Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|059160
Gene name
Locationscaffold_03a:1612528..1615005
Strand+
Gene length (bp)2477
Transcript length (bp)1626
Coding sequence length (bp)1626
Protein length (aa) 542

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 1.4E-51 98 400
PF09260 A_amylase_dom_C Alpha-amylase, domain C 1.7E-08 449 510

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01117|AMY1_LIPKO Alpha-amylase 1 OS=Lipomyces kononenkoae GN=LKA1 PE=1 SV=2 44 511 1.0E-118
sp|Q08806|AMY2_SCHOC Alpha-amylase 2 OS=Schwanniomyces occidentalis GN=SWA2 PE=3 SV=1 38 516 3.0E-113
sp|P19269|AMY1_SCHOC Alpha-amylase 1 OS=Schwanniomyces occidentalis GN=AMY1 PE=1 SV=1 58 516 6.0E-110
sp|P21567|AMY1_SACFI Alpha-amylase OS=Saccharomycopsis fibuligera GN=ALP1 PE=3 SV=1 57 492 8.0E-108
sp|O14154|MDE5_SCHPO Alpha-amylase mde5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde5 PE=2 SV=1 47 492 8.0E-107
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01117|AMY1_LIPKO Alpha-amylase 1 OS=Lipomyces kononenkoae GN=LKA1 PE=1 SV=2 44 511 1.0E-118
sp|Q08806|AMY2_SCHOC Alpha-amylase 2 OS=Schwanniomyces occidentalis GN=SWA2 PE=3 SV=1 38 516 3.0E-113
sp|P19269|AMY1_SCHOC Alpha-amylase 1 OS=Schwanniomyces occidentalis GN=AMY1 PE=1 SV=1 58 516 6.0E-110
sp|P21567|AMY1_SACFI Alpha-amylase OS=Saccharomycopsis fibuligera GN=ALP1 PE=3 SV=1 57 492 8.0E-108
sp|O14154|MDE5_SCHPO Alpha-amylase mde5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde5 PE=2 SV=1 47 492 8.0E-107
sp|Q09840|AMY2_SCHPO Alpha-amylase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah2 PE=1 SV=1 21 510 5.0E-106
sp|P0C1B4|AMYA3_ASPOR Alpha-amylase A type-3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy3 PE=3 SV=1 64 511 1.0E-105
sp|P30292|AMY_ASPSH Alpha-amylase OS=Aspergillus shirousami GN=amy PE=1 SV=1 64 511 7.0E-105
sp|P0C1B3|AMYA1_ASPOR Alpha-amylase A type-1/2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy1 PE=1 SV=1 64 511 1.0E-104
sp|Q02906|AMYB_ASPAW Alpha-amylase B OS=Aspergillus awamori GN=amyB PE=3 SV=1 64 511 1.0E-103
sp|Q02905|AMYA_ASPAW Alpha-amylase A OS=Aspergillus awamori GN=amyA PE=3 SV=1 64 511 2.0E-103
sp|O74922|AMY1_SCHPO Alpha-amylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah1 PE=3 SV=1 40 515 5.0E-98
sp|P56271|AMYA_ASPNG Acid alpha-amylase OS=Aspergillus niger PE=1 SV=1 60 511 1.0E-97
sp|O13996|YEI1_SCHPO Uncharacterized glycosyl hydrolase C27E2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.01 PE=3 SV=1 62 495 7.0E-92
sp|Q10427|YQ29_SCHPO Uncharacterized glycosyl hydrolase C11E10.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC11E10.09c PE=3 SV=1 64 491 6.0E-86
sp|Q9Y7S9|AMY3_SCHPO Alpha-amylase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aah3 PE=1 SV=1 49 510 7.0E-86
sp|P21543|AMYB_PAEPO Beta/alpha-amylase OS=Paenibacillus polymyxa PE=1 SV=1 64 428 4.0E-46
sp|O42918|AMY4_SCHPO Alpha-amylase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu7 PE=1 SV=1 146 466 4.0E-37
sp|P43379|CDGT2_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans GN=cgt PE=1 SV=1 39 427 5.0E-36
sp|P09121|CDGT_BACS3 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 38-2) GN=cgt PE=1 SV=2 69 427 2.0E-35
sp|P17692|CDGT_BACS8 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain B1018) GN=cgt PE=1 SV=1 35 427 9.0E-35
sp|P05618|CDGT_BACS0 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1011) GN=cgt PE=1 SV=1 69 427 1.0E-34
sp|P30921|CDGT_BAC11 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 17-1) GN=cgt PE=1 SV=1 69 427 1.0E-33
sp|P31747|CDGT_BACSS Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 6.6.3) GN=cgt PE=3 SV=1 69 522 1.0E-33
sp|P19531|AMYM_GEOSE Maltogenic alpha-amylase OS=Geobacillus stearothermophilus GN=amyM PE=1 SV=2 65 427 9.0E-33
sp|P30920|CDGT1_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans PE=1 SV=1 69 427 2.0E-32
sp|O42918|AMY4_SCHPO Alpha-amylase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu7 PE=1 SV=1 38 248 5.0E-32
sp|P08137|AMY_BACCI Alpha-amylase OS=Bacillus circulans PE=3 SV=1 69 427 8.0E-32
sp|P14014|CDGT_BACLI Cyclomaltodextrin glucanotransferase OS=Bacillus licheniformis GN=cgtA PE=3 SV=1 69 427 1.0E-31
sp|P31797|CDGT_GEOSE Cyclomaltodextrin glucanotransferase OS=Geobacillus stearothermophilus GN=cgt PE=1 SV=1 69 427 5.0E-30
sp|Q05884|AMY_STRLI Alpha-amylase OS=Streptomyces lividans GN=amy PE=1 SV=1 89 410 1.0E-28
sp|O30565|CDGT_BREBE Cyclomaltodextrin glucanotransferase OS=Brevibacillus brevis GN=cgt PE=3 SV=1 69 472 3.0E-27
sp|P31835|CDGT2_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans PE=1 SV=1 68 427 2.0E-26
sp|P26827|CDGT_THETU Cyclomaltodextrin glucanotransferase OS=Thermoanaerobacterium thermosulfurigenes GN=amyA PE=1 SV=2 69 427 2.0E-26
sp|P31746|CDGT_BACS2 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1-1) GN=cgt PE=1 SV=1 69 472 4.0E-26
sp|P27036|CDGT_BACOH Cyclomaltodextrin glucanotransferase OS=Bacillus ohbensis GN=cgt PE=3 SV=2 69 427 3.0E-25
sp|Q9R9H8|BBMA_BACIU Intracellular maltogenic amylase OS=Bacillus subtilis GN=bbmA PE=1 SV=2 56 427 6.0E-25
sp|O06988|BBMA_BACSU Intracellular maltogenic amylase OS=Bacillus subtilis (strain 168) GN=bbmA PE=3 SV=2 56 427 9.0E-25
sp|P04830|CDGT1_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans GN=cgtM PE=1 SV=2 40 427 1.0E-24
sp|Q08751|NEPU2_THEVU Neopullulanase 2 OS=Thermoactinomyces vulgaris GN=tvaII PE=1 SV=1 69 505 5.0E-22
sp|P38940|NEPU_GEOSE Neopullulanase OS=Geobacillus stearothermophilus GN=nplT PE=1 SV=1 70 428 7.0E-22
sp|P29964|CDAS_THEP3 Cyclomaltodextrinase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=Teth39_0676 PE=1 SV=2 69 466 2.0E-21
sp|P32818|AMYM_BACAD Maltogenic alpha-amylase OS=Bacillus acidopullulyticus PE=3 SV=1 61 427 2.0E-21
sp|Q08341|CDAS_LYSSH Cyclomaltodextrinase OS=Lysinibacillus sphaericus PE=1 SV=1 60 427 3.0E-20
sp|P14898|AMY2_DICT6 Alpha-amylase 2 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyB PE=1 SV=2 69 427 2.0E-19
sp|P14899|AMY3_DICT6 Alpha-amylase 3 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=amyC PE=3 SV=2 98 406 1.0E-18
sp|Q8A1G0|SUSA_BACTN Neopullulanase SusA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susA PE=3 SV=1 69 494 6.0E-18
sp|P20845|AMY_BACME Alpha-amylase OS=Bacillus megaterium PE=1 SV=1 98 406 3.0E-15
sp|O86959|AGLB_THENE Cyclomaltodextrinase OS=Thermotoga neapolitana GN=aglB PE=1 SV=1 82 454 7.0E-15
sp|P08704|CDGT_KLEOX Cyclomaltodextrin glucanotransferase OS=Klebsiella oxytoca GN=cgt PE=3 SV=1 45 427 2.0E-14
sp|P25718|AMY1_ECOLI Alpha-amylase OS=Escherichia coli (strain K12) GN=malS PE=1 SV=1 64 278 4.0E-14
sp|Q9X2F4|AGLB_THEMA Cyclomaltodextrinase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=aglB PE=1 SV=1 73 428 8.0E-14
sp|P38939|APU_THEP3 Amylopullulanase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=apu PE=1 SV=2 41 428 4.0E-13
sp|O05242|O16G3_BACSU Probable oligo-1,6-glucosidase 3 OS=Bacillus subtilis (strain 168) GN=yugT PE=3 SV=2 64 400 5.0E-12
sp|P36905|APU_THESA Amylopullulanase OS=Thermoanaerobacterium saccharolyticum GN=apu PE=3 SV=2 38 428 7.0E-12
sp|P38536|APU_THETU Amylopullulanase OS=Thermoanaerobacterium thermosulfurigenes GN=amyB PE=3 SV=2 41 428 5.0E-11
sp|P00692|AMY_BACAM Alpha-amylase OS=Bacillus amyloliquefaciens PE=1 SV=1 97 398 8.0E-10
sp|Q45101|O16G_BACCO Oligo-1,6-glucosidase OS=Bacillus coagulans GN=malL PE=3 SV=1 64 391 1.0E-09
sp|P16950|APU_THETY Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus GN=apu PE=1 SV=1 95 428 2.0E-09
sp|P21332|O16G_BACCE Oligo-1,6-glucosidase OS=Bacillus cereus GN=malL PE=1 SV=1 64 181 5.0E-09
sp|P23671|AMY_CLOAB Alpha-amylase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=amyA PE=3 SV=2 99 299 6.0E-09
sp|P27933|AMY3D_ORYSJ Alpha-amylase isozyme 3D OS=Oryza sativa subsp. japonica GN=AMY1.3 PE=2 SV=2 97 324 2.0E-08
sp|P00691|AMY_BACSU Alpha-amylase OS=Bacillus subtilis (strain 168) GN=amyE PE=1 SV=2 99 287 2.0E-08
sp|P06278|AMY_BACLI Alpha-amylase OS=Bacillus licheniformis GN=amyS PE=1 SV=1 97 398 2.0E-08
sp|Q8A1G3|SUSG_BACTN Alpha-amylase SusG OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susG PE=1 SV=1 56 182 3.0E-08
sp|Q9P6J3|MALT_SCHPO Alpha-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mal1 PE=2 SV=1 64 269 4.0E-08
sp|O06994|O16G1_BACSU Oligo-1,6-glucosidase 1 OS=Bacillus subtilis (strain 168) GN=malL PE=1 SV=1 64 182 4.0E-08
sp|P29093|O16G_BACF5 Oligo-1,6-glucosidase OS=Bacillus sp. (strain F5) GN=malL PE=1 SV=2 64 181 2.0E-07
sp|O34364|O16G2_BACSU Probable oligo-1,6-glucosidase 2 OS=Bacillus subtilis (strain 168) GN=ycdG PE=2 SV=1 61 426 2.0E-07
sp|Q54796|DEXB_STRPN Glucan 1,6-alpha-glucosidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dexB PE=3 SV=2 64 181 2.0E-07
sp|P30269|AMY_BUTFI Alpha-amylase OS=Butyrivibrio fibrisolvens GN=amyA PE=3 SV=1 94 310 3.0E-07
sp|L8B068|MALA_HALJP Alpha-amylase MalA OS=Haloarcula japonica GN=malA PE=1 SV=1 100 399 3.0E-07
sp|Q9K8U9|O16G_BACHD Oligo-1,6-glucosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=malL PE=3 SV=1 107 181 4.0E-07
sp|Q59905|DEXB_STREQ Glucan 1,6-alpha-glucosidase OS=Streptococcus dysgalactiae subsp. equisimilis GN=dexB PE=3 SV=1 64 391 7.0E-07
sp|P39795|TREC_BACSU Trehalose-6-phosphate hydrolase OS=Bacillus subtilis (strain 168) GN=treA PE=1 SV=2 98 182 1.0E-06
sp|P9WQ19|TRES_MYCTU Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=treS PE=1 SV=1 98 266 1.0E-06
sp|P9WQ18|TRES_MYCTO Trehalose synthase/amylase TreS OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=treS PE=3 SV=1 98 266 1.0E-06
sp|A0R6E0|TRES_MYCS2 Trehalose synthase/amylase TreS OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=treS PE=1 SV=1 98 266 1.0E-06
sp|Q94A41|AMY3_ARATH Alpha-amylase 3, chloroplastic OS=Arabidopsis thaliana GN=AMY3 PE=2 SV=1 103 285 1.0E-06
sp|O04196|ISOA1_ARATH Isoamylase 1, chloroplastic OS=Arabidopsis thaliana GN=ISA1 PE=1 SV=1 98 261 2.0E-06
sp|P17859|AMYA_VIGMU Alpha-amylase OS=Vigna mungo GN=AMY1.1 PE=2 SV=1 92 264 2.0E-06
sp|P40884|IMA5_YEAST Oligo-1,6-glucosidase IMA5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMA5 PE=2 SV=1 103 181 4.0E-06
sp|Q9Z3R8|AGLA_RHIME Probable alpha-glucosidase OS=Rhizobium meliloti (strain 1021) GN=aglA PE=3 SV=2 62 182 7.0E-06
sp|P29094|O16G_GEOTM Oligo-1,6-glucosidase OS=Geobacillus thermoglucosidasius GN=malL PE=1 SV=1 64 182 8.0E-06
sp|Q8VZ56|AMY1_ARATH Alpha-amylase 1 OS=Arabidopsis thaliana GN=AMY1 PE=1 SV=1 97 261 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016052 carbohydrate catabolic process Yes
GO:0005509 calcium ion binding Yes
GO:0004556 alpha-amylase activity Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0016787 hydrolase activity No
GO:0009056 catabolic process No
GO:0016160 amylase activity No
GO:0005488 binding No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0044238 primary metabolic process No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:1901575 organic substance catabolic process No
GO:0043167 ion binding No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.5

Transmembrane Domains

Domain # Start End Length
1 23 45 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|059160
MHHALSSCHVPYLREIKKSQRRSLCSLSTSLVVFYIPLSLAHSTISLSLFLLFSIARAATADQWRGRSIYQLITD
RFALPNGTDPSACDPAERAYCGGTWNTIRENLDYIQDAGFTAIWISPVNENYDGPRTVYGDAYHGYWIKDFSKLN
NRFGTADDLKALVAELHRREMYIMVDVVINNVMSTSLKPDYSQYFFEDSSMYHPYCPIQWGNTTSEQTCWLGDTK
VPLPDVNTSHPTVIAQYGDWIHDLVQEYQFDGLRIDAAKHVHVDFWPTFAAKAGVFCMGEVFSGVEVDPVAQYQG
PQGLDSVLNYPMYTALVEAFGIPGPGNITAVSTVIEQSQNSFHDTTVLGNFLENQDVPRWHNISVDPQSLYNAMV
LNFMMDGIPVVYYGQEQSFSGSSDPYNREPLWPSQYQQTDAYKFIQTLNQFRNYLVKTDWATQKTQILTASPYGI
AVMKGKIISVVTNIGSPPRNGTDIAVKSPFESSSSMINILTCQQWVVGSRGYLDVQYTKGVLQLWGILLARTLLH
LHSTRGVYPPPLCSLR*
Coding >Agabi119p4|059160
ATGCATCATGCTCTAAGCTCTTGCCATGTACCGTACCTACGGGAAATAAAGAAAAGCCAGCGACGCAGTCTATGC
TCCCTATCTACTTCCCTTGTCGTCTTCTATATACCCCTCTCACTGGCTCACTCAACCATCTCTCTCTCCCTCTTT
CTCCTTTTCAGCATCGCACGGGCCGCAACTGCGGACCAATGGCGTGGTCGTTCTATATACCAACTGATTACAGAC
CGCTTTGCTCTCCCCAATGGGACTGACCCCAGCGCTTGTGACCCAGCAGAACGAGCATACTGTGGTGGGACATGG
AATACGATACGCGAAAATCTTGACTACATTCAGGATGCTGGCTTTACCGCCATATGGATCAGTCCCGTGAATGAA
AACTATGATGGTCCCCGTACTGTGTATGGTGACGCATATCACGGCTATTGGATCAAAGACTTCAGTAAGCTCAAC
AATCGTTTCGGCACGGCCGATGATCTCAAGGCCCTGGTTGCGGAGCTCCATCGTCGCGAAATGTATATTATGGTT
GATGTTGTGATTAACAACGTCATGTCCACCTCGTTGAAGCCCGATTATTCTCAGTACTTTTTTGAAGACTCTTCC
ATGTATCATCCCTATTGTCCAATACAATGGGGTAATACTACCAGCGAACAAACTTGTTGGTTAGGAGACACCAAA
GTGCCTCTTCCTGACGTCAACACGAGTCATCCCACCGTTATTGCTCAATACGGGGACTGGATCCATGATCTTGTT
CAGGAGTACCAATTTGATGGGCTTCGCATTGACGCCGCCAAGCATGTACACGTCGATTTTTGGCCTACCTTTGCC
GCCAAGGCCGGGGTATTTTGCATGGGAGAAGTCTTTAGTGGAGTCGAAGTTGACCCTGTTGCACAATATCAAGGG
CCCCAAGGACTTGACTCCGTTCTCAACTATCCTATGTACACAGCTTTGGTAGAGGCATTTGGCATTCCTGGGCCT
GGTAATATAACCGCGGTTTCGACTGTAATTGAGCAGTCTCAAAACAGTTTTCATGACACCACCGTCCTAGGTAAT
TTTCTAGAAAACCAGGATGTTCCCCGCTGGCATAATATATCTGTTGATCCCCAAAGCCTATATAATGCCATGGTC
TTGAATTTCATGATGGATGGCATCCCCGTCGTATATTATGGACAAGAACAATCTTTCTCGGGTAGCTCTGACCCC
TACAACCGCGAACCCCTCTGGCCGTCTCAGTACCAGCAAACTGACGCCTATAAATTCATCCAGACCCTGAACCAA
TTTCGCAACTATCTAGTCAAAACAGATTGGGCGACGCAAAAGACTCAGATATTGACTGCGAGTCCTTATGGGATT
GCTGTAATGAAAGGAAAAATAATATCTGTCGTTACTAACATCGGTTCCCCCCCACGAAACGGGACTGATATCGCG
GTGAAGTCTCCTTTTGAATCTAGTTCAAGCATGATTAACATTTTGACTTGCCAACAATGGGTCGTGGGATCGAGA
GGCTATCTTGACGTCCAATATACCAAGGGGGTACTACAGTTGTGGGGAATTCTACTCGCCAGAACTCTGCTGCAT
CTTCACTCCACCCGTGGCGTTTATCCACCGCCGCTCTGTTCATTGCGTTGA
Transcript >Agabi119p4|059160
ATGCATCATGCTCTAAGCTCTTGCCATGTACCGTACCTACGGGAAATAAAGAAAAGCCAGCGACGCAGTCTATGC
TCCCTATCTACTTCCCTTGTCGTCTTCTATATACCCCTCTCACTGGCTCACTCAACCATCTCTCTCTCCCTCTTT
CTCCTTTTCAGCATCGCACGGGCCGCAACTGCGGACCAATGGCGTGGTCGTTCTATATACCAACTGATTACAGAC
CGCTTTGCTCTCCCCAATGGGACTGACCCCAGCGCTTGTGACCCAGCAGAACGAGCATACTGTGGTGGGACATGG
AATACGATACGCGAAAATCTTGACTACATTCAGGATGCTGGCTTTACCGCCATATGGATCAGTCCCGTGAATGAA
AACTATGATGGTCCCCGTACTGTGTATGGTGACGCATATCACGGCTATTGGATCAAAGACTTCAGTAAGCTCAAC
AATCGTTTCGGCACGGCCGATGATCTCAAGGCCCTGGTTGCGGAGCTCCATCGTCGCGAAATGTATATTATGGTT
GATGTTGTGATTAACAACGTCATGTCCACCTCGTTGAAGCCCGATTATTCTCAGTACTTTTTTGAAGACTCTTCC
ATGTATCATCCCTATTGTCCAATACAATGGGGTAATACTACCAGCGAACAAACTTGTTGGTTAGGAGACACCAAA
GTGCCTCTTCCTGACGTCAACACGAGTCATCCCACCGTTATTGCTCAATACGGGGACTGGATCCATGATCTTGTT
CAGGAGTACCAATTTGATGGGCTTCGCATTGACGCCGCCAAGCATGTACACGTCGATTTTTGGCCTACCTTTGCC
GCCAAGGCCGGGGTATTTTGCATGGGAGAAGTCTTTAGTGGAGTCGAAGTTGACCCTGTTGCACAATATCAAGGG
CCCCAAGGACTTGACTCCGTTCTCAACTATCCTATGTACACAGCTTTGGTAGAGGCATTTGGCATTCCTGGGCCT
GGTAATATAACCGCGGTTTCGACTGTAATTGAGCAGTCTCAAAACAGTTTTCATGACACCACCGTCCTAGGTAAT
TTTCTAGAAAACCAGGATGTTCCCCGCTGGCATAATATATCTGTTGATCCCCAAAGCCTATATAATGCCATGGTC
TTGAATTTCATGATGGATGGCATCCCCGTCGTATATTATGGACAAGAACAATCTTTCTCGGGTAGCTCTGACCCC
TACAACCGCGAACCCCTCTGGCCGTCTCAGTACCAGCAAACTGACGCCTATAAATTCATCCAGACCCTGAACCAA
TTTCGCAACTATCTAGTCAAAACAGATTGGGCGACGCAAAAGACTCAGATATTGACTGCGAGTCCTTATGGGATT
GCTGTAATGAAAGGAAAAATAATATCTGTCGTTACTAACATCGGTTCCCCCCCACGAAACGGGACTGATATCGCG
GTGAAGTCTCCTTTTGAATCTAGTTCAAGCATGATTAACATTTTGACTTGCCAACAATGGGTCGTGGGATCGAGA
GGCTATCTTGACGTCCAATATACCAAGGGGGTACTACAGTTGTGGGGAATTCTACTCGCCAGAACTCTGCTGCAT
CTTCACTCCACCCGTGGCGTTTATCCACCGCCGCTCTGTTCATTGCGTTGA
Gene >Agabi119p4|059160
ATGCATCATGCTCTAAGCTCTTGCCATGTACCGTACCTACGGGAAATAAAGAAAAGCCAGCGACGCAGTCTATGC
TCCCTATCTACTTCCCTTGTCGTCTTCTATATACCCCTCTCACTGGCTCACTCAAGTAGCCCATTCGTTGTATAT
CCCTCTCGTTTCTTATGCTTTCTCTAGCCATCTCTCTCTCCCTCTTTCTCCTTTTCAGCATCGCACGGGCCGCAA
CTGCGGACCAATGGCGTGGTCGTTCTATATACCAGTAAGAACCCCTGTTGTGGGCCGACTCTCTTTCGCTGACCC
ATGATCAACTAGACTGATTACAGACCGCTTTGCTCTCCCCAATGGGACTGACCCCAGCGCTTGTGACCCAGCAGA
ACGAGCATACTGTGGTGGGACATGGAATACGTGTGTTTTGTTCGAATCTCCCTTCCTACTAACTCACCTTAACTT
GGCATTAGGATACGCGAAAATCTTGACTACATTCAGGATGCTGGCTTTACCGCCAGTAAATCTCTTTCCTTTCCC
ATACTGTTGTTTCGGTCTGATCACGGCCGCTAGTATGGATCAGTCCCGTGAATGAAAACTATGATGGTCCCCGTA
CTGTGTATGGTGACGCATATCACGGCTATTGGATCAAAGACTTCAGTAAGCTCAACAATCGTTTCGGCACGGCCG
ATGATCTCAAGGCCCTGGTTGCGGAGCTCCATCGTCGCGAAATGTAAGTCGAAAATTTGACGTATGCCTTCTTCG
CACGACTGATGTCTTCTCACAGGTATATTATGGTTGATGTTGTGATTAACAACGTCATGTCCACCTCGTTGAAGC
CCGATTATTCTCAGTACTTTTTTGAAGACTCTGTAAGTATGACATTTCCCGCATCCCAGTATCTAACATTTCACA
GTCCATGTATCATCCCTATTGTCCAATACAATGGGGTAATACTACCAGCGAACAAACTTGTTGGTTAGGAGACAC
CAAAGTGCCTCTTCCTGACGTCAACACGAGTCATCCCACCGTTATTGCTCAATACGGGGACTGGATCCATGATCT
TGTTCAGGAGTACCAATTTGATGGGCTTCGCATTGACGGTAAGCCTCAAATATCTGTCGAATAGCTATAACGCTA
ATGCTCCTCCAAGCCGCCAAGTATGTCATGATCTTCGCAGCCACGCTTTGTTGTTGAGGTACTAACTTGTTTCGA
GGCATGTACACGTCGATTTTTGGCCTACCTTTGCCGCCAAGGCCGGGGTATTTTGCATGGGAGAAGTCTTTAGTG
GAGTCGAAGTTGAGTAAGTCGCGCTACACTTTTATTATCGTAGATGCAGCTCATCTCCCACCCAGCCCTGTTGCA
CAATATCAAGGGCCCCAAGGACTTGACTCCGTTCTCAACTATCCTATGTACACAGCTTTGGTAGAGGCATTTGGC
ATTCCTGGGCCTGGTAATATAACCGCGGTTTCGACTGTAATTGAGCAGTCTCAAAACAGTTTTCATGTACGTTGG
GTCCAAATATTGTTCTCCTTCATACTCGCTCATTTGAGTCAGGACACCACCGTCCTAGGTAATTTTCTAGAAAAC
CAGGATGTTCCCCGCTGGCATAATATATCTGTTGATCCCCAAAGCCTATAGTGAGGTGTTTATCCAACCACAGAT
CCAGTTTTCTGACCAATGCTGTTCAAGTAATGCCATGGTCTTGAATTTCATGATGGATGGCATCCCCGTCGTATA
TTATGGACAAGAACAATCTTTCTCGGGTAGCTCTGACCCCGTGTGTAATAATTATTTCATATACTCTACGGTCGT
CTCACATCCATAGTACAACCGCGAACCCCTCTGGCCGTCTCAGTACCAGCAAACTGACGCCTATAAATTCATCCA
GACCCTGAACCAAGTTCGTCACGAAGATCTATCCTCCTGAGACTGACGTTGACGTTGGACATAGTTTCGCAACTA
TCTAGTCAAAACAGATTGGGCGACGCAAAAGACTCAGATATTGACTGCGAGTCCTTATGGGATTGCTGTAATGAA
AGGAAAAATAATATCTGTCGTTACTAACATCGGTTCCCCCGTAGGTCCCCCAGACTTCATTATCCTGTACCACCA
GTTGAGCTGATGGCCCTTCCATTGCCAGCCACGAAACGGGACTGATATCGCGGTGAAGTCTCCTTTTGAATCTAG
TTCAAGCATGATTAAGTAAGTATATTCACACTTTCTATATGACAAGCGGATGAATATGACGAATTTGCTTAGCAT
TTTGACTTGCCAACAATGGGTCGTGGGATCGAGAGGCTATCTTGACGTCCAATATACCAAGGGGGGTCAGCCCGT
CATTCTTGCGCCAGCTGATTCACTCAATGACTCTGGCTTCTGTGGCAACACGCTCAGTACTACAGTTGTGGGGAA
TTCTACTCGCCAGAACTCTGCTGCATCTTCACTCCACCCGTGGCGTTTATCCACCGCCGCTCTGTTCATTGCGTT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail