Protein ID | Agabi119p4|058930 |
Gene name | |
Location | scaffold_03a:1558770..1559859 |
Strand | + |
Gene length (bp) | 1089 |
Transcript length (bp) | 834 |
Coding sequence length (bp) | 834 |
Protein length (aa) | 278 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF16123 | HAGH_C | Hydroxyacylglutathione hydrolase C-terminus | 1.6E-21 | 189 | 270 |
PF00753 | Lactamase_B | Metallo-beta-lactamase superfamily | 2.4E-08 | 58 | 188 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q3B7M2|GLO2_BOVIN | Hydroxyacylglutathione hydrolase, mitochondrial OS=Bos taurus GN=HAGH PE=2 SV=3 | 13 | 271 | 1.0E-62 |
sp|Q6P963|GLO2_DANRE | Hydroxyacylglutathione hydrolase, mitochondrial OS=Danio rerio GN=hagh PE=2 SV=2 | 13 | 271 | 8.0E-62 |
sp|Q5ZI23|GLO2_CHICK | Hydroxyacylglutathione hydrolase, mitochondrial OS=Gallus gallus GN=HAGH PE=2 SV=1 | 10 | 271 | 6.0E-61 |
sp|B4F6K2|GLO2_XENTR | Hydroxyacylglutathione hydrolase, mitochondrial OS=Xenopus tropicalis GN=hagh PE=2 SV=1 | 13 | 271 | 6.0E-60 |
sp|Q99KB8|GLO2_MOUSE | Hydroxyacylglutathione hydrolase, mitochondrial OS=Mus musculus GN=Hagh PE=1 SV=2 | 13 | 271 | 7.0E-60 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q3B7M2|GLO2_BOVIN | Hydroxyacylglutathione hydrolase, mitochondrial OS=Bos taurus GN=HAGH PE=2 SV=3 | 13 | 271 | 1.0E-62 |
sp|Q6P963|GLO2_DANRE | Hydroxyacylglutathione hydrolase, mitochondrial OS=Danio rerio GN=hagh PE=2 SV=2 | 13 | 271 | 8.0E-62 |
sp|Q5ZI23|GLO2_CHICK | Hydroxyacylglutathione hydrolase, mitochondrial OS=Gallus gallus GN=HAGH PE=2 SV=1 | 10 | 271 | 6.0E-61 |
sp|B4F6K2|GLO2_XENTR | Hydroxyacylglutathione hydrolase, mitochondrial OS=Xenopus tropicalis GN=hagh PE=2 SV=1 | 13 | 271 | 6.0E-60 |
sp|Q99KB8|GLO2_MOUSE | Hydroxyacylglutathione hydrolase, mitochondrial OS=Mus musculus GN=Hagh PE=1 SV=2 | 13 | 271 | 7.0E-60 |
sp|Q16775|GLO2_HUMAN | Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens GN=HAGH PE=1 SV=2 | 13 | 271 | 3.0E-58 |
sp|Q4R6C1|GLO2_MACFA | Hydroxyacylglutathione hydrolase, mitochondrial OS=Macaca fascicularis GN=HAGH PE=2 SV=2 | 13 | 271 | 1.0E-57 |
sp|O35952|GLO2_RAT | Hydroxyacylglutathione hydrolase, mitochondrial OS=Rattus norvegicus GN=Hagh PE=1 SV=2 | 13 | 271 | 2.0E-57 |
sp|O24496|GLO2C_ARATH | Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana GN=GLX2-2 PE=1 SV=2 | 13 | 272 | 5.0E-57 |
sp|O94250|GLO22_SCHPO | Probable hydroxyacylglutathione hydrolase C13B11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC13B11.03c PE=3 SV=1 | 13 | 268 | 1.0E-56 |
sp|Q28333|GLO2_CALJA | Hydroxyacylglutathione hydrolase, mitochondrial (Fragment) OS=Callithrix jacchus GN=HAGH PE=2 SV=2 | 13 | 271 | 7.0E-56 |
sp|Q9UT36|GLO21_SCHPO | Probable hydroxyacylglutathione hydrolase C824.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC824.07 PE=3 SV=1 | 23 | 268 | 5.0E-53 |
sp|Q5ZLY2|HAGHL_CHICK | Hydroxyacylglutathione hydrolase-like protein OS=Gallus gallus GN=HAGHL PE=2 SV=1 | 13 | 271 | 3.0E-50 |
sp|Q8N490|PNKD_HUMAN | Probable hydrolase PNKD OS=Homo sapiens GN=PNKD PE=1 SV=2 | 13 | 268 | 3.0E-49 |
sp|A7YY46|PNKD_BOVIN | Probable hydrolase PNKD OS=Bos taurus GN=PNKD PE=2 SV=1 | 13 | 238 | 4.0E-49 |
sp|Q69ZP3|PNKD_MOUSE | Probable hydrolase PNKD OS=Mus musculus GN=Pnkd PE=1 SV=2 | 13 | 268 | 6.0E-49 |
sp|A4G7G5|GLO2_HERAR | Hydroxyacylglutathione hydrolase OS=Herminiimonas arsenicoxydans GN=gloB PE=3 SV=1 | 13 | 271 | 3.0E-48 |
sp|Q9DB32|HAGHL_MOUSE | Hydroxyacylglutathione hydrolase-like protein OS=Mus musculus GN=Haghl PE=1 SV=1 | 13 | 271 | 1.0E-45 |
sp|Q05584|GLO2_YEAST | Hydroxyacylglutathione hydrolase, cytoplasmic isozyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO2 PE=1 SV=1 | 13 | 270 | 2.0E-44 |
sp|Q7NG34|GLO2_GLOVI | Hydroxyacylglutathione hydrolase OS=Gloeobacter violaceus (strain PCC 7421) GN=gloB PE=3 SV=1 | 22 | 270 | 1.0E-43 |
sp|Q1QW62|GLO2_CHRSD | Hydroxyacylglutathione hydrolase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-43 |
sp|Q5N5S6|GLO2_SYNP6 | Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gloB PE=3 SV=2 | 13 | 270 | 3.0E-43 |
sp|Q31ND6|GLO2_SYNE7 | Hydroxyacylglutathione hydrolase OS=Synechococcus elongatus (strain PCC 7942) GN=gloB PE=3 SV=1 | 13 | 270 | 3.0E-43 |
sp|Q60BX0|GLO2_METCA | Hydroxyacylglutathione hydrolase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gloB PE=3 SV=1 | 13 | 272 | 3.0E-42 |
sp|Q8YZ99|GLO2_NOSS1 | Hydroxyacylglutathione hydrolase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gloB PE=3 SV=1 | 13 | 250 | 3.0E-42 |
sp|Q6PII5|HAGHL_HUMAN | Hydroxyacylglutathione hydrolase-like protein OS=Homo sapiens GN=HAGHL PE=2 SV=1 | 13 | 203 | 4.0E-42 |
sp|Q3MGD2|GLO2_ANAVT | Hydroxyacylglutathione hydrolase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gloB PE=3 SV=1 | 13 | 250 | 4.0E-42 |
sp|B2IVH7|GLO2_NOSP7 | Hydroxyacylglutathione hydrolase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-42 |
sp|B1WUT9|GLO2_CYAA5 | Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain ATCC 51142) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-42 |
sp|Q2JPX4|GLO2_SYNJB | Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-42 |
sp|Q54MR1|GLO2_DICDI | Hydroxyacylglutathione hydrolase OS=Dictyostelium discoideum GN=hagh PE=3 SV=1 | 13 | 270 | 6.0E-42 |
sp|Q2JVC3|GLO2_SYNJA | Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain JA-3-3Ab) GN=gloB PE=3 SV=1 | 13 | 270 | 6.0E-42 |
sp|P72933|GLO2_SYNY3 | Hydroxyacylglutathione hydrolase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gloB PE=3 SV=1 | 13 | 270 | 7.0E-42 |
sp|Q5ZVZ3|GLO2_LEGPH | Hydroxyacylglutathione hydrolase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gloB PE=3 SV=1 | 13 | 271 | 1.0E-41 |
sp|A5IBE7|GLO2_LEGPC | Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Corby) GN=gloB PE=3 SV=1 | 13 | 271 | 2.0E-41 |
sp|Q3BWP5|GLO2_XANC5 | Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gloB PE=3 SV=1 | 13 | 271 | 2.0E-41 |
sp|Q5X5R2|GLO2_LEGPA | Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Paris) GN=gloB PE=3 SV=1 | 13 | 271 | 3.0E-41 |
sp|Q5WX41|GLO2_LEGPL | Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Lens) GN=gloB PE=3 SV=1 | 13 | 271 | 3.0E-41 |
sp|C4K7Z9|GLO2_HAMD5 | Hydroxyacylglutathione hydrolase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-40 |
sp|Q8PNI0|GLO2_XANAC | Hydroxyacylglutathione hydrolase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gloB PE=3 SV=1 | 13 | 272 | 1.0E-40 |
sp|Q0A751|GLO2_ALKEH | Hydroxyacylglutathione hydrolase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gloB PE=3 SV=1 | 14 | 245 | 2.0E-40 |
sp|B7K3R6|GLO2_CYAP8 | Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain PCC 8801) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-39 |
sp|Q8PBY0|GLO2_XANCP | Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gloB PE=3 SV=1 | 13 | 272 | 2.0E-39 |
sp|B0RTE9|GLO2_XANCB | Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. campestris (strain B100) GN=gloB PE=3 SV=1 | 13 | 272 | 2.0E-39 |
sp|Q4URM1|GLO2_XANC8 | Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gloB PE=3 SV=1 | 13 | 272 | 2.0E-39 |
sp|Q8LDW8|GLO2D_ARATH | Probable hydroxyacylglutathione hydrolase 2, chloroplastic OS=Arabidopsis thaliana GN=GLX2-4 PE=2 SV=1 | 3 | 272 | 2.0E-39 |
sp|B7KEB4|GLO2_CYAP7 | Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain PCC 7424) GN=gloB PE=3 SV=1 | 13 | 270 | 7.0E-39 |
sp|B5F9V3|GLO2_VIBFM | Hydroxyacylglutathione hydrolase OS=Vibrio fischeri (strain MJ11) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-38 |
sp|Q8FYE7|GLO2_BRUSU | Hydroxyacylglutathione hydrolase OS=Brucella suis biovar 1 (strain 1330) GN=gloB PE=3 SV=1 | 9 | 270 | 1.0E-38 |
sp|A5VSR1|GLO2_BRUO2 | Hydroxyacylglutathione hydrolase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gloB PE=3 SV=2 | 9 | 270 | 1.0E-38 |
sp|Q8YJF4|GLO2_BRUME | Hydroxyacylglutathione hydrolase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gloB PE=3 SV=1 | 9 | 270 | 1.0E-38 |
sp|Q57AW2|GLO2_BRUAB | Hydroxyacylglutathione hydrolase OS=Brucella abortus biovar 1 (strain 9-941) GN=gloB PE=3 SV=1 | 9 | 270 | 1.0E-38 |
sp|Q2YLU8|GLO2_BRUA2 | Hydroxyacylglutathione hydrolase OS=Brucella abortus (strain 2308) GN=gloB PE=3 SV=1 | 9 | 270 | 1.0E-38 |
sp|Q5E3G3|GLO2_VIBF1 | Hydroxyacylglutathione hydrolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gloB PE=3 SV=2 | 13 | 270 | 1.0E-38 |
sp|B0CIU0|GLO2_BRUSI | Hydroxyacylglutathione hydrolase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gloB PE=3 SV=1 | 9 | 270 | 1.0E-38 |
sp|C0RFI1|GLO2_BRUMB | Hydroxyacylglutathione hydrolase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gloB PE=3 SV=1 | 9 | 270 | 1.0E-38 |
sp|A9M8S2|GLO2_BRUC2 | Hydroxyacylglutathione hydrolase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gloB PE=3 SV=1 | 9 | 270 | 1.0E-38 |
sp|B2S889|GLO2_BRUA1 | Hydroxyacylglutathione hydrolase OS=Brucella abortus (strain S19) GN=gloB PE=3 SV=1 | 9 | 270 | 1.0E-38 |
sp|B0BZI8|GLO2_ACAM1 | Hydroxyacylglutathione hydrolase OS=Acaryochloris marina (strain MBIC 11017) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-38 |
sp|A5GJK5|GLO2_SYNPW | Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain WH7803) GN=gloB PE=3 SV=1 | 7 | 272 | 4.0E-38 |
sp|C3LPP0|GLO2_VIBCM | Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-38 |
sp|Q9KPX6|GLO2_VIBCH | Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-38 |
sp|A5F635|GLO2_VIBC3 | Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-38 |
sp|Q13F06|GLO2_RHOPS | Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisB5) GN=gloB PE=3 SV=1 | 18 | 269 | 6.0E-38 |
sp|B0JW10|GLO2_MICAN | Hydroxyacylglutathione hydrolase OS=Microcystis aeruginosa (strain NIES-843) GN=gloB PE=3 SV=1 | 13 | 270 | 7.0E-38 |
sp|Q0AM20|GLO2_MARMM | Hydroxyacylglutathione hydrolase OS=Maricaulis maris (strain MCS10) GN=gloB PE=3 SV=1 | 11 | 270 | 1.0E-37 |
sp|A1U0V1|GLO2_MARHV | Hydroxyacylglutathione hydrolase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-37 |
sp|B6EJV4|GLO2_ALISL | Hydroxyacylglutathione hydrolase OS=Aliivibrio salmonicida (strain LFI1238) GN=gloB PE=3 SV=1 | 18 | 270 | 2.0E-37 |
sp|Q12320|GLO4_YEAST | Hydroxyacylglutathione hydrolase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO4 PE=3 SV=1 | 13 | 268 | 4.0E-37 |
sp|Q8DIF1|GLO2_THEEB | Hydroxyacylglutathione hydrolase OS=Thermosynechococcus elongatus (strain BP-1) GN=gloB PE=3 SV=1 | 13 | 270 | 4.0E-37 |
sp|Q9SID3|GLO2N_ARATH | Hydroxyacylglutathione hydrolase 2, mitochondrial OS=Arabidopsis thaliana GN=At2g31350 PE=1 SV=1 | 13 | 270 | 5.0E-37 |
sp|B8HMJ9|GLO2_CYAP4 | Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=gloB PE=3 SV=1 | 13 | 246 | 5.0E-37 |
sp|C6DC67|GLO2_PECCP | Hydroxyacylglutathione hydrolase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-37 |
sp|A6WXE0|GLO2_OCHA4 | Hydroxyacylglutathione hydrolase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gloB PE=3 SV=1 | 9 | 270 | 7.0E-37 |
sp|Q87MG0|GLO2_VIBPA | Hydroxyacylglutathione hydrolase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-36 |
sp|A1JKA9|GLO2_YERE8 | Hydroxyacylglutathione hydrolase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-36 |
sp|Q46Z82|GLO2_CUPPJ | Hydroxyacylglutathione hydrolase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=gloB PE=3 SV=1 | 13 | 271 | 1.0E-36 |
sp|B1JBN3|GLO2_PSEPW | Hydroxyacylglutathione hydrolase OS=Pseudomonas putida (strain W619) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-36 |
sp|Q2RP80|GLO2_RHORT | Hydroxyacylglutathione hydrolase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-36 |
sp|Q6G1L3|GLO2_BARHE | Hydroxyacylglutathione hydrolase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gloB PE=3 SV=1 | 13 | 270 | 3.0E-36 |
sp|Q10Y41|GLO2_TRIEI | Hydroxyacylglutathione hydrolase OS=Trichodesmium erythraeum (strain IMS101) GN=gloB PE=3 SV=1 | 13 | 245 | 3.0E-36 |
sp|Q6NC62|GLO2_RHOPA | Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gloB PE=3 SV=1 | 18 | 269 | 3.0E-36 |
sp|Q87YS8|GLO2_PSESM | Hydroxyacylglutathione hydrolase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-36 |
sp|Q2J429|GLO2_RHOP2 | Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain HaA2) GN=gloB PE=3 SV=1 | 18 | 269 | 5.0E-36 |
sp|O24495|GLO2M_ARATH | Hydroxyacylglutathione hydrolase 1, mitochondrial OS=Arabidopsis thaliana GN=GLX2-1 PE=2 SV=2 | 7 | 270 | 6.0E-36 |
sp|Q26547|GLO2_SCHMA | Probable hydroxyacylglutathione hydrolase OS=Schistosoma mansoni PE=2 SV=1 | 41 | 270 | 8.0E-36 |
sp|Q7V6G8|GLO2_PROMM | Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9313) GN=gloB PE=3 SV=1 | 12 | 241 | 9.0E-36 |
sp|B0TRL8|GLO2_SHEHH | Hydroxyacylglutathione hydrolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-35 |
sp|A4SPI6|GLO2_AERS4 | Hydroxyacylglutathione hydrolase OS=Aeromonas salmonicida (strain A449) GN=gloB PE=3 SV=1 | 15 | 245 | 1.0E-35 |
sp|Q8DBD8|GLO2_VIBVU | Hydroxyacylglutathione hydrolase OS=Vibrio vulnificus (strain CMCP6) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-35 |
sp|Q7MII4|GLO22_VIBVY | Hydroxyacylglutathione hydrolase 2 OS=Vibrio vulnificus (strain YJ016) GN=gloB2 PE=3 SV=1 | 13 | 270 | 1.0E-35 |
sp|A9BEI3|GLO2_PROM4 | Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9211) GN=gloB PE=3 SV=1 | 18 | 238 | 2.0E-35 |
sp|Q92MF8|GLO2_RHIME | Hydroxyacylglutathione hydrolase OS=Rhizobium meliloti (strain 1021) GN=gloB PE=3 SV=1 | 20 | 270 | 2.0E-35 |
sp|A6T510|GLO2_KLEP7 | Hydroxyacylglutathione hydrolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-35 |
sp|Q48KX8|GLO2_PSE14 | Hydroxyacylglutathione hydrolase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-35 |
sp|Q6D1V5|GLO2_PECAS | Hydroxyacylglutathione hydrolase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-35 |
sp|A9IZW8|GLO2_BART1 | Hydroxyacylglutathione hydrolase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-35 |
sp|B5Y1G4|GLO2_KLEP3 | Hydroxyacylglutathione hydrolase OS=Klebsiella pneumoniae (strain 342) GN=gloB PE=3 SV=1 | 13 | 270 | 6.0E-35 |
sp|C5BEP2|GLO2_EDWI9 | Hydroxyacylglutathione hydrolase OS=Edwardsiella ictaluri (strain 93-146) GN=gloB PE=3 SV=1 | 13 | 270 | 8.0E-35 |
sp|A1WXD9|GLO2_HALHL | Hydroxyacylglutathione hydrolase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gloB PE=3 SV=1 | 17 | 249 | 1.0E-34 |
sp|A8H589|GLO2_SHEPA | Hydroxyacylglutathione hydrolase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-34 |
sp|A7MY07|GLO2_VIBCB | Hydroxyacylglutathione hydrolase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-34 |
sp|Q5QZL0|GLO2_IDILO | Hydroxyacylglutathione hydrolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gloB PE=3 SV=1 | 13 | 269 | 2.0E-34 |
sp|B7VIP5|GLO2_VIBTL | Hydroxyacylglutathione hydrolase OS=Vibrio tasmaniensis (strain LGP32) GN=gloB PE=3 SV=1 | 13 | 270 | 3.0E-34 |
sp|A4TL56|GLO2_YERPP | Hydroxyacylglutathione hydrolase OS=Yersinia pestis (strain Pestoides F) GN=gloB PE=3 SV=1 | 13 | 270 | 4.0E-34 |
sp|Q8U9W1|GLO2_AGRFC | Hydroxyacylglutathione hydrolase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gloB PE=3 SV=2 | 20 | 270 | 4.0E-34 |
sp|A5W167|GLO2_PSEP1 | Hydroxyacylglutathione hydrolase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gloB PE=3 SV=1 | 13 | 270 | 4.0E-34 |
sp|Q4ZVL3|GLO2_PSEU2 | Hydroxyacylglutathione hydrolase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gloB PE=3 SV=1 | 13 | 270 | 4.0E-34 |
sp|Q3KE79|GLO2_PSEPF | Hydroxyacylglutathione hydrolase OS=Pseudomonas fluorescens (strain Pf0-1) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-34 |
sp|Q1CFI4|GLO2_YERPN | Hydroxyacylglutathione hydrolase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gloB PE=3 SV=1 | 13 | 270 | 6.0E-34 |
sp|Q0WHW5|GLO2_YERPE | Hydroxyacylglutathione hydrolase OS=Yersinia pestis GN=gloB PE=3 SV=1 | 13 | 270 | 6.0E-34 |
sp|Q1CAJ7|GLO2_YERPA | Hydroxyacylglutathione hydrolase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gloB PE=3 SV=1 | 13 | 270 | 6.0E-34 |
sp|A4W6V2|GLO2_ENT38 | Hydroxyacylglutathione hydrolase OS=Enterobacter sp. (strain 638) GN=gloB PE=3 SV=1 | 13 | 270 | 7.0E-34 |
sp|Q0AE32|GLO2_NITEC | Hydroxyacylglutathione hydrolase OS=Nitrosomonas eutropha (strain C91) GN=gloB PE=3 SV=1 | 13 | 271 | 7.0E-34 |
sp|B1JR44|GLO2_YERPY | Hydroxyacylglutathione hydrolase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gloB PE=3 SV=1 | 13 | 270 | 7.0E-34 |
sp|Q667M5|GLO2_YERPS | Hydroxyacylglutathione hydrolase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gloB PE=3 SV=1 | 13 | 270 | 7.0E-34 |
sp|B2KAD1|GLO2_YERPB | Hydroxyacylglutathione hydrolase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gloB PE=3 SV=1 | 13 | 270 | 7.0E-34 |
sp|A7FFK5|GLO2_YERP3 | Hydroxyacylglutathione hydrolase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gloB PE=3 SV=1 | 13 | 270 | 7.0E-34 |
sp|Q9JXK4|GLO2_NEIMB | Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gloB PE=3 SV=1 | 13 | 271 | 9.0E-34 |
sp|A9M0M3|GLO2_NEIM0 | Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gloB PE=3 SV=1 | 13 | 271 | 9.0E-34 |
sp|Q89XT5|GLO2_BRADU | Hydroxyacylglutathione hydrolase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gloB PE=3 SV=1 | 23 | 268 | 1.0E-33 |
sp|Q6LN63|GLO2_PHOPR | Hydroxyacylglutathione hydrolase OS=Photobacterium profundum GN=gloB PE=3 SV=2 | 13 | 270 | 1.0E-33 |
sp|Q1LL91|GLO2_CUPMC | Hydroxyacylglutathione hydrolase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=gloB PE=3 SV=1 | 13 | 271 | 1.0E-33 |
sp|Q3SIB0|GLO2_THIDA | Hydroxyacylglutathione hydrolase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gloB PE=3 SV=1 | 13 | 272 | 1.0E-33 |
sp|Q4FP49|GLO2_PELUB | Hydroxyacylglutathione hydrolase OS=Pelagibacter ubique (strain HTCC1062) GN=gloB PE=3 SV=1 | 13 | 238 | 1.0E-33 |
sp|A1KW76|GLO2_NEIMF | Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gloB PE=3 SV=1 | 13 | 271 | 2.0E-33 |
sp|Q9PBI4|GLO2_XYLFA | Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain 9a5c) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-33 |
sp|A4XU09|GLO2_PSEMY | Hydroxyacylglutathione hydrolase OS=Pseudomonas mendocina (strain ymp) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-33 |
sp|Q21YF8|GLO2_RHOFT | Hydroxyacylglutathione hydrolase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gloB PE=3 SV=2 | 13 | 270 | 2.0E-33 |
sp|Q07VA9|GLO2_RHOP5 | Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisA53) GN=gloB PE=3 SV=1 | 23 | 269 | 3.0E-33 |
sp|Q3AL08|GLO2_SYNSC | Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain CC9605) GN=gloB PE=3 SV=1 | 18 | 241 | 3.0E-33 |
sp|B4RJC7|GLO2_NEIG2 | Hydroxyacylglutathione hydrolase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gloB PE=3 SV=1 | 13 | 271 | 4.0E-33 |
sp|B0UBD0|GLO2_METS4 | Hydroxyacylglutathione hydrolase OS=Methylobacterium sp. (strain 4-46) GN=gloB PE=3 SV=1 | 21 | 270 | 4.0E-33 |
sp|B3R1Y0|GLO2_CUPTR | Hydroxyacylglutathione hydrolase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=gloB PE=3 SV=1 | 13 | 271 | 5.0E-33 |
sp|A1IPQ8|GLO2_NEIMA | Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gloB PE=3 SV=1 | 13 | 270 | 6.0E-33 |
sp|A5ETG1|GLO2_BRASB | Hydroxyacylglutathione hydrolase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gloB PE=3 SV=1 | 23 | 269 | 6.0E-33 |
sp|P05446|GLO2_RHOBL | Hydroxyacylglutathione hydrolase OS=Rhodobacter blasticus GN=gloB PE=3 SV=1 | 13 | 270 | 6.0E-33 |
sp|B0U365|GLO2_XYLFM | Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain M12) GN=gloB PE=3 SV=1 | 13 | 270 | 7.0E-33 |
sp|Q3SVQ1|GLO2_NITWN | Hydroxyacylglutathione hydrolase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gloB PE=3 SV=1 | 23 | 269 | 8.0E-33 |
sp|Q88FF3|GLO2_PSEPK | Hydroxyacylglutathione hydrolase OS=Pseudomonas putida (strain KT2440) GN=gloB PE=3 SV=1 | 13 | 270 | 9.0E-33 |
sp|Q87C74|GLO2_XYLFT | Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=gloB PE=3 SV=1 | 13 | 270 | 9.0E-33 |
sp|B2I5S5|GLO2_XYLF2 | Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain M23) GN=gloB PE=3 SV=1 | 13 | 270 | 9.0E-33 |
sp|Q0I8S8|GLO2_SYNS3 | Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain CC9311) GN=gloB PE=3 SV=2 | 17 | 272 | 1.0E-32 |
sp|Q5F7J0|GLO2_NEIG1 | Hydroxyacylglutathione hydrolase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gloB PE=3 SV=1 | 13 | 271 | 1.0E-32 |
sp|A3QET2|GLO2_SHELP | Hydroxyacylglutathione hydrolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gloB PE=3 SV=1 | 15 | 270 | 1.0E-32 |
sp|A1S6T3|GLO2_SHEAM | Hydroxyacylglutathione hydrolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-32 |
sp|B0KN02|GLO2_PSEPG | Hydroxyacylglutathione hydrolase OS=Pseudomonas putida (strain GB-1) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-32 |
sp|Q82XW0|GLO2_NITEU | Hydroxyacylglutathione hydrolase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gloB PE=3 SV=1 | 13 | 272 | 2.0E-32 |
sp|Q4KBH9|GLO2_PSEF5 | Hydroxyacylglutathione hydrolase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-32 |
sp|Q6FYC3|GLO2_BARQU | Hydroxyacylglutathione hydrolase OS=Bartonella quintana (strain Toulouse) GN=gloB PE=3 SV=1 | 13 | 270 | 3.0E-32 |
sp|Q21C03|GLO2_RHOPB | Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisB18) GN=gloB PE=3 SV=1 | 22 | 269 | 5.0E-32 |
sp|Q98G02|GLO2_RHILO | Hydroxyacylglutathione hydrolase OS=Rhizobium loti (strain MAFF303099) GN=gloB PE=3 SV=1 | 21 | 270 | 5.0E-32 |
sp|Q1H188|GLO2_METFK | Hydroxyacylglutathione hydrolase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-32 |
sp|A4Y6B8|GLO2_SHEPC | Hydroxyacylglutathione hydrolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gloB PE=3 SV=1 | 13 | 263 | 7.0E-32 |
sp|A6VVZ9|GLO2_MARMS | Hydroxyacylglutathione hydrolase OS=Marinomonas sp. (strain MWYL1) GN=gloB PE=3 SV=1 | 13 | 238 | 8.0E-32 |
sp|A2C7W3|GLO2_PROM3 | Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9303) GN=gloB PE=3 SV=1 | 12 | 271 | 8.0E-32 |
sp|A4YKS8|GLO2_BRASO | Hydroxyacylglutathione hydrolase OS=Bradyrhizobium sp. (strain ORS278) GN=gloB PE=3 SV=1 | 23 | 269 | 1.0E-31 |
sp|B8ICA2|GLO2_METNO | Hydroxyacylglutathione hydrolase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=gloB PE=3 SV=1 | 21 | 270 | 1.0E-31 |
sp|Q162S3|GLO2_ROSDO | Hydroxyacylglutathione hydrolase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-31 |
sp|A1SS88|GLO2_PSYIN | Hydroxyacylglutathione hydrolase OS=Psychromonas ingrahamii (strain 37) GN=gloB PE=3 SV=1 | 15 | 270 | 1.0E-31 |
sp|Q8Z983|GLO2_SALTI | Hydroxyacylglutathione hydrolase OS=Salmonella typhi GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-31 |
sp|Q31H51|GLO2_THICR | Hydroxyacylglutathione hydrolase OS=Thiomicrospira crunogena (strain XCL-2) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-31 |
sp|B2VHJ7|GLO2_ERWT9 | Hydroxyacylglutathione hydrolase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-31 |
sp|Q21J46|GLO2_SACD2 | Hydroxyacylglutathione hydrolase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gloB PE=3 SV=1 | 9 | 270 | 2.0E-31 |
sp|Q12BV7|GLO2_POLSJ | Hydroxyacylglutathione hydrolase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=gloB PE=3 SV=1 | 24 | 270 | 2.0E-31 |
sp|Q9CMW8|GLO2_PASMU | Hydroxyacylglutathione hydrolase OS=Pasteurella multocida (strain Pm70) GN=gloB PE=3 SV=1 | 15 | 237 | 2.0E-31 |
sp|A1RK78|GLO2_SHESW | Hydroxyacylglutathione hydrolase OS=Shewanella sp. (strain W3-18-1) GN=gloB PE=3 SV=1 | 13 | 263 | 3.0E-31 |
sp|Q7VD23|GLO2_PROMA | Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gloB PE=3 SV=1 | 17 | 241 | 4.0E-31 |
sp|Q28TK3|GLO2_JANSC | Hydroxyacylglutathione hydrolase OS=Jannaschia sp. (strain CCS1) GN=gloB PE=3 SV=1 | 14 | 270 | 4.0E-31 |
sp|B4SLN7|GLO2_STRM5 | Hydroxyacylglutathione hydrolase OS=Stenotrophomonas maltophilia (strain R551-3) GN=gloB PE=3 SV=1 | 13 | 272 | 4.0E-31 |
sp|B2FR57|GLO2_STRMK | Hydroxyacylglutathione hydrolase OS=Stenotrophomonas maltophilia (strain K279a) GN=gloB PE=3 SV=1 | 13 | 272 | 5.0E-31 |
sp|Q5LNN5|GLO2_RUEPO | Hydroxyacylglutathione hydrolase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-31 |
sp|A0KIK2|GLO2_AERHH | Hydroxyacylglutathione hydrolase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=gloB PE=3 SV=1 | 15 | 270 | 6.0E-31 |
sp|B1XQ70|GLO2_SYNP2 | Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gloB PE=3 SV=1 | 13 | 270 | 7.0E-31 |
sp|Q3IIR9|GLO2_PSEHT | Hydroxyacylglutathione hydrolase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gloB PE=3 SV=1 | 13 | 246 | 8.0E-31 |
sp|Q11DS3|GLO2_CHESB | Hydroxyacylglutathione hydrolase OS=Chelativorans sp. (strain BNC1) GN=gloB PE=3 SV=1 | 20 | 270 | 2.0E-30 |
sp|Q1I7T2|GLO2_PSEE4 | Hydroxyacylglutathione hydrolase OS=Pseudomonas entomophila (strain L48) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-30 |
sp|Q47FN7|GLO2_DECAR | Hydroxyacylglutathione hydrolase OS=Dechloromonas aromatica (strain RCB) GN=gloB PE=3 SV=1 | 13 | 266 | 2.0E-30 |
sp|Q2P6Y4|GLO2_XANOM | Hydroxyacylglutathione hydrolase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gloB PE=3 SV=1 | 13 | 270 | 3.0E-30 |
sp|B8E5A2|GLO2_SHEB2 | Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS223) GN=gloB PE=3 SV=1 | 13 | 270 | 3.0E-30 |
sp|A9L0E9|GLO2_SHEB9 | Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS195) GN=gloB PE=3 SV=1 | 13 | 244 | 3.0E-30 |
sp|A4WUN2|GLO2_RHOS5 | Hydroxyacylglutathione hydrolase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-30 |
sp|C4LC58|GLO2_TOLAT | Hydroxyacylglutathione hydrolase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-30 |
sp|A3PIB4|GLO2_RHOS1 | Hydroxyacylglutathione hydrolase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gloB PE=3 SV=1 | 13 | 270 | 6.0E-30 |
sp|Q7N809|GLO2_PHOLL | Hydroxyacylglutathione hydrolase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gloB PE=3 SV=1 | 13 | 270 | 7.0E-30 |
sp|Q3J436|GLO2_RHOS4 | Hydroxyacylglutathione hydrolase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gloB PE=3 SV=1 | 13 | 270 | 8.0E-30 |
sp|A3D437|GLO2_SHEB5 | Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gloB PE=3 SV=1 | 13 | 270 | 9.0E-30 |
sp|A6WMW5|GLO2_SHEB8 | Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS185) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-29 |
sp|Q12MM2|GLO2_SHEDO | Hydroxyacylglutathione hydrolase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-29 |
sp|A8GA75|GLO2_SERP5 | Hydroxyacylglutathione hydrolase OS=Serratia proteamaculans (strain 568) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-29 |
sp|Q0BWR4|GLO2_HYPNA | Hydroxyacylglutathione hydrolase OS=Hyphomonas neptunium (strain ATCC 15444) GN=gloB PE=3 SV=1 | 9 | 270 | 4.0E-29 |
sp|A2C116|GLO2_PROM1 | Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain NATL1A) GN=gloB PE=3 SV=1 | 17 | 237 | 5.0E-29 |
sp|Q2N9P7|GLO2_ERYLH | Hydroxyacylglutathione hydrolase OS=Erythrobacter litoralis (strain HTCC2594) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-29 |
sp|Q46GM1|GLO2_PROMT | Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain NATL2A) GN=gloB PE=3 SV=2 | 17 | 237 | 6.0E-29 |
sp|Q2SJ47|GLO2_HAHCH | Hydroxyacylglutathione hydrolase OS=Hahella chejuensis (strain KCTC 2396) GN=gloB PE=3 SV=1 | 14 | 270 | 7.0E-29 |
sp|Q2K3M6|GLO2_RHIEC | Hydroxyacylglutathione hydrolase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gloB PE=3 SV=1 | 20 | 270 | 7.0E-29 |
sp|P57336|GLO2_BUCAI | Hydroxyacylglutathione hydrolase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gloB PE=3 SV=1 | 13 | 268 | 7.0E-29 |
sp|Q1QQZ1|GLO2_NITHX | Hydroxyacylglutathione hydrolase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gloB PE=3 SV=1 | 23 | 269 | 1.0E-28 |
sp|Q2NVG1|GLO2_SODGM | Hydroxyacylglutathione hydrolase OS=Sodalis glossinidius (strain morsitans) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-28 |
sp|Q08889|GLO2_BUCAP | Hydroxyacylglutathione hydrolase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-28 |
sp|A0KXS9|GLO2_SHESA | Hydroxyacylglutathione hydrolase OS=Shewanella sp. (strain ANA-3) GN=gloB PE=3 SV=1 | 13 | 244 | 3.0E-28 |
sp|Q65U07|GLO2_MANSM | Hydroxyacylglutathione hydrolase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=gloB PE=3 SV=1 | 15 | 238 | 3.0E-28 |
sp|Q0I3Q7|GLO2_HAES1 | Hydroxyacylglutathione hydrolase OS=Haemophilus somnus (strain 129Pt) GN=gloB PE=3 SV=1 | 15 | 243 | 4.0E-28 |
sp|Q3AYI2|GLO2_SYNS9 | Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain CC9902) GN=gloB PE=3 SV=1 | 18 | 243 | 5.0E-28 |
sp|Q7U5Z8|GLO2_SYNPX | Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain WH8102) GN=gloB PE=3 SV=1 | 18 | 272 | 9.0E-28 |
sp|B1LHM1|GLO2_ECOSM | Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gloB PE=3 SV=1 | 13 | 266 | 9.0E-28 |
sp|B7NKW6|GLO2_ECO7I | Hydroxyacylglutathione hydrolase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gloB PE=3 SV=1 | 13 | 266 | 9.0E-28 |
sp|B8F6A3|GLO2_HAEPS | Hydroxyacylglutathione hydrolase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-27 |
sp|C3K9Q0|GLO2_PSEFS | Hydroxyacylglutathione hydrolase OS=Pseudomonas fluorescens (strain SBW25) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-27 |
sp|Q32JQ1|GLO2_SHIDS | Hydroxyacylglutathione hydrolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gloB PE=3 SV=1 | 13 | 270 | 3.0E-27 |
sp|B0UU01|GLO2_HISS2 | Hydroxyacylglutathione hydrolase OS=Histophilus somni (strain 2336) GN=gloB PE=3 SV=1 | 15 | 240 | 3.0E-27 |
sp|P0AC84|GLO2_ECOLI | Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain K12) GN=gloB PE=1 SV=1 | 13 | 266 | 3.0E-27 |
sp|B1XD76|GLO2_ECODH | Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain K12 / DH10B) GN=gloB PE=3 SV=1 | 13 | 266 | 3.0E-27 |
sp|C4ZRU9|GLO2_ECOBW | Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gloB PE=3 SV=1 | 13 | 266 | 3.0E-27 |
sp|B5Z0I6|GLO2_ECO5E | Hydroxyacylglutathione hydrolase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gloB PE=3 SV=1 | 13 | 266 | 3.0E-27 |
sp|P0AC85|GLO2_ECO57 | Hydroxyacylglutathione hydrolase OS=Escherichia coli O157:H7 GN=gloB PE=3 SV=1 | 13 | 266 | 3.0E-27 |
sp|A7ZWF4|GLO2_ECOHS | Hydroxyacylglutathione hydrolase OS=Escherichia coli O9:H4 (strain HS) GN=gloB PE=3 SV=1 | 13 | 266 | 3.0E-27 |
sp|A6VNK4|GLO2_ACTSZ | Hydroxyacylglutathione hydrolase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=gloB PE=3 SV=1 | 17 | 242 | 3.0E-27 |
sp|P71374|GLO2_HAEIN | Hydroxyacylglutathione hydrolase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloB PE=3 SV=1 | 18 | 212 | 4.0E-27 |
sp|B5R447|GLO2_SALEP | Hydroxyacylglutathione hydrolase OS=Salmonella enteritidis PT4 (strain P125109) GN=gloB PE=3 SV=1 | 13 | 249 | 4.0E-27 |
sp|B5FJ56|GLO2_SALDC | Hydroxyacylglutathione hydrolase OS=Salmonella dublin (strain CT_02021853) GN=gloB PE=3 SV=1 | 13 | 249 | 4.0E-27 |
sp|A7MI37|GLO2_CROS8 | Hydroxyacylglutathione hydrolase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-27 |
sp|B7LW87|GLO2_ESCF3 | Hydroxyacylglutathione hydrolase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gloB PE=3 SV=1 | 13 | 266 | 5.0E-27 |
sp|B7N874|GLO2_ECOLU | Hydroxyacylglutathione hydrolase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gloB PE=3 SV=1 | 13 | 266 | 7.0E-27 |
sp|B1IPU6|GLO2_ECOLC | Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gloB PE=3 SV=1 | 13 | 266 | 7.0E-27 |
sp|Q8FKY7|GLO2_ECOL6 | Hydroxyacylglutathione hydrolase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gloB PE=3 SV=1 | 13 | 266 | 8.0E-27 |
sp|B4TYG8|GLO2_SALSV | Hydroxyacylglutathione hydrolase OS=Salmonella schwarzengrund (strain CVM19633) GN=gloB PE=3 SV=1 | 13 | 249 | 8.0E-27 |
sp|A9MZ21|GLO2_SALPB | Hydroxyacylglutathione hydrolase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gloB PE=3 SV=1 | 13 | 249 | 8.0E-27 |
sp|B4SV37|GLO2_SALNS | Hydroxyacylglutathione hydrolase OS=Salmonella newport (strain SL254) GN=gloB PE=3 SV=1 | 13 | 249 | 8.0E-27 |
sp|B4TK83|GLO2_SALHS | Hydroxyacylglutathione hydrolase OS=Salmonella heidelberg (strain SL476) GN=gloB PE=3 SV=1 | 13 | 249 | 8.0E-27 |
sp|Q57SZ8|GLO2_SALCH | Hydroxyacylglutathione hydrolase OS=Salmonella choleraesuis (strain SC-B67) GN=gloB PE=3 SV=1 | 13 | 249 | 8.0E-27 |
sp|B5F8X0|GLO2_SALA4 | Hydroxyacylglutathione hydrolase OS=Salmonella agona (strain SL483) GN=gloB PE=3 SV=1 | 13 | 249 | 8.0E-27 |
sp|A9MPF3|GLO2_SALAR | Hydroxyacylglutathione hydrolase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gloB PE=3 SV=1 | 13 | 249 | 9.0E-27 |
sp|Q4QJZ3|GLO2_HAEI8 | Hydroxyacylglutathione hydrolase OS=Haemophilus influenzae (strain 86-028NP) GN=gloB PE=3 SV=1 | 18 | 238 | 9.0E-27 |
sp|C0Q6N0|GLO2_SALPC | Hydroxyacylglutathione hydrolase OS=Salmonella paratyphi C (strain RKS4594) GN=gloB PE=3 SV=1 | 13 | 249 | 1.0E-26 |
sp|B7MQ21|GLO2_ECO81 | Hydroxyacylglutathione hydrolase OS=Escherichia coli O81 (strain ED1a) GN=gloB PE=3 SV=1 | 13 | 249 | 1.0E-26 |
sp|B5R5L1|GLO2_SALG2 | Hydroxyacylglutathione hydrolase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gloB PE=3 SV=1 | 13 | 249 | 1.0E-26 |
sp|Q0TLC5|GLO2_ECOL5 | Hydroxyacylglutathione hydrolase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gloB PE=3 SV=1 | 13 | 266 | 2.0E-26 |
sp|B7UJA8|GLO2_ECO27 | Hydroxyacylglutathione hydrolase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=gloB PE=3 SV=1 | 13 | 266 | 2.0E-26 |
sp|Q3Z5F1|GLO2_SHISS | Hydroxyacylglutathione hydrolase OS=Shigella sonnei (strain Ss046) GN=gloB PE=3 SV=1 | 13 | 266 | 2.0E-26 |
sp|B2U350|GLO2_SHIB3 | Hydroxyacylglutathione hydrolase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gloB PE=3 SV=1 | 13 | 266 | 2.0E-26 |
sp|A7ZHU8|GLO2_ECO24 | Hydroxyacylglutathione hydrolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gloB PE=3 SV=1 | 13 | 266 | 2.0E-26 |
sp|B7M211|GLO2_ECO8A | Hydroxyacylglutathione hydrolase OS=Escherichia coli O8 (strain IAI1) GN=gloB PE=3 SV=1 | 13 | 266 | 2.0E-26 |
sp|B7LHB8|GLO2_ECO55 | Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain 55989 / EAEC) GN=gloB PE=3 SV=1 | 13 | 266 | 2.0E-26 |
sp|A5UF43|GLO2_HAEIG | Hydroxyacylglutathione hydrolase OS=Haemophilus influenzae (strain PittGG) GN=gloB PE=3 SV=1 | 18 | 212 | 2.0E-26 |
sp|A8AKR2|GLO2_CITK8 | Hydroxyacylglutathione hydrolase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-26 |
sp|Q8EE27|GLO2_SHEON | Hydroxyacylglutathione hydrolase OS=Shewanella oneidensis (strain MR-1) GN=gloB PE=3 SV=1 | 13 | 244 | 3.0E-26 |
sp|Q1MB56|GLO2_RHIL3 | Hydroxyacylglutathione hydrolase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gloB PE=3 SV=1 | 20 | 270 | 4.0E-26 |
sp|Q83MC1|GLO2_SHIFL | Hydroxyacylglutathione hydrolase OS=Shigella flexneri GN=gloB PE=3 SV=1 | 13 | 266 | 4.0E-26 |
sp|Q0T802|GLO2_SHIF8 | Hydroxyacylglutathione hydrolase OS=Shigella flexneri serotype 5b (strain 8401) GN=gloB PE=3 SV=1 | 13 | 266 | 4.0E-26 |
sp|Q325T4|GLO2_SHIBS | Hydroxyacylglutathione hydrolase OS=Shigella boydii serotype 4 (strain Sb227) GN=gloB PE=3 SV=1 | 13 | 266 | 4.0E-26 |
sp|Q1RFX9|GLO2_ECOUT | Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain UTI89 / UPEC) GN=gloB PE=3 SV=1 | 13 | 266 | 4.0E-26 |
sp|B6HZS5|GLO2_ECOSE | Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain SE11) GN=gloB PE=3 SV=1 | 13 | 266 | 4.0E-26 |
sp|A1A7Q3|GLO2_ECOK1 | Hydroxyacylglutathione hydrolase OS=Escherichia coli O1:K1 / APEC GN=gloB PE=3 SV=1 | 13 | 266 | 4.0E-26 |
sp|B7MBI8|GLO2_ECO45 | Hydroxyacylglutathione hydrolase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gloB PE=3 SV=1 | 13 | 266 | 4.0E-26 |
sp|Q7VQB7|GLO2_BLOFL | Hydroxyacylglutathione hydrolase OS=Blochmannia floridanus GN=gloB PE=3 SV=1 | 13 | 267 | 5.0E-26 |
sp|Q3JAC4|GLO2_NITOC | Hydroxyacylglutathione hydrolase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gloB PE=3 SV=1 | 24 | 270 | 6.0E-26 |
sp|Q8ZRM2|GLO2_SALTY | Hydroxyacylglutathione hydrolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloB PE=1 SV=1 | 13 | 249 | 8.0E-26 |
sp|B5BDW7|GLO2_SALPK | Hydroxyacylglutathione hydrolase OS=Salmonella paratyphi A (strain AKU_12601) GN=gloB PE=3 SV=1 | 13 | 249 | 8.0E-26 |
sp|Q5PFD6|GLO2_SALPA | Hydroxyacylglutathione hydrolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gloB PE=3 SV=1 | 13 | 249 | 8.0E-26 |
sp|B7VB64|GLO2_PSEA8 | Hydroxyacylglutathione hydrolase OS=Pseudomonas aeruginosa (strain LESB58) GN=gloB PE=3 SV=1 | 13 | 270 | 3.0E-25 |
sp|A6V707|GLO2_PSEA7 | Hydroxyacylglutathione hydrolase OS=Pseudomonas aeruginosa (strain PA7) GN=gloB PE=3 SV=1 | 13 | 270 | 3.0E-25 |
sp|Q9I2T1|GLO2_PSEAE | Hydroxyacylglutathione hydrolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gloB PE=3 SV=1 | 13 | 270 | 5.0E-25 |
sp|Q1LT01|GLO2_BAUCH | Hydroxyacylglutathione hydrolase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=gloB PE=3 SV=1 | 13 | 272 | 8.0E-25 |
sp|Q493H8|GLO2_BLOPB | Hydroxyacylglutathione hydrolase OS=Blochmannia pennsylvanicus (strain BPEN) GN=gloB PE=3 SV=1 | 13 | 270 | 9.0E-24 |
sp|B0BTR9|GLO2_ACTPJ | Hydroxyacylglutathione hydrolase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=gloB PE=3 SV=1 | 13 | 270 | 9.0E-24 |
sp|B3H0S9|GLO2_ACTP7 | Hydroxyacylglutathione hydrolase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=gloB PE=3 SV=1 | 13 | 270 | 9.0E-24 |
sp|A3MZD3|GLO2_ACTP2 | Hydroxyacylglutathione hydrolase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=gloB PE=3 SV=1 | 13 | 270 | 1.0E-23 |
sp|Q7VM19|GLO2_HAEDU | Hydroxyacylglutathione hydrolase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gloB PE=3 SV=1 | 13 | 238 | 4.0E-23 |
sp|Q89AN4|GLO2_BUCBP | Hydroxyacylglutathione hydrolase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gloB PE=3 SV=1 | 13 | 245 | 5.0E-23 |
sp|Q31BX5|GLO2_PROM9 | Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9312) GN=gloB PE=3 SV=1 | 59 | 238 | 7.0E-23 |
sp|Q6ML19|GLO2_BDEBA | Hydroxyacylglutathione hydrolase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gloB PE=3 SV=1 | 9 | 201 | 9.0E-23 |
sp|A2BQ40|GLO2_PROMS | Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain AS9601) GN=gloB PE=3 SV=2 | 61 | 238 | 2.0E-21 |
sp|Q8D3D4|GLO2_WIGBR | Hydroxyacylglutathione hydrolase OS=Wigglesworthia glossinidia brevipalpis GN=gloB PE=3 SV=1 | 13 | 270 | 2.0E-21 |
sp|Q0VBY3|HAGHL_BOVIN | Hydroxyacylglutathione hydrolase-like protein OS=Bos taurus GN=HAGHL PE=2 SV=1 | 13 | 157 | 2.0E-20 |
sp|Q7MQ55|GLO21_VIBVY | Hydroxyacylglutathione hydrolase 1 OS=Vibrio vulnificus (strain YJ016) GN=gloB1 PE=3 SV=1 | 23 | 270 | 2.0E-20 |
sp|A3PBT3|GLO2_PROM0 | Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9301) GN=gloB PE=3 SV=2 | 15 | 238 | 6.0E-20 |
sp|Q051W5|GLO2_LEPBL | Hydroxyacylglutathione hydrolase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gloB PE=3 SV=1 | 19 | 262 | 4.0E-19 |
sp|Q04RQ6|GLO2_LEPBJ | Hydroxyacylglutathione hydrolase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gloB PE=3 SV=1 | 19 | 262 | 4.0E-19 |
sp|Q9C8L4|ETHE1_ARATH | Persulfide dioxygenase ETHE1 homolog, mitochondrial OS=Arabidopsis thaliana GN=GLY3 PE=1 SV=3 | 24 | 190 | 8.0E-19 |
sp|A5FZE9|GLO2_ACICJ | Hydroxyacylglutathione hydrolase OS=Acidiphilium cryptum (strain JF-5) GN=gloB PE=3 SV=1 | 15 | 205 | 2.0E-17 |
sp|Q8SSH0|GLO2_ENCCU | Probable hydroxyacylglutathione hydrolase ECU02_0580 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0580 PE=1 SV=2 | 58 | 273 | 3.0E-16 |
sp|Q2IJC6|GLO2_ANADE | Hydroxyacylglutathione hydrolase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=gloB PE=3 SV=1 | 22 | 244 | 2.0E-15 |
sp|P96981|GLO2_RHOCA | Hydroxyacylglutathione hydrolase OS=Rhodobacter capsulatus GN=gloB PE=3 SV=1 | 13 | 203 | 1.0E-14 |
sp|B0TXY0|GLO2_FRAP2 | Hydroxyacylglutathione hydrolase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gloB PE=3 SV=1 | 1 | 270 | 1.0E-11 |
sp|O95571|ETHE1_HUMAN | Persulfide dioxygenase ETHE1, mitochondrial OS=Homo sapiens GN=ETHE1 PE=1 SV=2 | 17 | 190 | 1.0E-10 |
sp|O34769|PKSB_BACSU | Probable polyketide biosynthesis zinc-dependent hydrolase PksB OS=Bacillus subtilis (strain 168) GN=pksB PE=1 SV=1 | 14 | 190 | 7.0E-10 |
sp|A0Q7M7|GLO2_FRATN | Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. novicida (strain U112) GN=gloB PE=3 SV=1 | 1 | 270 | 3.0E-09 |
sp|P54501|YQGX_BACSU | Probable metallo-hydrolase YqgX OS=Bacillus subtilis (strain 168) GN=yqgX PE=3 SV=1 | 12 | 188 | 6.0E-09 |
sp|A7Z4X7|BAEB_BACMF | Probable polyketide biosynthesis zinc-dependent hydrolase BaeB OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeB PE=1 SV=1 | 24 | 190 | 8.0E-09 |
sp|Q3JRV4|Y2304_BURP1 | Probable metallo-hydrolase BURPS1710b_2304 OS=Burkholderia pseudomallei (strain 1710b) GN=BURPS1710b_2304 PE=1 SV=1 | 26 | 276 | 5.0E-07 |
sp|Q8UAA9|BLH_AGRFC | Beta-lactamase hydrolase-like protein OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=blh PE=2 SV=1 | 21 | 196 | 7.0E-07 |
sp|Q9PFB0|BLH_XYLFA | Beta-lactamase hydrolase-like protein OS=Xylella fastidiosa (strain 9a5c) GN=blh PE=2 SV=1 | 21 | 190 | 8.0E-07 |
sp|A4IWV0|GLO2_FRATW | Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gloB PE=3 SV=1 | 1 | 270 | 9.0E-07 |
sp|Q5NF43|GLO2_FRATT | Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gloB PE=3 SV=1 | 1 | 270 | 9.0E-07 |
sp|B2SFR3|GLO2_FRATM | Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gloB PE=3 SV=1 | 1 | 270 | 9.0E-07 |
sp|Q14GJ6|GLO2_FRAT1 | Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gloB PE=3 SV=1 | 1 | 270 | 9.0E-07 |
sp|Q87AD6|BLH_XYLFT | Beta-lactamase hydrolase-like protein OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=blh PE=3 SV=1 | 21 | 190 | 2.0E-06 |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 18 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Agabi119p4|058930 MLLSRWSFLSARMKVVPVPVRQDNYAYLLIDTPSNKAAAVDVYDVDKVSAAAQSLGVSIVAAITTHWHDDHSGGN HEFGKKFPGLPIYGSKDKENVTNVSHPVGDNDEFKIGDNIHVKCLATPCHTQDSISYYVTDPTDSSHPGGVFTGD TLFIGGCGRFFEGSADEMGRALKYLGSLPDKTLVYNGHEYTTGNLAFAKAIEPDSPGIARLAQFVKDNDITTGKS TIGDEKDWNVFMRLSSPDVRKKTNAGPNTPDSDIMNSLREQKNNFRGELPKL* |
Coding | >Agabi119p4|058930 ATGCTTCTCTCCCGCTGGTCCTTTCTCAGCGCCAGAATGAAGGTCGTCCCTGTCCCCGTCCGCCAGGATAACTAT GCCTATCTCCTCATAGATACCCCCTCAAACAAGGCCGCCGCAGTCGACGTATACGACGTCGACAAGGTCTCTGCT GCCGCACAAAGCCTTGGCGTTTCAATTGTCGCGGCTATCACTACCCATTGGCACGACGATCACAGCGGTGGCAAC CACGAATTTGGCAAGAAATTCCCAGGCTTGCCGATCTATGGCAGTAAAGACAAAGAGAATGTCACAAACGTCTCC CATCCTGTCGGCGATAACGACGAATTTAAGATTGGCGACAACATCCATGTCAAATGCCTTGCAACTCCGTGCCAC ACTCAAGATTCCATCTCTTACTACGTGACCGACCCCACAGACTCGTCCCACCCTGGTGGCGTCTTCACCGGCGAC ACCCTCTTCATCGGCGGATGCGGTCGTTTCTTCGAGGGCTCTGCAGATGAGATGGGTCGTGCTCTCAAGTACCTA GGCTCCCTCCCTGACAAGACACTTGTCTACAACGGCCATGAATACACTACAGGAAACCTTGCCTTTGCAAAGGCC ATAGAGCCAGATAGCCCTGGAATCGCTCGACTTGCACAGTTTGTCAAGGACAACGACATCACCACTGGCAAATCT ACCATTGGCGATGAAAAGGATTGGAACGTCTTTATGCGCCTCAGCTCACCAGACGTCAGGAAAAAGACAAATGCA GGACCCAATACACCAGATTCCGACATCATGAACTCGCTAAGGGAACAGAAGAACAATTTCAGAGGAGAATTACCC AAGCTGTAA |
Transcript | >Agabi119p4|058930 ATGCTTCTCTCCCGCTGGTCCTTTCTCAGCGCCAGAATGAAGGTCGTCCCTGTCCCCGTCCGCCAGGATAACTAT GCCTATCTCCTCATAGATACCCCCTCAAACAAGGCCGCCGCAGTCGACGTATACGACGTCGACAAGGTCTCTGCT GCCGCACAAAGCCTTGGCGTTTCAATTGTCGCGGCTATCACTACCCATTGGCACGACGATCACAGCGGTGGCAAC CACGAATTTGGCAAGAAATTCCCAGGCTTGCCGATCTATGGCAGTAAAGACAAAGAGAATGTCACAAACGTCTCC CATCCTGTCGGCGATAACGACGAATTTAAGATTGGCGACAACATCCATGTCAAATGCCTTGCAACTCCGTGCCAC ACTCAAGATTCCATCTCTTACTACGTGACCGACCCCACAGACTCGTCCCACCCTGGTGGCGTCTTCACCGGCGAC ACCCTCTTCATCGGCGGATGCGGTCGTTTCTTCGAGGGCTCTGCAGATGAGATGGGTCGTGCTCTCAAGTACCTA GGCTCCCTCCCTGACAAGACACTTGTCTACAACGGCCATGAATACACTACAGGAAACCTTGCCTTTGCAAAGGCC ATAGAGCCAGATAGCCCTGGAATCGCTCGACTTGCACAGTTTGTCAAGGACAACGACATCACCACTGGCAAATCT ACCATTGGCGATGAAAAGGATTGGAACGTCTTTATGCGCCTCAGCTCACCAGACGTCAGGAAAAAGACAAATGCA GGACCCAATACACCAGATTCCGACATCATGAACTCGCTAAGGGAACAGAAGAACAATTTCAGAGGAGAATTACCC AAGCTGTAA |
Gene | >Agabi119p4|058930 ATGCTTCTCTCCCGCTGGTCCTTTCTCAGCGCCAGAATGAAGGTCGTCCCTGTCCCCGTCCGCCAGGATAACTAT GCCTATCTCCTCATAGATACCCCCTCAAACAAGGCCGCCGCAGTCGACGTATACGACGTCGACAAGGTCTCTGCT GCCGCACAAAGCCTTGGCGTTTCAATTGTCGCGGCTATCACTACCCATTGGCACGACGATCACAGCGGTGGCAAC CACGTGCGTTCTCTCCTTTCCAATCCTCTCCTGCTCAACTTTCTGCACAGGAATTTGTATGTCTCTCCTCCCACC CGGTAGTATATCGGTCTTGACCGAGCCTGGAGCAGGGCAAGAAATTCCCAGGCTTGCCGATCTATGGCAGTAAAG ACAAAGAGAATGTCACAAACGTCTCCCATCCTGTCGGCGATAACGACGAATTTAAGATTGGCGACAACATCCATG TCAAGTAAAAAAGGTTCATACATCGCACTCACGACAAATTCTCATCAGCATGTTCTAGATGCCTTGCAACTCCGT GCCACACTCAAGATTCCATCTCTTACTACGTGACCGACCCCACAGACTCGTCCCACCCTGGTGGCGTCTTCACCG GCGACACCCTCTTCATCGGCGGATGCGGTCGTTTCTTCGAGGGCTCTGCAGATGAGATGGGTCGTGCTCTCAAGT ACCTAGGCTCCCTCCCTGACAAGACACTTGTCTACAACGGCCATGAATACACTACAGGAAACCTTGCCTTTGCAA AGGCCATAGAGCCAGATAGCCCTGGAATCGCTCGACTTGCACAGTTTGTCAAGGACAACGACATCACCACTGGCA AATCTACCATTGGCGATGAAAAGGATTGGAACGTCTTTATGCGCCTCAGCTCACCAGACGTCAGGCAAGTATCTA TTCGCAGACGTCTATAGTATGTGTTCTCATAGCCGAAGCAGGAAAAAGACAAATGCAGGACCCAATACACCAGAT TCCGACATCATGAACTCGCTAAGGGAACAGAAGAACAATTTCAGAGGGTGATTTAATCCTTGGAGTAAAAATAGT CTATCTCATGTTTGTGATAGAGAATTACCCAAGCTGTAA |