Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|058560
Gene name
Locationscaffold_03a:1472834..1476484
Strand+
Gene length (bp)3650
Transcript length (bp)2424
Coding sequence length (bp)2424
Protein length (aa) 808

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 4.3E-86 94 321
PF12708 Pectate_lyase_3 Pectate lyase superfamily protein 3.5E-15 450 519

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P49426|EXG1_COCCA Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum GN=EXG1 PE=1 SV=1 69 802 0.0E+00
sp|D4B0V1|E13B_ARTBC Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02077 PE=1 SV=1 414 802 9.0E-107
sp|D4B0V1|E13B_ARTBC Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02077 PE=1 SV=1 71 405 6.0E-101
sp|P53626|E13B_TRIHA Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum GN=bgn13.1 PE=1 SV=1 136 790 9.0E-59

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

Domain # Start End Length
1 34 53 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|058560
MELRDEKMTRYKAPEGDRVILDSNLSGFHMLPKFLSTFVAFFLSLVISVHALGTSCSAPLGPGTAAPGDPFWLER
IRHQGISAFNPNPSGYQVFRNVKDFGARGDGVTDDTAAINAAISAGNRCGGGGCGSSTITPAVVYFPKGTYLVSA
PIIAYYYSQLIGDAKSPPTLLAAASFDGMAVIDADPYIPGGGGAQWYINQNNFFRSVRNFVIDVRRVPAEKSQGT
GLHWQVSQATSLFNIVVHMSTAPNTAHQGIFMENGSGGFMSDLVFNGGKFGIWVGNQQFTVRNITVNNAQTGIFA
IWNWGWTFQGVTINNCGVGFDLTTGATSPSSQTTGAEAIIDATINDTPIFIRNSEPSNGRLAGSLVINNARLNNV
PVAVGVAGGGVVLAGGSKTIASWGQGNVFSGTNPNGRFVQDNIVNAHKPSVLLDGNGKIFGKPHPQYANYAVSQF
VSVKDHGARGDGRTDDTAALKSIFDQFAGCKIIFFDAGTYIVSSTLTIPAGTQIVGEGWSTIAGKGSAFRDMNNP
QVVVRVGASGSQGVVEITDMLFTTIGPAAGAIVVEWNVRQPDGQNGGAGMWDTHIRLGGVAGSNLQTSQCPSSGS
GGTTNCFAAFLALHLTSRSTAYLEGTWVWLADHDLDGPSQLNLYSGRGILSESAGPVWLIATGSEHHVLYQYSLV
GAKNHYMGLIQTESPYFQPNPSPPAPFSIVPSFSDPSFNGVRSSWALTVSGSTDIIVFGAGLYSFFSNYNQDCIT
PATCQSQILNVDSSSSLTVYSLSTVATTFQLSVNQAGIVNQAGNVNGFQSTMTAWSR*
Coding >Agabi119p4|058560
ATGGAACTCAGAGACGAAAAAATGACGCGATACAAAGCCCCTGAAGGAGACAGAGTGATCCTCGACAGCAACTTG
TCCGGGTTCCATATGCTACCAAAATTTCTGTCCACTTTCGTCGCTTTTTTCCTCTCCTTGGTCATCTCTGTTCAT
GCTTTGGGAACATCTTGTAGTGCACCTTTAGGACCCGGAACTGCCGCTCCGGGGGATCCATTTTGGCTTGAACGA
ATCAGGCACCAGGGAATTTCGGCTTTCAATCCTAACCCTTCCGGTTACCAAGTTTTCAGGAATGTCAAGGATTTC
GGTGCGAGAGGCGACGGTGTTACTGACGATACAGCAGCGATCAATGCAGCGATTTCAGCAGGGAACCGCTGTGGC
GGTGGCGGTTGTGGATCTTCGACGATCACGCCTGCTGTCGTCTATTTCCCCAAAGGAACCTACCTAGTTTCAGCC
CCGATCATCGCCTATTATTACTCGCAGCTGATCGGTGATGCTAAATCCCCGCCAACTTTGCTTGCCGCTGCTTCA
TTCGACGGGATGGCTGTCATTGATGCGGATCCATACATCCCGGGTGGCGGTGGTGCCCAGTGGTATATTAATCAG
AACAACTTCTTCCGGTCCGTACGGAATTTCGTGATCGATGTTCGAAGAGTTCCTGCGGAGAAGTCACAAGGAACT
GGTCTGCATTGGCAAGTTTCGCAGGCTACTTCTTTGTTCAATATTGTTGTCCATATGTCCACTGCTCCCAACACG
GCACACCAAGGTATCTTTATGGAAAATGGAAGTGGTGGGTTCATGAGTGACTTGGTGTTTAATGGAGGAAAGTTC
GGTATCTGGGTTGGAAATCAACAATTTACTGTCCGCAATATCACCGTCAACAATGCTCAAACGGGTATTTTTGCC
ATCTGGAATTGGGGTTGGACTTTCCAGGGCGTCACCATCAATAACTGTGGTGTCGGTTTCGACCTTACGACAGGC
GCAACGTCGCCCTCTTCGCAAACAACTGGAGCTGAAGCTATCATTGACGCTACCATCAACGATACTCCTATTTTC
ATCAGAAACTCAGAGCCCAGTAACGGTCGACTAGCTGGATCACTCGTGATCAATAATGCTAGACTCAATAATGTT
CCGGTTGCCGTTGGGGTTGCTGGCGGCGGCGTTGTGTTGGCTGGTGGTTCGAAAACGATAGCCAGCTGGGGCCAG
GGTAACGTCTTCTCTGGCACCAACCCTAATGGAAGATTCGTACAAGACAACATTGTGAACGCCCACAAGCCTTCT
GTCCTTTTGGACGGGAATGGAAAGATCTTTGGAAAGCCACATCCTCAATATGCCAATTATGCTGTCAGTCAATTC
GTGAGTGTCAAAGACCATGGCGCTCGAGGTGATGGTCGAACGGACGATACCGCTGCACTCAAGTCGATATTTGAC
CAGTTTGCTGGCTGCAAGATTATCTTTTTCGATGCCGGAACCTATATCGTCTCTTCCACCCTGACCATTCCTGCT
GGAACTCAGATTGTTGGTGAAGGCTGGTCGACTATTGCTGGGAAGGGATCTGCCTTCCGGGATATGAACAATCCT
CAAGTGGTCGTCAGAGTTGGCGCATCCGGGTCGCAGGGAGTGGTCGAGATTACTGACATGCTATTTACAACAATT
GGCCCTGCCGCTGGTGCGATCGTTGTTGAATGGAATGTCAGACAACCTGATGGACAAAATGGTGGTGCTGGCATG
TGGGACACTCATATCAGGCTAGGCGGAGTGGCTGGATCCAACTTGCAAACCAGTCAATGTCCCAGTTCCGGAAGC
GGTGGAACGACTAATTGCTTTGCTGCTTTCCTTGCACTACACCTTACATCTCGGTCCACTGCTTACTTGGAGGGT
ACCTGGGTCTGGTTGGCTGACCATGATCTTGATGGCCCTTCTCAACTCAATCTGTATTCCGGAAGAGGCATCCTT
TCCGAATCCGCTGGTCCTGTCTGGTTGATTGCTACAGGCTCTGAACACCATGTCTTATACCAATACTCTTTGGTC
GGCGCGAAGAATCACTACATGGGTCTCATTCAGACTGAAAGCCCGTATTTCCAACCTAACCCCAGTCCTCCTGCT
CCATTCTCCATTGTACCCTCGTTCAGTGATCCGAGCTTCAATGGTGTCCGATCATCTTGGGCACTAACGGTGTCT
GGTTCTACCGATATCATAGTCTTCGGCGCGGGACTTTACAGCTTCTTCTCGAACTACAATCAAGATTGCATTACC
CCTGCTACGTGCCAAAGTCAAATCTTGAACGTCGATTCGTCATCATCGCTCACGGTGTACAGTTTGTCCACTGTG
GCGACTACGTTCCAGCTTAGCGTCAACCAAGCCGGGATTGTCAACCAAGCAGGAAATGTGAATGGTTTCCAATCT
ACTATGACTGCTTGGAGTCGATGA
Transcript >Agabi119p4|058560
ATGGAACTCAGAGACGAAAAAATGACGCGATACAAAGCCCCTGAAGGAGACAGAGTGATCCTCGACAGCAACTTG
TCCGGGTTCCATATGCTACCAAAATTTCTGTCCACTTTCGTCGCTTTTTTCCTCTCCTTGGTCATCTCTGTTCAT
GCTTTGGGAACATCTTGTAGTGCACCTTTAGGACCCGGAACTGCCGCTCCGGGGGATCCATTTTGGCTTGAACGA
ATCAGGCACCAGGGAATTTCGGCTTTCAATCCTAACCCTTCCGGTTACCAAGTTTTCAGGAATGTCAAGGATTTC
GGTGCGAGAGGCGACGGTGTTACTGACGATACAGCAGCGATCAATGCAGCGATTTCAGCAGGGAACCGCTGTGGC
GGTGGCGGTTGTGGATCTTCGACGATCACGCCTGCTGTCGTCTATTTCCCCAAAGGAACCTACCTAGTTTCAGCC
CCGATCATCGCCTATTATTACTCGCAGCTGATCGGTGATGCTAAATCCCCGCCAACTTTGCTTGCCGCTGCTTCA
TTCGACGGGATGGCTGTCATTGATGCGGATCCATACATCCCGGGTGGCGGTGGTGCCCAGTGGTATATTAATCAG
AACAACTTCTTCCGGTCCGTACGGAATTTCGTGATCGATGTTCGAAGAGTTCCTGCGGAGAAGTCACAAGGAACT
GGTCTGCATTGGCAAGTTTCGCAGGCTACTTCTTTGTTCAATATTGTTGTCCATATGTCCACTGCTCCCAACACG
GCACACCAAGGTATCTTTATGGAAAATGGAAGTGGTGGGTTCATGAGTGACTTGGTGTTTAATGGAGGAAAGTTC
GGTATCTGGGTTGGAAATCAACAATTTACTGTCCGCAATATCACCGTCAACAATGCTCAAACGGGTATTTTTGCC
ATCTGGAATTGGGGTTGGACTTTCCAGGGCGTCACCATCAATAACTGTGGTGTCGGTTTCGACCTTACGACAGGC
GCAACGTCGCCCTCTTCGCAAACAACTGGAGCTGAAGCTATCATTGACGCTACCATCAACGATACTCCTATTTTC
ATCAGAAACTCAGAGCCCAGTAACGGTCGACTAGCTGGATCACTCGTGATCAATAATGCTAGACTCAATAATGTT
CCGGTTGCCGTTGGGGTTGCTGGCGGCGGCGTTGTGTTGGCTGGTGGTTCGAAAACGATAGCCAGCTGGGGCCAG
GGTAACGTCTTCTCTGGCACCAACCCTAATGGAAGATTCGTACAAGACAACATTGTGAACGCCCACAAGCCTTCT
GTCCTTTTGGACGGGAATGGAAAGATCTTTGGAAAGCCACATCCTCAATATGCCAATTATGCTGTCAGTCAATTC
GTGAGTGTCAAAGACCATGGCGCTCGAGGTGATGGTCGAACGGACGATACCGCTGCACTCAAGTCGATATTTGAC
CAGTTTGCTGGCTGCAAGATTATCTTTTTCGATGCCGGAACCTATATCGTCTCTTCCACCCTGACCATTCCTGCT
GGAACTCAGATTGTTGGTGAAGGCTGGTCGACTATTGCTGGGAAGGGATCTGCCTTCCGGGATATGAACAATCCT
CAAGTGGTCGTCAGAGTTGGCGCATCCGGGTCGCAGGGAGTGGTCGAGATTACTGACATGCTATTTACAACAATT
GGCCCTGCCGCTGGTGCGATCGTTGTTGAATGGAATGTCAGACAACCTGATGGACAAAATGGTGGTGCTGGCATG
TGGGACACTCATATCAGGCTAGGCGGAGTGGCTGGATCCAACTTGCAAACCAGTCAATGTCCCAGTTCCGGAAGC
GGTGGAACGACTAATTGCTTTGCTGCTTTCCTTGCACTACACCTTACATCTCGGTCCACTGCTTACTTGGAGGGT
ACCTGGGTCTGGTTGGCTGACCATGATCTTGATGGCCCTTCTCAACTCAATCTGTATTCCGGAAGAGGCATCCTT
TCCGAATCCGCTGGTCCTGTCTGGTTGATTGCTACAGGCTCTGAACACCATGTCTTATACCAATACTCTTTGGTC
GGCGCGAAGAATCACTACATGGGTCTCATTCAGACTGAAAGCCCGTATTTCCAACCTAACCCCAGTCCTCCTGCT
CCATTCTCCATTGTACCCTCGTTCAGTGATCCGAGCTTCAATGGTGTCCGATCATCTTGGGCACTAACGGTGTCT
GGTTCTACCGATATCATAGTCTTCGGCGCGGGACTTTACAGCTTCTTCTCGAACTACAATCAAGATTGCATTACC
CCTGCTACGTGCCAAAGTCAAATCTTGAACGTCGATTCGTCATCATCGCTCACGGTGTACAGTTTGTCCACTGTG
GCGACTACGTTCCAGCTTAGCGTCAACCAAGCCGGGATTGTCAACCAAGCAGGAAATGTGAATGGTTTCCAATCT
ACTATGACTGCTTGGAGTCGATGA
Gene >Agabi119p4|058560
ATGGAACTCAGAGACGAAAAAATGACGCGATACAAAGCCCCTGAAGGAGACAGAGTGATCCTCGACAGGTACTTA
TAGTTGGAGTCAGTGTAGCGCACCTAAGCAAGCGCTCCTCGTTACTCGCTTCAGCTCTACGTTAGCAACTTGTCC
GGGTTCCATATGCTACCAAAATTTCTGTCCACTTTCGTCGCTTTTTTCCTCTCCTTGGTCATCTCTGTTCATGCT
TTGGGAACATCTTGTAGTGCACCTTTAGGACCCGGAACTGCCGCTCCGGGGGATCCATTTTGGCTTGAACGAATC
AGGCACCAGGGAATTTCGGCTTTCAATCCTAACCCTTCCGGTTACCAAGTTTTCAGGAATGTCAAGGTTCGTACT
CGCAAGGATACCAGTCCTAGTCAGTCATTGATGAGCGTGTCAGGATTTCGGTGCGAGAGGCGACGGTGTTACTGA
CGATACAGCAGCGATCAAGTAAATTTCTCGCTATTTGCCATATGCTTCGTGGCTGAAATTTTCACCAGTGCAGCG
ATTTCAGCAGGGAACCGCTGTGGCGGTGGCGGTTGTGGATCTTCGACGTATGTACATCTCATGAACTTGAAGTCG
TTCAGCACTTACAATTTGAGGTTTAGGATCACGCCTGCTGTCGTCTATTTCCCCAAAGGGTAAGCATACCTCTTA
TGAGCAATTTATGGAAGCAATCGTTGAAATCGTTGAATCGATCATAGAACCTACCTAGTTTCAGCCCCGATCATC
GCCTATTATTACTCGCAGCTGATCGGTGATGCTAAATCCCCGCCAACTTTGCTTGCCGCTGCTTCATTCGACGGG
ATGGCTGTCATTGGTAGGCTTGTTGATGGTTGTTGTTTTTGCATCCGGTATGAACTGATTTGTCAGATGCGGATC
CATACATCCCGGGTGGCGGTGGTGCCCAGTGGTATATTAATCAGAACAACTTGTACTTATTCTCTCATTTTATCT
TTGAAGATTTCTGGCTGACTTCGTATTTAGCTTCCGGTCCGTACGGAATTTCGTGATCGATGTTCGAAGGTACGA
CAGCCACCCTACTCATCCCACCTTTCTTTTGAAAGTAACGTTCAATCCTTAGAGTTCCTGCGGAGAAGTCACAAG
GAACTGGTCTGCATTGGCAAGTTTCGCAGGCTACTTCTTTGTTCAATATTGTTGTCCATATGTCCACTGCTCCCA
ACACGGCACACCAAGGTTTGTTTTTATGTCCAAGTTGTAATATAACAGTACTCAACCACTTACTTTCAGGTATCT
TTATGGAAAATGGAAGGTGCGTATCTTTACTATCAACACCAACAGCGTGTTCATTCGCCTTAGTGGTGGGTTCAT
GAGTGACTTGGTGTTTAATGGAGGTTCGTCCAAGATCATACGAAGCAGACAAACACTTGTTAACTTAGCACAGGA
AAGTTCGGTATCTGGGTTGGAAATCAACAGTATGTGACGCATTCATTTATTTAAGATGACGAAGTAAGATAAATG
CAGATTTACTGTCCGCAATATCACCGTCAACAATGCTCAAACGGGTATTTTTGCCATCTGGAATTGGGGTAAGGA
GGTTTAGCACAGTCTTAATTTTGCCATTAGCATTCATATGTTCCCAGGTTGGACTTTCCAGGGCGTCACCATCAA
TAACTGTGGTGTCGGTTTCGACCTTACGACAGGCGCAACGTCGCCCTCTTCGCAAACAACTGGAGCTGAAGCTAT
CATTGACGCTACCATCAACGATACTCCTATTTTCATCAGAAACTCAGAGCCCAGTAACGGTCGACTAGCTGGATC
ACTCGTGATCAATAATGCTAGACTCAATAATGTTCCGGTTGCCGTTGGGGTTGCTGGCGGCGGCGTTGTGTTGGC
TGGTGGTTCGAAAACGATAGCCAGCTGGGGCCAGGGTAACGTCTTCTCTGGCACCAACCCTAATGGAAGATTCGT
ACAAGACAACATTGTGAACGCCCACAAGCCTTCTGTCCTTTTGGACGGGAATGGAAAGATCTTTGGAAAGCCACA
TCCTCAATATGCCAATTATGCTGTCAGTCAATTCGTGAGTGTCAAAGACCATGGCGCTCGAGGTGATGGTCGAAC
GGACGATACCGCTGCACTCAAGTCGATATTTGACCAGGTTAGTGAATCGTTACCAATAGCTTCGAGTCCCGCCCG
GCTCACCCGCGCAATCCATTTAGTTTGCTGGCTGCAAGATTATCTTTTTCGATGCCGGAACCTATATCGTCTCTT
CCACCCTGACCATTCCTGCTGGAACTCAGATTGTTGGTGAAGGCTGGTCGACTATTGCTGGGAAGGGATCTGCCT
TCCGGGATATGAACAATCCTCAAGTGGTCGTCAGAGTTGGCGCATCCGGGTCGCAGGGAGTGGTCGAGATTACTG
ACATGCTATTTACAACAATTGGCCCTGGTGCGTAGCGAATCTCAACTGTTGTGGACTTTGGCCATATCTGACCTC
TTATGAAATGCAACAGCCGCTGGTGCGATCGTTGTTGAATGGAATGTCAGACAACCTGATGGACAAAATGGTGGT
GCTGGCATGTGGGACACTCATATCAGGTTCGTGTGTTTGTCCAGTATTTGTGGTCGCATTCCTCACTTTCGGACG
GTTTGATAGGCTAGGCGGAGTGGCTGGATCCAACTTGCAAACCAGTCAATGTCCCAGTTCCGGAAGCGGTGGAAC
GACTAATTGCTTTGCTGCTTTCCTTGCACTACACCTTACATCTCGGTCCACTGCTTACTTGGAGGTCAGTGCGCG
GTCACAGTCCTATTTTAAAGTCCAGCATATTCAGAACAATGGCTCCTTCAGGGTACCTGGGTCTGGTTGGCTGAC
CATGATCTTGATGGCCCTTCTCAACTCAATCTGTATTCCGGAAGAGGCATCCTTTCCGAATCCGCTGGTCCTGTC
TGGTTGATTGCTACAGGTGAGTAACTTTCAACCCAATGATCTATACTGAGCTTGACATATCGACAAGGCTGTGAG
TGTATTAAACAAAACGAAGTTCATTAACATTAGTGACGCTTTGAAAAAGCTGAACACCATGTCTTATACCAATAC
TCTTTGGTCGGCGCGAAGAATCACTACATGGGTCTCATTCAGACTGAAAGCGTGAGCGATTCTAATTCTTGTAGA
CTTGTGACGTTTGTCCTGAATCGCATTGTTTCAAGCCGTATTTCCAACCTAACCCCAGTCCTCCTGCTCCATTCT
CCATTGTACCCTCGTTCAGTGATCCGAGCTTCAATGGTGTCCGATCATCTTGGGCACTAACGGTGTCTGGTTCTA
CCGATATCATAGTCTTCGGTAAGCCTTGGGTTATTGTTTGTTGATTACAGACATAAACCTATGATCTTGCAGGCG
CGGGACTTTACAGCTTCTTCTCGGTCAGATTTTCTTTGTATTGTTGTGGTCCGATCAGTAAGCTAACGATTGCGC
AGAACTACAATCAAGATTGCATTACCCCTGCTACGTGCCAAAGTCAAATCTTGAACGTCGATTCGTCATCATCGC
TCACGGTGTACAGTTTGTCCACTGTGGCGACTACGTTCCAGCTTAGCGTCAACCAAGCCGGGATTGTCAACCAAG
CAGGAAATGTGAATGGTTTCCAATCTACTATGACTGCTTGGAGTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail