Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|058540
Gene name
Locationscaffold_03a:1468310..1469437
Strand-
Gene length (bp)1127
Transcript length (bp)954
Coding sequence length (bp)954
Protein length (aa) 318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 1.7E-41 6 233
PF13460 NAD_binding_10 NAD(P)H-binding 7.9E-13 10 150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZID0|NMRL1_CHICK NmrA-like family domain-containing protein 1 OS=Gallus gallus GN=NMRAL1 PE=2 SV=1 4 298 5.0E-40
sp|Q0VCN1|NMRL1_BOVIN NmrA-like family domain-containing protein 1 OS=Bos taurus GN=NMRAL1 PE=2 SV=1 4 295 3.0E-32
sp|Q9HBL8|NMRL1_HUMAN NmrA-like family domain-containing protein 1 OS=Homo sapiens GN=NMRAL1 PE=1 SV=1 4 295 5.0E-32
sp|Q8K2T1|NMRL1_MOUSE NmrA-like family domain-containing protein 1 OS=Mus musculus GN=Nmral1 PE=1 SV=1 4 295 5.0E-31
sp|Q54LJ8|NMRL1_DICDI NmrA-like family domain-containing protein DDB_G0286605 OS=Dictyostelium discoideum GN=DDB_G0286605 PE=2 SV=1 2 237 6.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZID0|NMRL1_CHICK NmrA-like family domain-containing protein 1 OS=Gallus gallus GN=NMRAL1 PE=2 SV=1 4 298 5.0E-40
sp|Q0VCN1|NMRL1_BOVIN NmrA-like family domain-containing protein 1 OS=Bos taurus GN=NMRAL1 PE=2 SV=1 4 295 3.0E-32
sp|Q9HBL8|NMRL1_HUMAN NmrA-like family domain-containing protein 1 OS=Homo sapiens GN=NMRAL1 PE=1 SV=1 4 295 5.0E-32
sp|Q8K2T1|NMRL1_MOUSE NmrA-like family domain-containing protein 1 OS=Mus musculus GN=Nmral1 PE=1 SV=1 4 295 5.0E-31
sp|Q54LJ8|NMRL1_DICDI NmrA-like family domain-containing protein DDB_G0286605 OS=Dictyostelium discoideum GN=DDB_G0286605 PE=2 SV=1 2 237 6.0E-19
sp|Q5AU62|NMRA_EMENI Nitrogen metabolite repression protein nmrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nmrA PE=1 SV=1 94 234 1.0E-07
sp|P86172|NMRL1_RAT NmrA-like family domain-containing protein 1 (Fragments) OS=Rattus norvegicus GN=Nmral1 PE=1 SV=1 4 97 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|058540
MMSKLIVVIGATGQQGGSVIDFLLKEAGGVFKVRGVTRNPSSPASLALAARGVEVVKADLSSLEDTTKAFSGAWG
IYAVTQFYEHGYEAEQLHGKNIVEAAKVVGANHIVLSTVEGREGQCLAISWTSKALIEDRVIESGIPFTFVHIPM
YYENFWTDFFAPQYNEELGFHWSVNFLPDVPIFAYSVADHGAWVVPAFREPEKYTGKRIKIVADYISLRDVVIQF
SQMTGEKASLAFELTKEQFEASRNANHPAAELMYLSWEYVIRAGPNSGVRDKEQTFSIYPQAKTYQQWLKDSEVV
RGLVAKLKAEAAASSTA*
Coding >Agabi119p4|058540
ATGATGTCTAAACTGATCGTTGTCATAGGCGCTACTGGTCAGCAAGGCGGCTCCGTTATTGACTTCCTCCTCAAA
GAGGCTGGTGGGGTCTTTAAAGTGCGCGGAGTCACAAGAAATCCCAGCTCTCCAGCGTCCCTCGCTCTTGCAGCT
AGAGGTGTTGAAGTTGTCAAGGCCGATTTGAGCTCGCTCGAAGACACAACAAAGGCCTTTTCTGGAGCATGGGGA
ATTTACGCTGTGACCCAATTTTATGAGCATGGCTACGAAGCTGAACAACTCCACGGCAAAAATATCGTCGAAGCT
GCAAAGGTCGTCGGTGCAAATCATATCGTTTTGTCTACCGTTGAGGGTCGAGAAGGTCAATGCCTGGCTATCAGT
TGGACTTCCAAGGCCTTAATTGAGGATCGTGTAATCGAGTCGGGGATCCCCTTCACTTTCGTGCACATCCCTATG
TATTATGAAAATTTTTGGACGGATTTCTTCGCACCACAGTACAATGAAGAATTGGGGTTCCACTGGTCCGTTAAC
TTCCTCCCAGATGTTCCCATCTTCGCCTACAGTGTTGCCGATCATGGTGCTTGGGTTGTTCCGGCATTCCGGGAG
CCAGAGAAGTACACTGGAAAGCGCATCAAGATCGTTGCAGACTATATCAGCCTTCGTGATGTTGTGATTCAGTTC
AGCCAGATGACGGGAGAAAAAGCCTCGTTGGCTTTTGAGTTAACCAAGGAACAGTTCGAGGCCTCACGAAACGCT
AACCATCCTGCCGCCGAGCTAATGTATCTATCTTGGGAATATGTTATCCGTGCCGGTCCAAATAGTGGCGTTCGT
GACAAAGAACAGACATTTTCCATATATCCTCAGGCGAAGACTTATCAGCAGTGGTTAAAGGATAGTGAGGTGGTC
AGAGGTCTTGTCGCGAAACTAAAGGCAGAGGCAGCAGCTAGCAGTACGGCGTAA
Transcript >Agabi119p4|058540
ATGATGTCTAAACTGATCGTTGTCATAGGCGCTACTGGTCAGCAAGGCGGCTCCGTTATTGACTTCCTCCTCAAA
GAGGCTGGTGGGGTCTTTAAAGTGCGCGGAGTCACAAGAAATCCCAGCTCTCCAGCGTCCCTCGCTCTTGCAGCT
AGAGGTGTTGAAGTTGTCAAGGCCGATTTGAGCTCGCTCGAAGACACAACAAAGGCCTTTTCTGGAGCATGGGGA
ATTTACGCTGTGACCCAATTTTATGAGCATGGCTACGAAGCTGAACAACTCCACGGCAAAAATATCGTCGAAGCT
GCAAAGGTCGTCGGTGCAAATCATATCGTTTTGTCTACCGTTGAGGGTCGAGAAGGTCAATGCCTGGCTATCAGT
TGGACTTCCAAGGCCTTAATTGAGGATCGTGTAATCGAGTCGGGGATCCCCTTCACTTTCGTGCACATCCCTATG
TATTATGAAAATTTTTGGACGGATTTCTTCGCACCACAGTACAATGAAGAATTGGGGTTCCACTGGTCCGTTAAC
TTCCTCCCAGATGTTCCCATCTTCGCCTACAGTGTTGCCGATCATGGTGCTTGGGTTGTTCCGGCATTCCGGGAG
CCAGAGAAGTACACTGGAAAGCGCATCAAGATCGTTGCAGACTATATCAGCCTTCGTGATGTTGTGATTCAGTTC
AGCCAGATGACGGGAGAAAAAGCCTCGTTGGCTTTTGAGTTAACCAAGGAACAGTTCGAGGCCTCACGAAACGCT
AACCATCCTGCCGCCGAGCTAATGTATCTATCTTGGGAATATGTTATCCGTGCCGGTCCAAATAGTGGCGTTCGT
GACAAAGAACAGACATTTTCCATATATCCTCAGGCGAAGACTTATCAGCAGTGGTTAAAGGATAGTGAGGTGGTC
AGAGGTCTTGTCGCGAAACTAAAGGCAGAGGCAGCAGCTAGCAGTACGGCGTAA
Gene >Agabi119p4|058540
ATGATGTCTAAACTGATCGTTGTCATAGGCGCTACTGGTCAGTAAGTTGCCAAGCCGTATTGTGTTGTAGGTCTT
TAACTAATGTTATTTGTATAGGCAAGGCGGCTCCGTTATTGACTTCCTCCTCAAAGAGGCTGGTGGGGTCTTTAA
AGTGCGCGGAGTCACAAGAAATCCCAGCTCTCCAGCGTCCCTCGCTCTTGCAGCTAGAGGTGTTGAAGTTGTCAA
GGCCGATTTGAGCTCGCTCGAAGACACAACAAAGGCCTTTTCTGGAGCATGGGGAATTTACGCTGTGACCCAATT
TTATGAGCATGGCTACGAAGCTGAACAACTCCACGGCAAAAATATCGTCGAAGCTGCAAAGGTCGTCGGTGCAAA
TCATATCGTTTTGTCTACCGTTGAGGGTCGAGAAGGTCAATGCCTGGCTATCAGTTGGACTTCCAAGGCCTTAAT
TGAGGATCGTGTAATCGAGTCGGGGATCCCCTTCACTTTCGTGCACATCCCTATGTATTATGAAAATTTTTGGAC
GGATTTCTTCGCACCACAGTACAATGAAGAATTGGGGTTCCACTGGTCCGTTAACTTCCTCCCAGATGTTCCCAT
CTTCGCCTACAGTGTTGCCGATCATGGTGCTTGGGTTGTTCCGGCATTCCGGGAGCCAGAGAAGTACACTGGTGA
GGACTTCCTAGCGGCAGCGTCCCGTCAATTGAATCAGATTGAATCATATACCAGGAAAGCGCATCAAGATCGTTG
CAGACTATATCAGCCTTCGTGATGTTGTGATTCAGTTCAGCCAGATGACGGGAGAAAAAGCCTCGTTGGCTTTTG
AGTTAACCAAGGAACAGTTCGAGGCCTCACGAAACGCTAACCATCCTGCCGCCGAGCTAATGTATCTATCTTGGG
AATATGTTATCCGTGCCGGTCCAAATAGTGGCGTTCGTGTGAGTCTTCTCCGATCTTTTGTCAGGCTTAGGCGCT
TCGGATATGACCCATTAGGACAGGACAAAGAACAGACATTTTCCATATATCCTCAGGCGAAGACTTATCAGCAGT
GGTTAAAGGATAGTGAGGTGGTCAGAGGTCTTGTCGCGAAACTAAAGGCAGAGGCAGCAGCTAGCAGTACGGCGT
AA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail