Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|058270
Gene name
Locationscaffold_03a:1402832..1405212
Strand-
Gene length (bp)2380
Transcript length (bp)2019
Coding sequence length (bp)2019
Protein length (aa) 673

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01189 Methyltr_RsmB-F 16S rRNA methyltransferase RsmB/F 1.2E-74 402 611
PF17125 Methyltr_RsmF_N N-terminal domain of 16S rRNA methyltransferase RsmF 9.1E-08 316 398

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94268|NOP2_SCHPO 25S rRNA (cytosine-C(5))-methyltransferase nop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nop2 PE=1 SV=1 1 665 0.0E+00
sp|P40991|NOP2_YEAST 25S rRNA (cytosine(2870)-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP2 PE=1 SV=1 259 666 0.0E+00
sp|Q922K7|NOP2_MOUSE Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus GN=Nop2 PE=1 SV=1 228 611 2.0E-168
sp|Q60343|TRM4_METJA tRNA (cytosine(48)-C(5))-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trm4 PE=1 SV=1 337 611 3.0E-50
sp|Q9V106|TRCM_PYRAB tRNA (cytosine(49)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB06230 PE=1 SV=1 324 611 3.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94268|NOP2_SCHPO 25S rRNA (cytosine-C(5))-methyltransferase nop2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nop2 PE=1 SV=1 1 665 0.0E+00
sp|P40991|NOP2_YEAST 25S rRNA (cytosine(2870)-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP2 PE=1 SV=1 259 666 0.0E+00
sp|Q922K7|NOP2_MOUSE Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus GN=Nop2 PE=1 SV=1 228 611 2.0E-168
sp|Q60343|TRM4_METJA tRNA (cytosine(48)-C(5))-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=trm4 PE=1 SV=1 337 611 3.0E-50
sp|Q9V106|TRCM_PYRAB tRNA (cytosine(49)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB06230 PE=1 SV=1 324 611 3.0E-47
sp|B5XQ35|RSMF_KLEP3 Ribosomal RNA small subunit methyltransferase F OS=Klebsiella pneumoniae (strain 342) GN=rsmF PE=3 SV=1 324 611 7.0E-46
sp|B7NBI3|RSMF_ECOLU Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rsmF PE=3 SV=1 324 611 6.0E-45
sp|B7USL2|RSMF_ECO27 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rsmF PE=3 SV=1 324 611 1.0E-44
sp|B7MVW5|RSMF_ECO81 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O81 (strain ED1a) GN=rsmF PE=3 SV=1 324 611 1.0E-44
sp|B2VJ83|RSMF_ERWT9 Ribosomal RNA small subunit methyltransferase F OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rsmF PE=3 SV=1 309 611 3.0E-44
sp|B7LPL0|RSMF_ESCF3 Ribosomal RNA small subunit methyltransferase F OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rsmF PE=3 SV=1 324 611 4.0E-44
sp|A6TB06|RSMF_KLEP7 Ribosomal RNA small subunit methyltransferase F OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rsmF PE=3 SV=2 324 611 5.0E-44
sp|B6IBR3|RSMF_ECOSE Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain SE11) GN=rsmF PE=3 SV=2 324 611 5.0E-44
sp|B7M2B1|RSMF_ECO8A Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O8 (strain IAI1) GN=rsmF PE=3 SV=1 324 611 5.0E-44
sp|Q321Y0|RSMF_SHIBS Ribosomal RNA small subunit methyltransferase F OS=Shigella boydii serotype 4 (strain Sb227) GN=rsmF PE=3 SV=2 324 611 6.0E-44
sp|B2U477|RSMF_SHIB3 Ribosomal RNA small subunit methyltransferase F OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rsmF PE=3 SV=2 324 611 6.0E-44
sp|B7L7N7|RSMF_ECO55 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain 55989 / EAEC) GN=rsmF PE=3 SV=1 324 611 6.0E-44
sp|A7ZMV8|RSMF_ECO24 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rsmF PE=3 SV=2 324 611 6.0E-44
sp|Q87PA5|RSMF_VIBPA Ribosomal RNA small subunit methyltransferase F OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rsmF PE=3 SV=1 324 611 6.0E-44
sp|Q32F19|RSMF_SHIDS Ribosomal RNA small subunit methyltransferase F OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rsmF PE=3 SV=2 324 672 6.0E-44
sp|B1J0Q3|RSMF_ECOLC Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rsmF PE=3 SV=2 324 611 8.0E-44
sp|A8A133|RSMF_ECOHS Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O9:H4 (strain HS) GN=rsmF PE=3 SV=2 324 611 8.0E-44
sp|B7NS84|RSMF_ECO7I Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rsmF PE=3 SV=1 324 611 8.0E-44
sp|Q0TGZ7|RSMF_ECOL5 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rsmF PE=3 SV=2 324 611 9.0E-44
sp|B1LD37|RSMF_ECOSM Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rsmF PE=3 SV=2 324 611 1.0E-43
sp|B5YQX9|RSMF_ECO5E Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rsmF PE=3 SV=1 324 661 1.0E-43
sp|Q8XCL9|RSMF_ECO57 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O157:H7 GN=rsmF PE=3 SV=2 324 661 1.0E-43
sp|P76273|RSMF_ECOLI Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain K12) GN=rsmF PE=1 SV=2 324 611 2.0E-43
sp|B1XHA3|RSMF_ECODH Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain K12 / DH10B) GN=rsmF PE=3 SV=1 324 611 2.0E-43
sp|C4ZZJ2|RSMF_ECOBW Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rsmF PE=3 SV=1 324 611 2.0E-43
sp|Q3Z2H4|RSMF_SHISS Ribosomal RNA small subunit methyltransferase F OS=Shigella sonnei (strain Ss046) GN=rsmF PE=3 SV=2 324 611 2.0E-43
sp|A7MKH5|RSMF_CROS8 Ribosomal RNA small subunit methyltransferase F OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rsmF PE=3 SV=2 324 611 2.0E-43
sp|A4WBJ4|RSMF_ENT38 Ribosomal RNA small subunit methyltransferase F OS=Enterobacter sp. (strain 638) GN=rsmF PE=3 SV=1 301 611 2.0E-43
sp|A8AFL6|RSMF_CITK8 Ribosomal RNA small subunit methyltransferase F OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rsmF PE=3 SV=1 324 611 3.0E-43
sp|Q8FGS9|RSMF_ECOL6 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rsmF PE=3 SV=2 324 611 6.0E-43
sp|Q1RAV2|RSMF_ECOUT Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli (strain UTI89 / UPEC) GN=rsmF PE=3 SV=2 324 611 8.0E-43
sp|A1AC00|RSMF_ECOK1 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O1:K1 / APEC GN=rsmF PE=3 SV=2 324 611 8.0E-43
sp|B7MBP2|RSMF_ECO45 Ribosomal RNA small subunit methyltransferase F OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rsmF PE=3 SV=1 324 611 8.0E-43
sp|B8CPH7|RSMF_SHEPW Ribosomal RNA small subunit methyltransferase F OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rsmF PE=3 SV=2 324 611 1.0E-42
sp|A7N0K6|RSMF_VIBCB Ribosomal RNA small subunit methyltransferase F OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rsmF PE=3 SV=2 324 611 2.0E-42
sp|B5FE06|RSMF_VIBFM Ribosomal RNA small subunit methyltransferase F OS=Vibrio fischeri (strain MJ11) GN=rsmF PE=3 SV=1 324 624 3.0E-42
sp|B4TY18|RSMF_SALSV Ribosomal RNA small subunit methyltransferase F OS=Salmonella schwarzengrund (strain CVM19633) GN=rsmF PE=3 SV=2 324 611 4.0E-42
sp|Q8Z662|RSMF_SALTI Ribosomal RNA small subunit methyltransferase F OS=Salmonella typhi GN=rsmF PE=3 SV=1 324 611 4.0E-42
sp|A9MV57|RSMF_SALPB Ribosomal RNA small subunit methyltransferase F OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rsmF PE=3 SV=2 324 611 4.0E-42
sp|Q83RJ3|RSMF_SHIFL Putative ribosomal RNA small subunit methyltransferase F OS=Shigella flexneri GN=rsmF PE=5 SV=2 324 611 4.0E-42
sp|Q0T529|RSMF_SHIF8 Ribosomal RNA small subunit methyltransferase F OS=Shigella flexneri serotype 5b (strain 8401) GN=rsmF PE=3 SV=2 324 611 4.0E-42
sp|C0Q2Y5|RSMF_SALPC Ribosomal RNA small subunit methyltransferase F OS=Salmonella paratyphi C (strain RKS4594) GN=rsmF PE=3 SV=1 324 611 4.0E-42
sp|Q57NF9|RSMF_SALCH Ribosomal RNA small subunit methyltransferase F OS=Salmonella choleraesuis (strain SC-B67) GN=rsmF PE=3 SV=2 324 611 4.0E-42
sp|B4SV89|RSMF_SALNS Ribosomal RNA small subunit methyltransferase F OS=Salmonella newport (strain SL254) GN=rsmF PE=3 SV=2 324 611 4.0E-42
sp|Q8ZNZ2|RSMF_SALTY Ribosomal RNA small subunit methyltransferase F OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rsmF PE=3 SV=1 324 611 4.0E-42
sp|B5BHA6|RSMF_SALPK Ribosomal RNA small subunit methyltransferase F OS=Salmonella paratyphi A (strain AKU_12601) GN=rsmF PE=3 SV=1 324 611 1.0E-41
sp|Q5PHN5|RSMF_SALPA Ribosomal RNA small subunit methyltransferase F OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rsmF PE=3 SV=1 324 611 1.0E-41
sp|C3LMI5|RSMF_VIBCM Ribosomal RNA small subunit methyltransferase F OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rsmF PE=3 SV=2 324 611 2.0E-41
sp|Q9KRY1|RSMF_VIBCH Ribosomal RNA small subunit methyltransferase F OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rsmF PE=3 SV=2 324 611 2.0E-41
sp|B4TKI0|RSMF_SALHS Ribosomal RNA small subunit methyltransferase F OS=Salmonella heidelberg (strain SL476) GN=rsmF PE=3 SV=2 324 611 2.0E-41
sp|B5R8V2|RSMF_SALG2 Ribosomal RNA small subunit methyltransferase F OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rsmF PE=3 SV=1 324 611 2.0E-41
sp|B5R2S1|RSMF_SALEP Ribosomal RNA small subunit methyltransferase F OS=Salmonella enteritidis PT4 (strain P125109) GN=rsmF PE=3 SV=1 324 611 2.0E-41
sp|B5FTI4|RSMF_SALDC Ribosomal RNA small subunit methyltransferase F OS=Salmonella dublin (strain CT_02021853) GN=rsmF PE=3 SV=1 324 611 2.0E-41
sp|A9MNH4|RSMF_SALAR Ribosomal RNA small subunit methyltransferase F OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rsmF PE=3 SV=2 301 611 2.0E-41
sp|B5F3P3|RSMF_SALA4 Ribosomal RNA small subunit methyltransferase F OS=Salmonella agona (strain SL483) GN=rsmF PE=3 SV=1 324 611 4.0E-41
sp|A8GDM6|RSMF_SERP5 Ribosomal RNA small subunit methyltransferase F OS=Serratia proteamaculans (strain 568) GN=rsmF PE=3 SV=2 324 611 4.0E-41
sp|A8FWM8|RSMF_SHESH Ribosomal RNA small subunit methyltransferase F OS=Shewanella sediminis (strain HAW-EB3) GN=rsmF PE=3 SV=1 324 609 7.0E-41
sp|Q7MKY6|RSMF_VIBVY Ribosomal RNA small subunit methyltransferase F OS=Vibrio vulnificus (strain YJ016) GN=rsmF PE=3 SV=2 324 611 1.0E-40
sp|Q8D9F3|RSMF_VIBVU Ribosomal RNA small subunit methyltransferase F OS=Vibrio vulnificus (strain CMCP6) GN=rsmF PE=3 SV=1 324 611 1.0E-40
sp|Q6LQU5|RSMF_PHOPR Ribosomal RNA small subunit methyltransferase F OS=Photobacterium profundum GN=rsmF PE=3 SV=2 324 666 1.0E-40
sp|B6ELC0|RSMF_ALISL Ribosomal RNA small subunit methyltransferase F OS=Aliivibrio salmonicida (strain LFI1238) GN=rsmF PE=3 SV=1 324 622 2.0E-40
sp|Q5E5C7|RSMF_VIBF1 Ribosomal RNA small subunit methyltransferase F OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rsmF PE=3 SV=2 308 624 4.0E-40
sp|Q6D4C8|RSMF_PECAS Ribosomal RNA small subunit methyltransferase F OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rsmF PE=3 SV=1 324 611 7.0E-40
sp|B7VNJ8|RSMF_VIBTL Ribosomal RNA small subunit methyltransferase F OS=Vibrio tasmaniensis (strain LGP32) GN=rsmF PE=3 SV=1 300 611 9.0E-40
sp|C6DFU6|RSMF_PECCP Ribosomal RNA small subunit methyltransferase F OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rsmF PE=3 SV=1 324 611 1.0E-39
sp|A3QDA2|RSMF_SHELP Ribosomal RNA small subunit methyltransferase F OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rsmF PE=3 SV=1 324 610 1.0E-39
sp|Q12MJ8|RSMF_SHEDO Ribosomal RNA small subunit methyltransferase F OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rsmF PE=3 SV=1 324 611 2.0E-39
sp|Q0HVX2|RSMF_SHESR Ribosomal RNA small subunit methyltransferase F OS=Shewanella sp. (strain MR-7) GN=rsmF PE=3 SV=2 324 651 3.0E-39
sp|A0KW34|RSMF_SHESA Ribosomal RNA small subunit methyltransferase F OS=Shewanella sp. (strain ANA-3) GN=rsmF PE=3 SV=2 324 651 5.0E-39
sp|Q0HJM6|RSMF_SHESM Ribosomal RNA small subunit methyltransferase F OS=Shewanella sp. (strain MR-4) GN=rsmF PE=3 SV=2 324 651 7.0E-39
sp|Q3IHA0|RSMF_PSEHT Ribosomal RNA small subunit methyltransferase F OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rsmF PE=3 SV=2 324 611 1.0E-38
sp|A1SWV0|RSMF_PSYIN Ribosomal RNA small subunit methyltransferase F OS=Psychromonas ingrahamii (strain 37) GN=rsmF PE=3 SV=1 324 622 2.0E-38
sp|B0TIZ6|RSMF_SHEHH Ribosomal RNA small subunit methyltransferase F OS=Shewanella halifaxensis (strain HAW-EB4) GN=rsmF PE=3 SV=1 324 611 2.0E-38
sp|A1S788|RSMF_SHEAM Ribosomal RNA small subunit methyltransferase F OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rsmF PE=3 SV=1 324 611 3.0E-38
sp|A6WP46|RSMF_SHEB8 Ribosomal RNA small subunit methyltransferase F OS=Shewanella baltica (strain OS185) GN=rsmF PE=3 SV=2 324 610 6.0E-38
sp|Q8EDY2|RSMF_SHEON Ribosomal RNA small subunit methyltransferase F OS=Shewanella oneidensis (strain MR-1) GN=rsmF PE=3 SV=1 324 610 6.0E-38
sp|A4SMI9|RSMF_AERS4 Ribosomal RNA small subunit methyltransferase F OS=Aeromonas salmonicida (strain A449) GN=rsmF PE=3 SV=1 324 611 1.0E-37
sp|A9L4E6|RSMF_SHEB9 Ribosomal RNA small subunit methyltransferase F OS=Shewanella baltica (strain OS195) GN=rsmF PE=3 SV=2 324 610 1.0E-37
sp|A1RIZ0|RSMF_SHESW Ribosomal RNA small subunit methyltransferase F OS=Shewanella sp. (strain W3-18-1) GN=rsmF PE=3 SV=2 324 610 1.0E-37
sp|A4Y7J8|RSMF_SHEPC Ribosomal RNA small subunit methyltransferase F OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rsmF PE=3 SV=2 324 610 1.0E-37
sp|B1KQN1|RSMF_SHEWM Ribosomal RNA small subunit methyltransferase F OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rsmF PE=3 SV=1 324 640 1.0E-37
sp|A0KKI5|RSMF_AERHH Ribosomal RNA small subunit methyltransferase F OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rsmF PE=3 SV=2 324 611 2.0E-37
sp|B8E968|RSMF_SHEB2 Ribosomal RNA small subunit methyltransferase F OS=Shewanella baltica (strain OS223) GN=rsmF PE=3 SV=2 324 610 2.0E-37
sp|A3D5D5|RSMF_SHEB5 Ribosomal RNA small subunit methyltransferase F OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rsmF PE=3 SV=2 324 610 3.0E-37
sp|A8H3W2|RSMF_SHEPA Ribosomal RNA small subunit methyltransferase F OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rsmF PE=3 SV=1 324 609 8.0E-37
sp|Q081I3|RSMF_SHEFN Ribosomal RNA small subunit methyltransferase F OS=Shewanella frigidimarina (strain NCIMB 400) GN=rsmF PE=3 SV=1 324 611 1.0E-36
sp|Q5SII2|RSMF_THET8 Ribosomal RNA small subunit methyltransferase F OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rsmF PE=1 SV=1 338 611 6.0E-35
sp|A8AQI3|RSMB_CITK8 Ribosomal RNA small subunit methyltransferase B OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rsmB PE=3 SV=1 225 610 1.0E-33
sp|B1JJH6|RSMB_YERPY Ribosomal RNA small subunit methyltransferase B OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rsmB PE=3 SV=1 301 610 7.0E-33
sp|Q664V2|RSMB_YERPS Ribosomal RNA small subunit methyltransferase B OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rsmB PE=3 SV=1 301 610 7.0E-33
sp|A4TH21|RSMB_YERPP Ribosomal RNA small subunit methyltransferase B OS=Yersinia pestis (strain Pestoides F) GN=rsmB PE=3 SV=1 301 610 7.0E-33
sp|Q1CCX4|RSMB_YERPN Ribosomal RNA small subunit methyltransferase B OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rsmB PE=3 SV=1 301 610 7.0E-33
sp|Q8ZJ81|RSMB_YERPE Ribosomal RNA small subunit methyltransferase B OS=Yersinia pestis GN=rsmB PE=3 SV=1 301 610 7.0E-33
sp|B2K506|RSMB_YERPB Ribosomal RNA small subunit methyltransferase B OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rsmB PE=3 SV=1 301 610 7.0E-33
sp|Q1C2X7|RSMB_YERPA Ribosomal RNA small subunit methyltransferase B OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rsmB PE=3 SV=1 301 610 7.0E-33
sp|A7FNK4|RSMB_YERP3 Ribosomal RNA small subunit methyltransferase B OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rsmB PE=3 SV=1 301 610 7.0E-33
sp|P72943|RSMB_SYNY3 Ribosomal RNA small subunit methyltransferase B OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rsmB PE=3 SV=1 303 611 2.0E-32
sp|A9R925|RSMB_YERPG Ribosomal RNA small subunit methyltransferase B OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rsmB PE=3 SV=2 301 610 6.0E-32
sp|A9N8B3|RSMB_SALPB Ribosomal RNA small subunit methyltransferase B OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rsmB PE=3 SV=1 325 571 3.0E-31
sp|P36929|RSMB_ECOLI Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli (strain K12) GN=rsmB PE=1 SV=2 325 610 3.0E-31
sp|B1IQ11|RSMB_ECOLC Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rsmB PE=3 SV=1 325 610 3.0E-31
sp|A8A593|RSMB_ECOHS Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O9:H4 (strain HS) GN=rsmB PE=3 SV=1 325 610 3.0E-31
sp|B1X6E1|RSMB_ECODH Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli (strain K12 / DH10B) GN=rsmB PE=3 SV=1 325 610 3.0E-31
sp|C4ZUE3|RSMB_ECOBW Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rsmB PE=3 SV=1 325 610 3.0E-31
sp|B5FJI4|RSMB_SALDC Ribosomal RNA small subunit methyltransferase B OS=Salmonella dublin (strain CT_02021853) GN=rsmB PE=3 SV=1 325 571 3.0E-31
sp|A9MN78|RSMB_SALAR Ribosomal RNA small subunit methyltransferase B OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rsmB PE=3 SV=1 324 610 4.0E-31
sp|P94464|RSMB_BACSU Ribosomal RNA small subunit methyltransferase B OS=Bacillus subtilis (strain 168) GN=rsmB PE=3 SV=2 291 611 5.0E-31
sp|B7NLK8|RSMB_ECO7I Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rsmB PE=3 SV=1 325 610 5.0E-31
sp|Q7UBD3|RSMB_SHIFL Ribosomal RNA small subunit methyltransferase B OS=Shigella flexneri GN=rsmB PE=3 SV=1 327 610 5.0E-31
sp|B1LGP5|RSMB_ECOSM Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rsmB PE=3 SV=1 325 610 6.0E-31
sp|B6I202|RSMB_ECOSE Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli (strain SE11) GN=rsmB PE=3 SV=1 325 610 6.0E-31
sp|B7M0Z4|RSMB_ECO8A Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O8 (strain IAI1) GN=rsmB PE=3 SV=1 325 610 6.0E-31
sp|B7LHZ0|RSMB_ECO55 Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli (strain 55989 / EAEC) GN=rsmB PE=3 SV=1 325 610 6.0E-31
sp|A7ZSH7|RSMB_ECO24 Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rsmB PE=3 SV=1 325 610 6.0E-31
sp|B4TJX9|RSMB_SALHS Ribosomal RNA small subunit methyltransferase B OS=Salmonella heidelberg (strain SL476) GN=rsmB PE=3 SV=1 324 571 6.0E-31
sp|Q31VY8|RSMB_SHIBS Ribosomal RNA small subunit methyltransferase B OS=Shigella boydii serotype 4 (strain Sb227) GN=rsmB PE=3 SV=1 325 610 6.0E-31
sp|B4SUR0|RSMB_SALNS Ribosomal RNA small subunit methyltransferase B OS=Salmonella newport (strain SL254) GN=rsmB PE=3 SV=1 324 571 6.0E-31
sp|Q3YWX1|RSMB_SHISS Ribosomal RNA small subunit methyltransferase B OS=Shigella sonnei (strain Ss046) GN=rsmB PE=3 SV=1 325 610 7.0E-31
sp|B5BGV5|RSMB_SALPK Ribosomal RNA small subunit methyltransferase B OS=Salmonella paratyphi A (strain AKU_12601) GN=rsmB PE=3 SV=1 325 571 7.0E-31
sp|Q5PIT6|RSMB_SALPA Ribosomal RNA small subunit methyltransferase B OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rsmB PE=3 SV=1 325 571 7.0E-31
sp|B7UK12|RSMB_ECO27 Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rsmB PE=3 SV=1 325 610 7.0E-31
sp|Q8ZLM5|RSMB_SALTY Ribosomal RNA small subunit methyltransferase B OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rsmB PE=3 SV=1 324 571 7.0E-31
sp|B5YT08|RSMB_ECO5E Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rsmB PE=3 SV=1 325 610 7.0E-31
sp|Q8XEE5|RSMB_ECO57 Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O157:H7 GN=rsmB PE=3 SV=1 325 610 7.0E-31
sp|B5RH47|RSMB_SALG2 Ribosomal RNA small subunit methyltransferase B OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rsmB PE=3 SV=1 324 571 8.0E-31
sp|B5R1E5|RSMB_SALEP Ribosomal RNA small subunit methyltransferase B OS=Salmonella enteritidis PT4 (strain P125109) GN=rsmB PE=3 SV=1 324 571 8.0E-31
sp|Q0T014|RSMB_SHIF8 Ribosomal RNA small subunit methyltransferase B OS=Shigella flexneri serotype 5b (strain 8401) GN=rsmB PE=3 SV=2 327 610 8.0E-31
sp|C0PZV1|RSMB_SALPC Ribosomal RNA small subunit methyltransferase B OS=Salmonella paratyphi C (strain RKS4594) GN=rsmB PE=3 SV=1 374 571 8.0E-31
sp|Q57J62|RSMB_SALCH Ribosomal RNA small subunit methyltransferase B OS=Salmonella choleraesuis (strain SC-B67) GN=rsmB PE=3 SV=1 374 571 8.0E-31
sp|Q8Z1X1|RSMB_SALTI Ribosomal RNA small subunit methyltransferase B OS=Salmonella typhi GN=rsmB PE=3 SV=1 325 571 9.0E-31
sp|B2U2Q6|RSMB_SHIB3 Ribosomal RNA small subunit methyltransferase B OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rsmB PE=3 SV=1 325 610 1.0E-30
sp|B7LRQ5|RSMB_ESCF3 Ribosomal RNA small subunit methyltransferase B OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rsmB PE=3 SV=1 325 610 2.0E-30
sp|B4TXB2|RSMB_SALSV Ribosomal RNA small subunit methyltransferase B OS=Salmonella schwarzengrund (strain CVM19633) GN=rsmB PE=3 SV=1 374 571 3.0E-30
sp|A8GKG7|RSMB_SERP5 Ribosomal RNA small subunit methyltransferase B OS=Serratia proteamaculans (strain 568) GN=rsmB PE=3 SV=1 301 610 3.0E-30
sp|B7NDR0|RSMB_ECOLU Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rsmB PE=3 SV=1 325 610 3.0E-30
sp|Q32B61|RSMB_SHIDS Ribosomal RNA small subunit methyltransferase B OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rsmB PE=3 SV=1 325 610 3.0E-30
sp|B5F7R5|RSMB_SALA4 Ribosomal RNA small subunit methyltransferase B OS=Salmonella agona (strain SL483) GN=rsmB PE=3 SV=1 325 571 4.0E-30
sp|Q8FD12|RSMB_ECOL6 Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rsmB PE=3 SV=1 325 610 6.0E-30
sp|B7N0S9|RSMB_ECO81 Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O81 (strain ED1a) GN=rsmB PE=3 SV=1 325 610 7.0E-30
sp|B2VK95|RSMB_ERWT9 Ribosomal RNA small subunit methyltransferase B OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rsmB PE=3 SV=1 294 610 1.0E-29
sp|Q1R644|RSMB_ECOUT Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli (strain UTI89 / UPEC) GN=rsmB PE=3 SV=1 325 610 2.0E-29
sp|A1AGI0|RSMB_ECOK1 Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O1:K1 / APEC GN=rsmB PE=3 SV=1 325 610 2.0E-29
sp|B7MCQ4|RSMB_ECO45 Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rsmB PE=3 SV=1 325 610 2.0E-29
sp|C6DFR7|RSMB_PECCP Ribosomal RNA small subunit methyltransferase B OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rsmB PE=3 SV=1 325 610 2.0E-29
sp|Q0TCH3|RSMB_ECOL5 Ribosomal RNA small subunit methyltransferase B OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rsmB PE=3 SV=1 325 610 2.0E-29
sp|Q6D000|RSMB_PECAS Ribosomal RNA small subunit methyltransferase B OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rsmB PE=3 SV=1 325 610 6.0E-29
sp|A4WF97|RSMB_ENT38 Ribosomal RNA small subunit methyltransferase B OS=Enterobacter sp. (strain 638) GN=rsmB PE=3 SV=1 374 610 7.0E-29
sp|A6TEU2|RSMB_KLEP7 Ribosomal RNA small subunit methyltransferase B OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rsmB PE=3 SV=1 293 571 2.0E-28
sp|Q7TS68|NSUN6_MOUSE Putative methyltransferase NSUN6 OS=Mus musculus GN=Nsun6 PE=2 SV=2 369 620 3.0E-28
sp|Q9KVU5|RSMB_VIBCH Ribosomal RNA small subunit methyltransferase B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rsmB PE=3 SV=1 294 608 8.0E-28
sp|Q7MYI0|RSMB_PHOLL Ribosomal RNA small subunit methyltransferase B OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rsmB PE=3 SV=1 300 610 1.0E-27
sp|B5XNC2|RSMB_KLEP3 Ribosomal RNA small subunit methyltransferase B OS=Klebsiella pneumoniae (strain 342) GN=rsmB PE=3 SV=1 225 571 4.0E-27
sp|A7MPE7|RSMB_CROS8 Ribosomal RNA small subunit methyltransferase B OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rsmB PE=3 SV=1 225 610 5.0E-27
sp|Q7MGK4|RSMB_VIBVY Ribosomal RNA small subunit methyltransferase B OS=Vibrio vulnificus (strain YJ016) GN=rsmB PE=3 SV=1 325 608 2.0E-26
sp|Q87KD3|RSMB_VIBPA Ribosomal RNA small subunit methyltransferase B OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rsmB PE=3 SV=1 274 608 2.0E-26
sp|Q8TEA1|NSUN6_HUMAN Putative methyltransferase NSUN6 OS=Homo sapiens GN=NSUN6 PE=1 SV=1 379 610 2.0E-26
sp|Q9I7A9|RSMB_PSEAE Ribosomal RNA small subunit methyltransferase B OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rsmB PE=3 SV=1 298 615 3.0E-26
sp|A1JRZ3|RSMB_YERE8 Ribosomal RNA small subunit methyltransferase B OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rsmB PE=3 SV=1 301 610 3.0E-26
sp|Q2NQQ2|RSMB_SODGM Ribosomal RNA small subunit methyltransferase B OS=Sodalis glossinidius (strain morsitans) GN=rsmB PE=3 SV=1 320 569 1.0E-25
sp|Q9PEV0|RSMB_XYLFA Ribosomal RNA small subunit methyltransferase B OS=Xylella fastidiosa (strain 9a5c) GN=rsmB PE=3 SV=1 272 610 1.0E-25
sp|Q8DDE5|RSMB_VIBVU Ribosomal RNA small subunit methyltransferase B OS=Vibrio vulnificus (strain CMCP6) GN=rsmB PE=3 SV=1 325 608 2.0E-25
sp|P44788|RSMB_HAEIN Ribosomal RNA small subunit methyltransferase B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rsmB PE=3 SV=1 324 610 3.0E-25
sp|Q87AR1|RSMB_XYLFT Ribosomal RNA small subunit methyltransferase B OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rsmB PE=3 SV=1 270 610 9.0E-25
sp|P38205|NCL1_YEAST Multisite-specific tRNA:(cytosine-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NCL1 PE=1 SV=1 385 611 2.0E-24
sp|Q8K4F6|NSUN5_MOUSE Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Mus musculus GN=Nsun5 PE=2 SV=2 327 611 3.0E-24
sp|P45679|RSMB_COXBU Ribosomal RNA small subunit methyltransferase B OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rsmB PE=3 SV=1 328 575 3.0E-23
sp|O13935|TRM4B_SCHPO Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm4b PE=3 SV=2 275 608 6.0E-23
sp|Q88B41|RSMB_PSESM Ribosomal RNA small subunit methyltransferase B OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rsmB PE=3 SV=1 328 610 9.0E-23
sp|Q28E61|NSUN2_XENTR tRNA (cytosine(34)-C(5))-methyltransferase OS=Xenopus tropicalis GN=nsun2 PE=2 SV=1 304 608 1.0E-22
sp|Q1HFZ0|NSUN2_MOUSE tRNA (cytosine(34)-C(5))-methyltransferase OS=Mus musculus GN=Nsun2 PE=1 SV=2 304 608 3.0E-22
sp|Q96P11|NSUN5_HUMAN Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Homo sapiens GN=NSUN5 PE=1 SV=2 328 608 3.0E-22
sp|B4F1L5|RSMB_PROMH Ribosomal RNA small subunit methyltransferase B OS=Proteus mirabilis (strain HI4320) GN=rsmB PE=3 SV=1 374 549 3.0E-22
sp|Q8EKR0|RSMB_SHEON Ribosomal RNA small subunit methyltransferase B OS=Shewanella oneidensis (strain MR-1) GN=rsmB PE=3 SV=1 380 610 4.0E-22
sp|Q08J23|NSUN2_HUMAN tRNA (cytosine(34)-C(5))-methyltransferase OS=Homo sapiens GN=NSUN2 PE=1 SV=2 304 608 4.0E-22
sp|Q9CKP7|RSMB_PASMU Ribosomal RNA small subunit methyltransferase B OS=Pasteurella multocida (strain Pm70) GN=rsmB PE=3 SV=1 324 611 5.0E-22
sp|Q4V7N2|NSUN2_XENLA tRNA (cytosine(34)-C(5))-methyltransferase OS=Xenopus laevis GN=nsun2 PE=2 SV=1 304 608 8.0E-22
sp|Q5ZLV4|NSUN2_CHICK tRNA (cytosine(34)-C(5))-methyltransferase OS=Gallus gallus GN=NSUN2 PE=2 SV=1 304 608 8.0E-21
sp|Q88RR3|RSMB_PSEPK Ribosomal RNA small subunit methyltransferase B OS=Pseudomonas putida (strain KT2440) GN=rsmB PE=3 SV=1 311 610 3.0E-20
sp|Q7VKC4|RSMB_HAEDU Ribosomal RNA small subunit methyltransferase B OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rsmB PE=3 SV=1 285 611 3.0E-20
sp|Q0V8R7|NSUN4_BOVIN 5-methylcytosine rRNA methyltransferase NSUN4 OS=Bos taurus GN=NSUN4 PE=2 SV=2 391 597 4.0E-19
sp|Q9HGQ2|TRM4A_SCHPO Multisite-specific tRNA:(cytosine-C(5))-methyltransferase trm4a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm4a PE=1 SV=3 368 608 4.0E-19
sp|Q4KMK0|NSUN3_DANRE Putative methyltransferase NSUN3 OS=Danio rerio GN=nsun3 PE=2 SV=1 324 590 5.0E-19
sp|Q8PG22|RSMB_XANAC Ribosomal RNA small subunit methyltransferase B OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rsmB PE=3 SV=1 374 608 1.0E-18
sp|Q9W4M9|NSUN2_DROME tRNA (cytosine(34)-C(5))-methyltransferase OS=Drosophila melanogaster GN=Nsun2 PE=2 SV=1 385 647 3.0E-18
sp|Q0P5D8|NSUN3_BOVIN Putative methyltransferase NSUN3 OS=Bos taurus GN=NSUN3 PE=2 SV=1 387 567 1.0E-17
sp|Q96CB9|NSUN4_HUMAN 5-methylcytosine rRNA methyltransferase NSUN4 OS=Homo sapiens GN=NSUN4 PE=1 SV=2 391 562 2.0E-17
sp|Q8CCT7|NSUN3_MOUSE Putative methyltransferase NSUN3 OS=Mus musculus GN=Nsun3 PE=2 SV=1 387 567 2.0E-17
sp|Q9CZ57|NSUN4_MOUSE 5-methylcytosine rRNA methyltransferase NSUN4 OS=Mus musculus GN=Nsun4 PE=1 SV=1 391 562 5.0E-17
sp|Q9H649|NSUN3_HUMAN Putative methyltransferase NSUN3 OS=Homo sapiens GN=NSUN3 PE=2 SV=1 387 568 1.0E-16
sp|Q5M7E3|NSUN4_XENLA 5-methylcytosine rRNA methyltransferase NSUN4 OS=Xenopus laevis GN=nsun4 PE=2 SV=1 391 557 3.0E-16
sp|P9WGX3|Y1407_MYCTU Putative methyltransferase Rv1407 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1407 PE=1 SV=1 389 611 3.0E-15
sp|P9WGX2|Y1407_MYCTO Putative methyltransferase MT1451 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1451 PE=3 SV=1 389 611 3.0E-15
sp|Q8P4G1|RSMB_XANCP Ribosomal RNA small subunit methyltransferase B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rsmB PE=3 SV=1 374 608 9.0E-15
sp|Q66KI9|NSUN4_XENTR 5-methylcytosine rRNA methyltransferase NSUN4 OS=Xenopus tropicalis GN=nsun4 PE=2 SV=1 391 557 1.0E-14
sp|Q5SK01|RSMB_THET8 Ribosomal RNA small subunit methyltransferase B OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rsmB PE=1 SV=1 394 611 1.0E-13
sp|Q63ZY6|NSN5C_HUMAN Putative methyltransferase NSUN5C OS=Homo sapiens GN=NSUN5P2 PE=5 SV=2 371 608 8.0E-13
sp|O14039|RCM1_SCHPO 25S rRNA (cytosine-C(5))-methyltransferase rcm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rcm1 PE=3 SV=3 329 610 2.0E-12
sp|P53972|RCM1_YEAST 25S rRNA (cytosine(2278)-C(5))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCM1 PE=1 SV=1 328 553 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|058270
MGRRAKNKQGAPQPLQEESSSIIRSNGKRKASNEGTGTNQPRKKLKDASNKTIVSPRSKPVAPNGKGRPQKNKNE
TKSRKKEQSLEDEDEDGDGWEDVEHEGNEVDLKAQARSLFDSSDDEMVQGDLDSDDEPEDDEPLRGAPQEFDFDS
DEDDGAGPILSTARISKQARPATIVPSNSDEDSSDSDEGGKITMANIEARSRALDEAAAAGAEIDAQELRQAALE
ASDDDIDMEEEDIDGELRLPTVTEREEEKNKGGPDVHTVQQRMKHCVRVLGNFKKRAEKGRLRHEYTEQLISDIA
SYYGYNEFLAEKLFQLFSVAEAIEFFEANEVPRPVTIRTNTLRTRRRDLAQALINRGVNLEPIGKWTNVGLQIFE
SSVPVGATPEYLAGHYMLQAASSFLPVIALSPQPNERVLDMASAPGGKATHIAALLQNTGVVFANDANKARTKSL
TANVHRLGCKNVVVCSYDGREFPKVMGGFDRVLLDAPCSGSGVISKDSSVKVNKSERDFTLLSHLQKQLILCAID
SVSPESKTGGYLVYSTCSVTVDENEAVVDYALRKRPNVTLVDTGLPFGREGFTKYRGKVFNPSIGLTRRFYPHAH
NMDGFFVAKFKIGKRSKSKTISEVNDVQMTVASAESGDEIGFDPNEDKVYIEKAKRRQMKAKGLRPPPREKE*
Coding >Agabi119p4|058270
ATGGGCCGTCGCGCAAAAAACAAGCAGGGTGCCCCACAACCGCTTCAAGAAGAAAGTTCATCAATAATCCGAAGC
AATGGAAAACGCAAAGCCAGCAATGAGGGTACAGGCACCAATCAACCCCGCAAGAAATTAAAAGATGCGTCGAAT
AAAACAATCGTATCACCAAGGTCAAAACCTGTTGCACCTAATGGGAAAGGCCGACCACAAAAGAACAAAAATGAA
ACAAAATCGCGAAAGAAGGAGCAGTCGCTCGAGGATGAGGATGAGGACGGAGATGGATGGGAAGATGTCGAGCAT
GAAGGTAATGAAGTCGACTTGAAAGCTCAGGCAAGGTCGCTTTTTGATAGCAGTGACGATGAAATGGTCCAAGGT
GATTTGGACAGTGACGACGAGCCGGAAGATGATGAGCCTTTGAGGGGAGCCCCTCAAGAATTTGACTTTGACTCA
GATGAAGATGATGGAGCCGGACCAATACTCTCAACGGCTAGAATATCAAAACAAGCCAGACCTGCGACGATTGTG
CCCTCTAATTCAGATGAAGATTCAAGCGACTCAGACGAAGGTGGTAAGATCACAATGGCAAATATAGAGGCTCGT
TCCCGCGCGTTGGACGAGGCCGCCGCGGCGGGAGCGGAAATAGATGCACAAGAATTGCGTCAGGCAGCTCTAGAA
GCGAGTGACGATGATATCGACATGGAGGAAGAAGATATTGATGGAGAGCTGAGGCTTCCGACTGTGACAGAGAGA
GAGGAGGAAAAGAACAAAGGCGGACCTGATGTTCACACTGTACAACAAAGAATGAAGCATTGTGTTCGTGTACTC
GGAAACTTCAAAAAACGCGCGGAAAAGGGCAGGCTGAGGCATGAGTATACTGAGCAGTTAATTTCGGATATTGCA
AGCTACTATGGGTATAATGAGTTCCTTGCAGAAAAGCTATTCCAACTTTTTTCCGTGGCTGAGGCGATCGAGTTT
TTTGAGGCAAACGAAGTGCCTCGACCTGTCACTATCCGAACAAATACCCTTCGTACCCGCCGGAGAGATCTTGCC
CAGGCTCTGATCAACAGAGGGGTGAATTTAGAGCCAATTGGTAAATGGACGAATGTTGGGCTTCAGATCTTCGAA
AGCAGTGTCCCTGTTGGTGCGACTCCTGAGTATTTGGCGGGCCATTACATGCTTCAGGCTGCGTCTTCATTTCTA
CCCGTTATTGCTTTATCTCCTCAGCCCAACGAACGCGTATTGGACATGGCGTCCGCCCCTGGAGGCAAAGCCACA
CATATTGCAGCACTCCTGCAGAATACGGGAGTTGTTTTCGCGAATGACGCCAATAAAGCCCGTACAAAAAGCCTT
ACGGCTAATGTCCATCGCCTTGGGTGCAAAAATGTTGTAGTGTGCTCTTACGACGGCCGAGAATTTCCGAAAGTT
ATGGGCGGCTTTGACCGCGTTTTGCTCGATGCTCCCTGCAGCGGTTCAGGTGTTATCAGCAAGGATTCTAGCGTC
AAGGTCAATAAGTCTGAGCGTGATTTTACGCTTCTTTCTCACCTACAAAAACAGCTCATCCTGTGCGCTATCGAT
AGCGTGAGCCCTGAGTCAAAGACGGGAGGTTACCTTGTGTATTCGACATGCTCAGTCACAGTGGATGAGAACGAG
GCTGTCGTCGATTATGCACTCCGCAAGCGACCCAATGTGACTCTCGTCGATACCGGGTTGCCCTTTGGCCGCGAG
GGATTTACTAAATACAGAGGGAAAGTATTCAATCCCAGTATTGGTCTTACCCGACGCTTTTACCCTCATGCGCAT
AACATGGATGGATTTTTCGTTGCCAAGTTCAAGATCGGTAAACGGTCAAAATCAAAAACCATCTCCGAAGTCAAT
GACGTTCAGATGACGGTTGCGAGTGCTGAAAGTGGTGACGAAATAGGTTTTGATCCGAATGAAGATAAGGTGTAT
ATTGAAAAGGCTAAGCGGAGGCAAATGAAGGCCAAGGGATTACGCCCTCCACCGCGTGAAAAAGAATGA
Transcript >Agabi119p4|058270
ATGGGCCGTCGCGCAAAAAACAAGCAGGGTGCCCCACAACCGCTTCAAGAAGAAAGTTCATCAATAATCCGAAGC
AATGGAAAACGCAAAGCCAGCAATGAGGGTACAGGCACCAATCAACCCCGCAAGAAATTAAAAGATGCGTCGAAT
AAAACAATCGTATCACCAAGGTCAAAACCTGTTGCACCTAATGGGAAAGGCCGACCACAAAAGAACAAAAATGAA
ACAAAATCGCGAAAGAAGGAGCAGTCGCTCGAGGATGAGGATGAGGACGGAGATGGATGGGAAGATGTCGAGCAT
GAAGGTAATGAAGTCGACTTGAAAGCTCAGGCAAGGTCGCTTTTTGATAGCAGTGACGATGAAATGGTCCAAGGT
GATTTGGACAGTGACGACGAGCCGGAAGATGATGAGCCTTTGAGGGGAGCCCCTCAAGAATTTGACTTTGACTCA
GATGAAGATGATGGAGCCGGACCAATACTCTCAACGGCTAGAATATCAAAACAAGCCAGACCTGCGACGATTGTG
CCCTCTAATTCAGATGAAGATTCAAGCGACTCAGACGAAGGTGGTAAGATCACAATGGCAAATATAGAGGCTCGT
TCCCGCGCGTTGGACGAGGCCGCCGCGGCGGGAGCGGAAATAGATGCACAAGAATTGCGTCAGGCAGCTCTAGAA
GCGAGTGACGATGATATCGACATGGAGGAAGAAGATATTGATGGAGAGCTGAGGCTTCCGACTGTGACAGAGAGA
GAGGAGGAAAAGAACAAAGGCGGACCTGATGTTCACACTGTACAACAAAGAATGAAGCATTGTGTTCGTGTACTC
GGAAACTTCAAAAAACGCGCGGAAAAGGGCAGGCTGAGGCATGAGTATACTGAGCAGTTAATTTCGGATATTGCA
AGCTACTATGGGTATAATGAGTTCCTTGCAGAAAAGCTATTCCAACTTTTTTCCGTGGCTGAGGCGATCGAGTTT
TTTGAGGCAAACGAAGTGCCTCGACCTGTCACTATCCGAACAAATACCCTTCGTACCCGCCGGAGAGATCTTGCC
CAGGCTCTGATCAACAGAGGGGTGAATTTAGAGCCAATTGGTAAATGGACGAATGTTGGGCTTCAGATCTTCGAA
AGCAGTGTCCCTGTTGGTGCGACTCCTGAGTATTTGGCGGGCCATTACATGCTTCAGGCTGCGTCTTCATTTCTA
CCCGTTATTGCTTTATCTCCTCAGCCCAACGAACGCGTATTGGACATGGCGTCCGCCCCTGGAGGCAAAGCCACA
CATATTGCAGCACTCCTGCAGAATACGGGAGTTGTTTTCGCGAATGACGCCAATAAAGCCCGTACAAAAAGCCTT
ACGGCTAATGTCCATCGCCTTGGGTGCAAAAATGTTGTAGTGTGCTCTTACGACGGCCGAGAATTTCCGAAAGTT
ATGGGCGGCTTTGACCGCGTTTTGCTCGATGCTCCCTGCAGCGGTTCAGGTGTTATCAGCAAGGATTCTAGCGTC
AAGGTCAATAAGTCTGAGCGTGATTTTACGCTTCTTTCTCACCTACAAAAACAGCTCATCCTGTGCGCTATCGAT
AGCGTGAGCCCTGAGTCAAAGACGGGAGGTTACCTTGTGTATTCGACATGCTCAGTCACAGTGGATGAGAACGAG
GCTGTCGTCGATTATGCACTCCGCAAGCGACCCAATGTGACTCTCGTCGATACCGGGTTGCCCTTTGGCCGCGAG
GGATTTACTAAATACAGAGGGAAAGTATTCAATCCCAGTATTGGTCTTACCCGACGCTTTTACCCTCATGCGCAT
AACATGGATGGATTTTTCGTTGCCAAGTTCAAGATCGGTAAACGGTCAAAATCAAAAACCATCTCCGAAGTCAAT
GACGTTCAGATGACGGTTGCGAGTGCTGAAAGTGGTGACGAAATAGGTTTTGATCCGAATGAAGATAAGGTGTAT
ATTGAAAAGGCTAAGCGGAGGCAAATGAAGGCCAAGGGATTACGCCCTCCACCGCGTGAAAAAGAATGA
Gene >Agabi119p4|058270
ATGGGCCGTCGCGCAAAAAACAAGCAGGGTGCCCCACAACCGCTTCAAGAAGAAAGTTCATCAATAATCCGAAGC
AATGGAAAACGCAAAGCCAGCAATGAGGGTACAGGCACCAATCAACCCCGCAAGAAATTAAAAGATGCGTCGAAT
AAAACAATCGTATCACCAAGGTCAAAACCTGTTGCACCTAATGGGAAAGGCCGACCACAAAAGAACAAAAATGAA
ACAAAATCGCGAAAGAAGGAGCAGTCGCTCGAGGATGAGGATGAGGACGGAGATGGATGGGAAGATGTCGAGCAT
GAAGGTAATGAAGTCGACTTGAAAGCTCAGGCAAGGTTGGTTTTTGTACAGCTACAACCGGTATCGTAACTAATG
TTCGCACAACAAGGTCGCTTTTTGATAGCAGTGACGATGAAATGGTCCAAGGTGATTTGGACAGTGACGACGAGC
CGGAAGAGTAGGTCCGACCTCAAAATTATTCATGATCGGCGCTTAGTTGCATACAGTGATGAGCCTTTGAGGGGA
GCCCCTCAAGAATTTGACTTTGACTCAGATGAAGATGATGGAGCCGGACCAATACTCTCAACGGCTAGAATATCA
AAACAAGCCAGACCTGCGACGATTGTGCCCTCTAATTCAGATGAAGATTCAAGCGACTCAGACGAAGGTGGTAAG
ATCACAATGGCAAATATAGAGGCTCGTTCCCGCGCGTTGGACGAGGCCGCCGCGGCGGGAGCGGAAATAGATGCA
CAAGAATTGCGTCAGGCAGCTCTAGAAGCGAGTGACGATGATATCGACATGGAGGAAGAAGATATTGATGGAGAG
CTGAGGCTTCCGACTGTGACAGAGAGAGAGGAGGAAAAGAACAAAGGCGGACCTGATGTTCACACTGTACAACAA
AGAATGAAGCATTGTGTTCGTGTACTCGGAAACTTCAAAAAACGCGCGGAAAAGGGCAGGTAAGTATTCATGAAG
TTGTTCTCCCCAGTCACACTAATCATTCAATCTTCGGATAGGCTGAGGCATGAGTATACTGAGCAGTTAATTTCG
GATATTGCAAGCTACTATGGGTATAATGAGTTCCTTGCAGAAAAGCTATTCCAACTTTTTTCCGTGGCTGAGGCA
TGTTTCTTCTGATCTTATTTGTAAAAAATCTGACACAAATGTCAGGCGATCGAGTTTTTTGAGGCAAACGAAGTG
CCTCGACCTGTCACTATCCGAACAAATACCCTTCGTACCCGCCGGAGAGATCTTGCCCAGGCTCTGATCAACAGA
GGGGTGAATTTAGAGCCAATTGGTAAATGGACGAATGTTGGGCTTCAGATCTTCGAAAGCAGTGTCCCTGTTGGT
GGGTACACGTCATAATTGTCAAATTATCCACCTAACAATATTCAGGTGCGACTCCTGAGTATTTGGCGGGCCATT
ACATGCTTCAGGCTGCGTCTTCATTTCTACCCGTTATTGCTTTATCTCCTCAGCCCAACGAACGCGTATTGGACA
TGGCGTCCGCCCCTGGAGGCAAAGCCACACATATTGCAGCACTCCTGCAGAATACGGGAGTTGTTTTCGCGAATG
ACGCCAATAAAGCCCGTACAAAAAGCCTTACGGCTAATGTCCATCGCCTTGGGTGCAAAAATGTTGTAGTGTGCT
CTTACGACGGCCGAGAATTTCCGAAAGTTATGGGCGGCTTTGACCGCGTTTTGCTCGATGCTCCCTGCAGCGGTT
CAGGTGTTATCAGCAAGGATTCTAGCGTCAAGGTCAATAAGGTAACGCAATTTCATCTAGGTTCTGACTAGGTTG
CGAACTAACGTCAGCCTTCATAGTCTGAGCGTGATTTTACGCTTCTTTCTCACCTACAAAAACAGCTCATCCTGT
GCGCTATCGATAGCGTGAGCCCTGAGTCAAAGACGGGAGGTTACCTTGTGTATTCGACATGCTCAGTCACAGTGG
ATGAGAACGAGGCTGTCGTCGATTATGCACTCCGCAAGCGACCCAATGTGACTCTCGTCGATACCGGGTTGCCCT
TTGGCCGCGAGGGATTTACTAAATACAGAGGGAAAGTATTCAATCCCAGTATTGGTCTTACCCGACGCTTTTACC
CTCATGCGCATAACATGGATGGATTTTTCGTTGCCAAGTTCAAGATCGGTAAACGGTCAAAATCAAAAACCATCT
CCGAAGTCAATGACGTTCAGATGACGGTTGCGAGTGCTGAAAGTGGTGACGAAATAGGTTTTGATCCGAATGAAG
ATAAGGTGTATATTGAAAGTGAGTATCGTACTTTGTCGTTGAAGATTTCTCCTCAACTTTCCCTGCAGAGGCTAA
GCGGAGGCAAATGAAGGCCAAGGGATTACGCCCTCCACCGCGTGAAAAAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail