Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|057500
Gene name
Locationscaffold_03a:1230691..1231387
Strand-
Gene length (bp)696
Transcript length (bp)564
Coding sequence length (bp)564
Protein length (aa) 188

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 1.3E-10 45 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86YN1|DOPP1_HUMAN Dolichyldiphosphatase 1 OS=Homo sapiens GN=DOLPP1 PE=2 SV=1 10 163 3.0E-14
sp|B0KWE9|DOPP1_CALJA Dolichyldiphosphatase 1 OS=Callithrix jacchus GN=DOLPP1 PE=3 SV=1 10 163 8.0E-14
sp|B0CM95|DOPP1_PAPAN Dolichyldiphosphatase 1 OS=Papio anubis GN=DOLPP1 PE=3 SV=1 10 163 9.0E-14
sp|B1MTH4|DOPP1_CALMO Dolichyldiphosphatase 1 OS=Callicebus moloch GN=DOLPP1 PE=3 SV=1 10 163 1.0E-13
sp|Q9JMF7|DOPP1_MOUSE Dolichyldiphosphatase 1 OS=Mus musculus GN=Dolpp1 PE=2 SV=1 10 163 2.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86YN1|DOPP1_HUMAN Dolichyldiphosphatase 1 OS=Homo sapiens GN=DOLPP1 PE=2 SV=1 10 163 3.0E-14
sp|B0KWE9|DOPP1_CALJA Dolichyldiphosphatase 1 OS=Callithrix jacchus GN=DOLPP1 PE=3 SV=1 10 163 8.0E-14
sp|B0CM95|DOPP1_PAPAN Dolichyldiphosphatase 1 OS=Papio anubis GN=DOLPP1 PE=3 SV=1 10 163 9.0E-14
sp|B1MTH4|DOPP1_CALMO Dolichyldiphosphatase 1 OS=Callicebus moloch GN=DOLPP1 PE=3 SV=1 10 163 1.0E-13
sp|Q9JMF7|DOPP1_MOUSE Dolichyldiphosphatase 1 OS=Mus musculus GN=Dolpp1 PE=2 SV=1 10 163 2.0E-13
sp|B2KI79|DOPP1_RHIFE Dolichyldiphosphatase 1 OS=Rhinolophus ferrumequinum GN=DOLPP1 PE=3 SV=1 10 161 3.0E-13
sp|Q6NLA5|LPPG_ARATH Lipid phosphate phosphatase gamma, chloroplastic OS=Arabidopsis thaliana GN=LPPG PE=1 SV=1 35 161 1.0E-09
sp|P53223|CAX4_YEAST Dolichyldiphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAX4 PE=1 SV=1 13 175 2.0E-08
sp|Q86IX2|DOPP1_DICDI Dolichyldiphosphatase 1 OS=Dictyostelium discoideum GN=dolpp1 PE=3 SV=1 35 161 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 26 48 22
2 90 112 22
3 119 138 19
4 142 164 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|057500
MGAGIKKGHGFLSHAILSFLDKADTIVISLTAACILYTRSVGVVYFVAGASTCSITVKLIKRAIRQPRPPPHVLV
GRRVKASFGMPSTHSATITFFATYIAIASWCLPIHATLPAHARFVPIVTTPLAMTIVMSRIWLGYHTWPQVAVGC
AYGCSLAMMWFMLWTKGGVREVGQVLERGVWKLYGWS*
Coding >Agabi119p4|057500
ATGGGCGCTGGAATTAAAAAGGGGCATGGGTTTCTATCTCATGCTATCTTGTCTTTCCTAGATAAGGCGGACACT
ATCGTTATATCGCTGACCGCTGCTTGCATCCTCTATACTCGATCAGTCGGAGTCGTTTATTTTGTCGCCGGGGCT
TCAACATGCAGTATTACAGTCAAACTCATCAAACGTGCAATAAGGCAGCCCAGACCACCGCCTCATGTGCTCGTT
GGGCGTAGGGTGAAAGCTTCGTTCGGCATGCCAAGCACGCACTCTGCGACCATAACGTTCTTTGCCACGTATATT
GCCATTGCAAGTTGGTGTCTTCCCATTCACGCAACGTTGCCAGCTCATGCACGGTTTGTACCGATTGTGACGACA
CCTTTGGCTATGACGATTGTCATGTCGAGGATATGGCTTGGATACCATACATGGCCACAGGTAGCTGTGGGATGT
GCATATGGTTGTTCTCTGGCTATGATGTGGTTTATGTTGTGGACCAAAGGCGGTGTTCGAGAAGTTGGGCAAGTG
TTGGAAAGGGGTGTATGGAAGCTATACGGTTGGTCGTAG
Transcript >Agabi119p4|057500
ATGGGCGCTGGAATTAAAAAGGGGCATGGGTTTCTATCTCATGCTATCTTGTCTTTCCTAGATAAGGCGGACACT
ATCGTTATATCGCTGACCGCTGCTTGCATCCTCTATACTCGATCAGTCGGAGTCGTTTATTTTGTCGCCGGGGCT
TCAACATGCAGTATTACAGTCAAACTCATCAAACGTGCAATAAGGCAGCCCAGACCACCGCCTCATGTGCTCGTT
GGGCGTAGGGTGAAAGCTTCGTTCGGCATGCCAAGCACGCACTCTGCGACCATAACGTTCTTTGCCACGTATATT
GCCATTGCAAGTTGGTGTCTTCCCATTCACGCAACGTTGCCAGCTCATGCACGGTTTGTACCGATTGTGACGACA
CCTTTGGCTATGACGATTGTCATGTCGAGGATATGGCTTGGATACCATACATGGCCACAGGTAGCTGTGGGATGT
GCATATGGTTGTTCTCTGGCTATGATGTGGTTTATGTTGTGGACCAAAGGCGGTGTTCGAGAAGTTGGGCAAGTG
TTGGAAAGGGGTGTATGGAAGCTATACGGTTGGTCGTAG
Gene >Agabi119p4|057500
ATGGGCGCTGGAATTAAAAAGGGGCATGGGTTTCTATCTCATGCTATCTTGTCTTTCCTAGATAAGGTGCGTCGT
CTGAGGTTTATGCCTAGCTCCAGGATTGACTCTCATTGGTTTCATGAGGCGGACACTATCGTTATATCGCTGACC
GCTGCTTGCATCCTCTATACTCGATCAGTCGGAGTCGTTTATTTTGTCGCCGGGGCTTCAACATGCAGTATTACA
GTCAAACTCATCAAACGTGCAATAAGGCAGCCCAGACCACCGCCTCATGTGCTCGTTGGGCGTAGGGTGAAAGCT
TCGTTCGGGTGAATGAACTTGGAATGAATAATTCAGCACGCCAATGAATACTACTATTAACCTTCTATTTGTCAA
CTCCACAGCATGCCAAGCACGCACTCTGCGACCATAACGTTCTTTGCCACGTATATTGCCATTGCAAGTTGGTGT
CTTCCCATTCACGCAACGTTGCCAGCTCATGCACGGTTTGTACCGATTGTGACGACACCTTTGGCTATGACGATT
GTCATGTCGAGGATATGGCTTGGATACCATACATGGCCACAGGTAGCTGTGGGATGTGCATATGGTTGTTCTCTG
GCTATGATGTGGTTTATGTTGTGGACCAAAGGCGGTGTTCGAGAAGTTGGGCAAGTGTTGGAAAGGGGTGTATGG
AAGCTATACGGTTGGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail