Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|057410
Gene name
Locationscaffold_03a:1199752..1202986
Strand+
Gene length (bp)3234
Transcript length (bp)2100
Coding sequence length (bp)2100
Protein length (aa) 700

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03571 Peptidase_M49 Peptidase family M49 1.0E-223 149 698

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q557H1|DPP3_DICDI Dipeptidyl peptidase 3 OS=Dictyostelium discoideum GN=dpp3-1 PE=3 SV=1 11 697 8.0E-169
sp|A7RZW4|DPP3_NEMVE Dipeptidyl peptidase 3 OS=Nematostella vectensis GN=dpp3 PE=3 SV=1 24 697 1.0E-168
sp|Q9NY33|DPP3_HUMAN Dipeptidyl peptidase 3 OS=Homo sapiens GN=DPP3 PE=1 SV=2 21 697 5.0E-166
sp|Q99KK7|DPP3_MOUSE Dipeptidyl peptidase 3 OS=Mus musculus GN=Dpp3 PE=1 SV=2 21 697 2.0E-164
sp|O55096|DPP3_RAT Dipeptidyl peptidase 3 OS=Rattus norvegicus GN=Dpp3 PE=1 SV=2 21 697 3.0E-164
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q557H1|DPP3_DICDI Dipeptidyl peptidase 3 OS=Dictyostelium discoideum GN=dpp3-1 PE=3 SV=1 11 697 8.0E-169
sp|A7RZW4|DPP3_NEMVE Dipeptidyl peptidase 3 OS=Nematostella vectensis GN=dpp3 PE=3 SV=1 24 697 1.0E-168
sp|Q9NY33|DPP3_HUMAN Dipeptidyl peptidase 3 OS=Homo sapiens GN=DPP3 PE=1 SV=2 21 697 5.0E-166
sp|Q99KK7|DPP3_MOUSE Dipeptidyl peptidase 3 OS=Mus musculus GN=Dpp3 PE=1 SV=2 21 697 2.0E-164
sp|O55096|DPP3_RAT Dipeptidyl peptidase 3 OS=Rattus norvegicus GN=Dpp3 PE=1 SV=2 21 697 3.0E-164
sp|Q9VHR8|DPP3_DROME Dipeptidyl peptidase 3 OS=Drosophila melanogaster GN=DppIII PE=2 SV=2 6 697 2.0E-150
sp|Q08225|DPP3_YEAST Probable dipeptidyl peptidase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL057W PE=1 SV=1 12 699 3.0E-150
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|057410
MTSTSVALNNERFLADRSTPLCSLEVAKSFALLSSNEKKYTHYLNQASWAGARIIQGQWTPHAIELYDLLILIFS
SSDKFKLADLEALRVASKVNTEDWENLLQYTIQVLSNLVNFKSFGFTKIIPRVHSEIFEAVVLNSANKEQATSLW
NKLKDHIYSITPEASLYIGKRSLGHVSNYYVGEVINDEEVTAIQAAAEKLNIDVLNTRVAKKGPGDYVLLIASAN
TGPSATHEIDVQGKTAQLRVEYGDFSAALKKTSDALRQAKKYVANQHQSNMIEGYIKSFETGSIQDHKDASKEWV
KDVGPVVESYIGFIETYVDPYGGRAEWEGFTAIVNKELSAKYEILVNKAPELIKVLPWGKNFEVDIFRKPDFTAL
EVVNFATGGIPAGINIPNYYDIRASTGFKNVSLANILAAKSPNEKLTFIHPDDVDLYNSWDNRSFELQVANHELL
GHGSGKLFEEYADGTKNFVPEQVINPLTGKPITSWYKPGQTPGSVLGEVSSSMEECRAETVALYLVGERDILEIF
GYTDSQDIENIQYITFLLMARAGLRGLEFYDPVNKKHGQAHMQARLGITQHLIRSGIARLEEVRDSNGALVDLYV
RVDKNLVLTKGREVAGKLLIELQVRKSTADGAGAREYYNNLTNPIAGWEGEIRDLVLAKKQPRKVFVQPNTHLVN
GNVELKEYAFTPAGVIESFIERNL*
Coding >Agabi119p4|057410
ATGACTTCAACCTCCGTAGCACTTAACAATGAGCGCTTTCTCGCTGACCGCTCAACTCCTCTTTGCAGCCTGGAA
GTCGCCAAATCATTCGCGTTGCTGAGTTCGAATGAGAAGAAATACACTCATTATCTTAACCAGGCTTCTTGGGCT
GGTGCTCGCATCATCCAAGGACAATGGACCCCACATGCGATCGAACTTTACGACCTACTTATCCTCATCTTTAGC
AGCAGTGACAAGTTCAAACTCGCTGACCTTGAGGCATTACGCGTTGCTTCAAAGGTGAACACAGAAGATTGGGAA
AATCTACTTCAATATACCATTCAAGTTTTGAGTAACCTTGTCAACTTCAAGTCATTCGGCTTCACCAAGATAATC
CCTCGCGTTCATTCTGAGATCTTTGAGGCAGTTGTTCTAAATTCGGCCAATAAAGAACAGGCGACATCACTTTGG
AACAAACTTAAAGACCATATTTACTCGATCACTCCAGAAGCCAGCCTATACATCGGCAAACGAAGTCTCGGGCAC
GTATCAAATTATTACGTCGGTGAGGTGATTAACGACGAAGAAGTGACTGCAATCCAGGCAGCTGCGGAAAAGCTC
AACATCGACGTATTAAATACTCGTGTCGCAAAAAAAGGACCTGGCGATTATGTCCTATTGATCGCTTCTGCAAAT
ACTGGACCTTCCGCGACTCATGAGATAGATGTTCAAGGCAAGACCGCTCAGCTTCGCGTTGAATATGGTGATTTC
TCTGCGGCCCTCAAAAAAACAAGTGATGCACTTCGACAGGCTAAGAAATATGTCGCAAATCAGCATCAAAGTAAC
ATGATCGAGGGTTACATAAAATCGTTCGAAACCGGGTCTATCCAAGATCATAAAGATGCTTCAAAAGAGTGGGTC
AAGGATGTAGGACCCGTAGTCGAGTCCTACATAGGGTTCATCGAAACATATGTTGACCCATATGGAGGTCGTGCG
GAGTGGGAAGGATTCACTGCCATTGTAAACAAGGAACTCAGTGCCAAATATGAAATACTCGTGAATAAAGCACCC
GAGCTTATCAAAGTATTGCCATGGGGCAAGAACTTTGAAGTTGATATATTTAGGAAGCCCGATTTCACGGCTTTG
GAAGTTGTCAACTTCGCAACAGGAGGTATCCCTGCTGGTATTAATATCCCTAACTATTATGATATCCGAGCTTCA
ACAGGTTTCAAGAATGTATCGCTTGCAAATATTCTAGCCGCGAAATCTCCAAATGAAAAACTCACATTTATACAC
CCCGATGATGTTGATTTGTATAACAGCTGGGATAACCGTTCTTTCGAACTGCAAGTTGCCAACCACGAGCTCCTG
GGTCATGGATCGGGTAAACTTTTTGAAGAATACGCGGATGGGACCAAAAATTTTGTTCCTGAACAGGTCATCAAT
CCCTTGACTGGGAAACCGATTACTTCTTGGTACAAACCTGGCCAAACCCCAGGATCAGTACTTGGCGAAGTATCT
TCTTCCATGGAAGAATGTCGTGCAGAAACGGTTGCCCTTTACCTGGTCGGCGAGCGTGACATTCTCGAAATCTTC
GGCTACACTGATTCACAAGATATTGAAAACATTCAATACATCACTTTCTTATTGATGGCCAGGGCAGGTCTCCGC
GGCCTTGAATTCTATGATCCTGTCAACAAAAAGCATGGTCAGGCTCACATGCAAGCTAGGCTTGGTATCACCCAA
CACCTTATTCGTTCTGGCATTGCGCGTCTGGAGGAGGTTCGTGACTCCAACGGCGCGCTCGTGGACCTTTACGTT
CGAGTTGATAAAAATTTGGTTCTAACAAAAGGAAGAGAAGTAGCTGGAAAACTTCTCATTGAACTCCAGGTCCGA
AAGAGTACAGCCGATGGTGCTGGGGCACGCGAATACTACAATAATCTCACCAATCCTATTGCCGGGTGGGAAGGG
GAGATAAGAGATCTTGTTCTGGCCAAGAAACAGCCACGCAAGGTTTTCGTTCAACCTAACACGCATTTGGTGAAC
GGCAACGTTGAATTGAAGGAGTATGCTTTCACCCCTGCAGGCGTAATTGAGAGCTTTATTGAACGGAACCTTTAA
Transcript >Agabi119p4|057410
ATGACTTCAACCTCCGTAGCACTTAACAATGAGCGCTTTCTCGCTGACCGCTCAACTCCTCTTTGCAGCCTGGAA
GTCGCCAAATCATTCGCGTTGCTGAGTTCGAATGAGAAGAAATACACTCATTATCTTAACCAGGCTTCTTGGGCT
GGTGCTCGCATCATCCAAGGACAATGGACCCCACATGCGATCGAACTTTACGACCTACTTATCCTCATCTTTAGC
AGCAGTGACAAGTTCAAACTCGCTGACCTTGAGGCATTACGCGTTGCTTCAAAGGTGAACACAGAAGATTGGGAA
AATCTACTTCAATATACCATTCAAGTTTTGAGTAACCTTGTCAACTTCAAGTCATTCGGCTTCACCAAGATAATC
CCTCGCGTTCATTCTGAGATCTTTGAGGCAGTTGTTCTAAATTCGGCCAATAAAGAACAGGCGACATCACTTTGG
AACAAACTTAAAGACCATATTTACTCGATCACTCCAGAAGCCAGCCTATACATCGGCAAACGAAGTCTCGGGCAC
GTATCAAATTATTACGTCGGTGAGGTGATTAACGACGAAGAAGTGACTGCAATCCAGGCAGCTGCGGAAAAGCTC
AACATCGACGTATTAAATACTCGTGTCGCAAAAAAAGGACCTGGCGATTATGTCCTATTGATCGCTTCTGCAAAT
ACTGGACCTTCCGCGACTCATGAGATAGATGTTCAAGGCAAGACCGCTCAGCTTCGCGTTGAATATGGTGATTTC
TCTGCGGCCCTCAAAAAAACAAGTGATGCACTTCGACAGGCTAAGAAATATGTCGCAAATCAGCATCAAAGTAAC
ATGATCGAGGGTTACATAAAATCGTTCGAAACCGGGTCTATCCAAGATCATAAAGATGCTTCAAAAGAGTGGGTC
AAGGATGTAGGACCCGTAGTCGAGTCCTACATAGGGTTCATCGAAACATATGTTGACCCATATGGAGGTCGTGCG
GAGTGGGAAGGATTCACTGCCATTGTAAACAAGGAACTCAGTGCCAAATATGAAATACTCGTGAATAAAGCACCC
GAGCTTATCAAAGTATTGCCATGGGGCAAGAACTTTGAAGTTGATATATTTAGGAAGCCCGATTTCACGGCTTTG
GAAGTTGTCAACTTCGCAACAGGAGGTATCCCTGCTGGTATTAATATCCCTAACTATTATGATATCCGAGCTTCA
ACAGGTTTCAAGAATGTATCGCTTGCAAATATTCTAGCCGCGAAATCTCCAAATGAAAAACTCACATTTATACAC
CCCGATGATGTTGATTTGTATAACAGCTGGGATAACCGTTCTTTCGAACTGCAAGTTGCCAACCACGAGCTCCTG
GGTCATGGATCGGGTAAACTTTTTGAAGAATACGCGGATGGGACCAAAAATTTTGTTCCTGAACAGGTCATCAAT
CCCTTGACTGGGAAACCGATTACTTCTTGGTACAAACCTGGCCAAACCCCAGGATCAGTACTTGGCGAAGTATCT
TCTTCCATGGAAGAATGTCGTGCAGAAACGGTTGCCCTTTACCTGGTCGGCGAGCGTGACATTCTCGAAATCTTC
GGCTACACTGATTCACAAGATATTGAAAACATTCAATACATCACTTTCTTATTGATGGCCAGGGCAGGTCTCCGC
GGCCTTGAATTCTATGATCCTGTCAACAAAAAGCATGGTCAGGCTCACATGCAAGCTAGGCTTGGTATCACCCAA
CACCTTATTCGTTCTGGCATTGCGCGTCTGGAGGAGGTTCGTGACTCCAACGGCGCGCTCGTGGACCTTTACGTT
CGAGTTGATAAAAATTTGGTTCTAACAAAAGGAAGAGAAGTAGCTGGAAAACTTCTCATTGAACTCCAGGTCCGA
AAGAGTACAGCCGATGGTGCTGGGGCACGCGAATACTACAATAATCTCACCAATCCTATTGCCGGGTGGGAAGGG
GAGATAAGAGATCTTGTTCTGGCCAAGAAACAGCCACGCAAGGTTTTCGTTCAACCTAACACGCATTTGGTGAAC
GGCAACGTTGAATTGAAGGAGTATGCTTTCACCCCTGCAGGCGTAATTGAGAGCTTTATTGAACGGAACCTTTAA
Gene >Agabi119p4|057410
ATGACTTCAACCTCCGTAGCACTTAACAATGAGCGCTTTCTCGCTGACCGCTCAACTCCTCTTTGCAGCCTGGAA
GTCGCCAAATCATTCGCGTTGCTGAGGTATGTTTTCCAATTTAGGACATCAATGCGTGTGGCTGATTAGTCTCAA
GTTCGAATGAGAAGAAATACACTCATTATCTTAACCAGGCTTCTTGGGCTGGTGCTCGCATCATCCAAGGTCCTT
TAGGACATTGCTTTTTGTCTACTGTTTTCGCTAAACAGCTAAAATAGGACAATGGACCCCACATGCGATCGAACT
TTACGACCTACTTATCCTCATCTTTAGCAGCAGTGACAAGTTCAAACTCGCTGACCTTGAGGCATTACGCGTTGC
TTCAAAGGTGAACACAGAAGATTGGGAAAATCTACTTCAATATACCATTCAAGTCAGCTTTCCAGCTTTATTTTC
TGTGCAAATCTAGAGCCACAAATTAGGTTTTGAGTAACCTTGTCAACTTCAAGTCATTCGGCTTCACCAAGATAA
TCCCTCGCGTTCATTCTGAGATCTTTGAGGCAGTTGTTCTAAATTCGGCCAATAAAGAACAGGCGACATCACTTT
GGAACAAAGTACTCTCAGTACAGACAACCTTTCCGGCTTTCTCTGACGATTATTCAGCTTAAAGACCATATTTAC
TCGATCACTCCAGAAGCCAGCCTATACATCGGCAAACGAAGTCTCGGGCACGTATCAAATTATTACGTCGGTGAG
GTGATTAACGACGAAGAAGTGACTGCAATCCAGGCAGCTGCGGAAAAGCTCAACATCGACGTATTAAATACTCGG
TATGTCAGGAGCAAGGCTTACTCTTTTCTTGTCAAATTCATTTTCAAACTCCAGTGTCGCAAAAAAAGGACCTGG
CGATTATGTCCTATTGATCGCTTCTGCAAATACTGGACCTTCCGCGACTCATGAGATAGATGTTCAAGGCAAGAC
CGCTCAGCTTCGCGTTGAATATGGTGATTTCTCTGCGGCCCTCAAAAAAACAAGTGATGCACTTCGACAGGTGTG
ATTTGTGTTGTCGTTTCGTTGTACAACGCTCATACAGTCCAGGCTAAGAAATATGTCGCAAATCAGCATCAAAGT
AACATGATCGAGGGTTACATAAAATCGTATGTACCATTGTTTGACGGTTCGTTACAGCCGCTCACAATACTAGGT
TCGAAACCGGGTCTATCCAAGATCATAAAGATGCTTCAAAAGAGTGGGTCAAGGATGTAGGACCCGTAGTCGAGT
CCTACATAGGGGTGTGTACTCGGGCATCTTAATCTGCGTAGCTGACGCCTCATCGATCGTCCGCAGTTCATCGAA
ACATATGTTGACCCATATGGAGGTCGTGCGGAGTGGGAAGGTAGCTGACTCTTTGCAAGCCTCCAGGACCGTGTG
GCTGACCATTTCTAGGATTCACTGCCATTGTAAACAAGGAACTCAGTGCCAAATATGAAATACTCGTGAATAAAG
CACCCGAGCTTATCAAAGTATTGCCATGGGGCAAGAACTTTGAAGTTGATATATTTAGGAAGCCCGATTTCACGG
CTTTGGAAGTTGTCAACTTCGCAACAGGAGGTGTGTTTATATGCCACCTCTAAGCTACCCTATTCAAATATTTTC
AGGTATCCCTGCTGGTATTAATGTAAGGATACAAAGCAGTTTCATTCCAGATCTCTGCAGAACTAACGTATTTCC
ATTTTATAGATCCCTGTGAGATTTTTCGGCCAATGCATTTCTCTGAGCCACGGTAATGACTGACCCGACCTGTAG
AACTATTATGATATCCGAGCTTCAACAGGTTTCAAGAATGTATCGCTTGCAGTAAGTTGGTCTCTTATTGGAACG
CATAATTTCAGTCTACAAACATCGTGCAGAATATTCTAGCCGCGAAATCTCCAAGTGAGACCCGCAGGAACTATC
CAGTAATTTATCTGACGCTTTTGTTACTAAATTTTAGATGAAAAACTCACATTTATACACCCCGATGATGTTGAT
TTGTATAACAGCTGGGATAACCGTTCTTTCGAACTGCAAGTTGCCAACCACGAGCTCCTGGGTCATGGATCGGGT
AAACTTTTTGAAGAATACGCGGATGGGACCAAAAATTTTGTTCCTGAACAGGTATATTCAATACGATCAATGCCT
GCAACGTTACGCTCACCGAATTCTTAGGTCATCAATCCCTTGACTGGGAAACCGATGTATGTTCATTTGCCGTTG
CCTGCTACAAGGCCATTAGTGAATCATGCATTTGAACTGTAGTACTTCTTGGTACAAACCTGGCCAAACCCCAGG
ATCAGTACTTGGCGAAGTATCTTCTTCCATGGAAGAATGTCGTGCAGAAACGGTTGCCCTTTACCGTGAGTTCAA
AACCAGAATTATAATCTGCTCTTTATCTCACGACAAATGTATCCAGTGGTCGGCGAGCGTGACATTCTCGAAATC
TTCGGCGTATGTACAAATTTCTGTTGCATGGTCGCTCCGAGATTGCTCATCTCTGCAGTACACTGATTCACAAGA
TATTGAAAACATTCAATACATCACTTTCTTATTGATGGCCAGGGCAGGTCTCCGCGGCCTTGAATTCTATGATCC
TGTCAACAAAAAGCATGGTCAGGCTCACATGCAAGCTAGGTATTAATGAGCTTTGGAACAACAGACAACAAACTA
AAAACCTTTCAATTTCCAAGGCTTGGTATCACCCAACACCTTATTCGTTCTGGCATTGCGCGTCTGGAGGAGGTT
CGTGACTCCAACGGCGCGCTCGTGGACCTTTACGTTCGAGTCAGTGAAGTATTGGCTGACTGCAAAAATCTTTGT
TCTCTAACTGGTTCTCTCCGTGCCGTTAGGTTGATAAAAATTTGGTTCTAACAAAAGGAAGAGAAGTAGCTGGAA
AACTTCTCATTGAACTCCAGGTCCGAAAGAGTACAGCCGATGGTGCTGGGGCACGCGAATACTACAATAATCTCA
CCAATCCTATTGCCGGGTGGGAAGGGGAGATAAGAGATCTTGTTCTGGCCAAGAAACAGGTTTGTAACCATTGTT
CAAAAGTATCATTACTGACAGGTTACGCATTCGTCTTTGTAGCCACGCAAGGTTTTCGTTCAACCTAACACGCAT
TTGGTGAACGGCAACGTTGAATTGAAGGAGTATGCTTTCACCCCTGCAGGCGTAATTGAGAGCTTTATTGAACGG
AACCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail