Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|057210
Gene name
Locationscaffold_03a:1153838..1157640
Strand+
Gene length (bp)3802
Transcript length (bp)3264
Coding sequence length (bp)3264
Protein length (aa) 1088

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 8.0E-33 817 1026

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 793 1086 1.0E-96
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 713 1086 2.0E-94
sp|Q8BKC8|PI4KB_MOUSE Phosphatidylinositol 4-kinase beta OS=Mus musculus GN=Pi4kb PE=1 SV=2 785 1087 1.0E-90
sp|O08561|PI4KB_RAT Phosphatidylinositol 4-kinase beta OS=Rattus norvegicus GN=Pi4kb PE=1 SV=1 785 1087 2.0E-90
sp|A4IID4|PI4KB_XENTR Phosphatidylinositol 4-kinase beta OS=Xenopus tropicalis GN=pi4kb PE=2 SV=1 785 1087 3.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 793 1086 1.0E-96
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 713 1086 2.0E-94
sp|Q8BKC8|PI4KB_MOUSE Phosphatidylinositol 4-kinase beta OS=Mus musculus GN=Pi4kb PE=1 SV=2 785 1087 1.0E-90
sp|O08561|PI4KB_RAT Phosphatidylinositol 4-kinase beta OS=Rattus norvegicus GN=Pi4kb PE=1 SV=1 785 1087 2.0E-90
sp|A4IID4|PI4KB_XENTR Phosphatidylinositol 4-kinase beta OS=Xenopus tropicalis GN=pi4kb PE=2 SV=1 785 1087 3.0E-90
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 793 1086 4.0E-90
sp|B4UT09|PI4KB_OTOGA Phosphatidylinositol 4-kinase beta OS=Otolemur garnettii GN=PI4KB PE=3 SV=1 785 1087 5.0E-90
sp|B1MTG7|PI4KB_CALMO Phosphatidylinositol 4-kinase beta OS=Callicebus moloch GN=PI4KB PE=3 SV=1 785 1087 6.0E-90
sp|B0KWC1|PI4KB_CALJA Phosphatidylinositol 4-kinase beta OS=Callithrix jacchus GN=PI4KB PE=3 SV=1 785 1087 6.0E-90
sp|Q9UBF8|PI4KB_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens GN=PI4KB PE=1 SV=1 785 1087 6.0E-90
sp|A9X1A0|PI4KB_PAPAN Phosphatidylinositol 4-kinase beta OS=Papio anubis GN=PI4KB PE=3 SV=2 785 1087 6.0E-90
sp|B3EX61|PI4KB_SORAR Phosphatidylinositol 4-kinase beta OS=Sorex araneus GN=PI4KB PE=3 SV=1 785 1087 7.0E-90
sp|B2KI64|PI4KB_RHIFE Phosphatidylinositol 4-kinase beta OS=Rhinolophus ferrumequinum GN=PI4KB PE=3 SV=1 785 1087 9.0E-90
sp|Q49GP3|PI4KB_DANRE Phosphatidylinositol 4-kinase beta OS=Danio rerio GN=pi4kb PE=2 SV=2 785 1087 4.0E-89
sp|O02810|PI4KB_BOVIN Phosphatidylinositol 4-kinase beta OS=Bos taurus GN=PI4KB PE=1 SV=2 785 1087 5.0E-89
sp|Q6GN16|PI4KB_XENLA Phosphatidylinositol 4-kinase beta OS=Xenopus laevis GN=pi4kb PE=2 SV=1 785 1087 2.0E-87
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 791 1086 1.0E-82
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 781 1086 1.0E-80
sp|Q9FMJ0|P4KB1_ARATH Phosphatidylinositol 4-kinase beta 1 OS=Arabidopsis thaliana GN=PI4KB1 PE=1 SV=1 793 1087 1.0E-69
sp|Q0WPX9|P4KB2_ARATH Phosphatidylinositol 4-kinase beta 2 OS=Arabidopsis thaliana GN=PI4KB2 PE=2 SV=1 793 1080 5.0E-67
sp|P37297|STT4_YEAST Phosphatidylinositol 4-kinase STT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STT4 PE=1 SV=1 818 1086 2.0E-48
sp|O02811|PI4KA_BOVIN Phosphatidylinositol 4-kinase alpha OS=Bos taurus GN=PI4KA PE=2 SV=1 809 1086 4.0E-47
sp|P42356|PI4KA_HUMAN Phosphatidylinositol 4-kinase alpha OS=Homo sapiens GN=PI4KA PE=1 SV=3 809 1086 5.0E-47
sp|O08662|PI4KA_RAT Phosphatidylinositol 4-kinase alpha OS=Rattus norvegicus GN=Pi4ka PE=1 SV=1 818 1086 1.0E-46
sp|Q9USR3|STT4_SCHPO Phosphatidylinositol 4-kinase stt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stt4 PE=3 SV=1 818 1086 2.0E-46
sp|A4QPH2|PI4P2_HUMAN Putative phosphatidylinositol 4-kinase alpha-like protein P2 OS=Homo sapiens GN=PI4KAP2 PE=5 SV=3 829 1086 9.0E-40
sp|Q8SQY7|STT4_ENCCU Probable phosphatidylinositol 4-kinase STT4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=STT4 PE=3 SV=2 819 1086 2.0E-37
sp|Q9SXA1|P4KA1_ARATH Phosphatidylinositol 4-kinase alpha 1 OS=Arabidopsis thaliana GN=PI4KA1 PE=1 SV=2 818 1086 1.0E-32
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 19 465 2.0E-30
sp|P54675|PI3K3_DICDI Phosphatidylinositol 3-kinase 3 OS=Dictyostelium discoideum GN=pikC PE=2 SV=2 817 1070 5.0E-29
sp|O70167|P3C2G_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Mus musculus GN=Pik3c2g PE=2 SV=1 817 1068 7.0E-29
sp|Q61194|P3C2A_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Mus musculus GN=Pik3c2a PE=1 SV=2 776 1075 1.0E-27
sp|Q9C680|P4KA2_ARATH Phosphatidylinositol 4-kinase alpha 2 OS=Arabidopsis thaliana GN=PI4KA2 PE=1 SV=1 818 1086 1.0E-27
sp|O00443|P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens GN=PIK3C2A PE=1 SV=2 775 1075 3.0E-27
sp|Q5RAY1|P3C2A_PONAB Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Pongo abelii GN=PIK3C2A PE=2 SV=1 787 1075 1.0E-26
sp|O75747|P3C2G_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Homo sapiens GN=PIK3C2G PE=1 SV=3 817 1012 2.0E-26
sp|O70173|P3C2G_RAT Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Rattus norvegicus GN=Pik3c2g PE=2 SV=1 817 1049 2.0E-26
sp|P54673|PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum GN=pikA PE=2 SV=2 813 1085 6.0E-26
sp|P54674|PI3K2_DICDI Phosphatidylinositol 3-kinase 2 OS=Dictyostelium discoideum GN=pikB PE=2 SV=2 817 1084 1.0E-25
sp|O00750|P3C2B_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta OS=Homo sapiens GN=PIK3C2B PE=1 SV=2 774 1075 3.0E-25
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 331 496 6.0E-25
sp|P54676|PI3K4_DICDI Phosphatidylinositol 3-kinase VPS34-like OS=Dictyostelium discoideum GN=pikE PE=3 SV=2 819 1052 1.0E-24
sp|P42347|PI3K1_SOYBN Phosphatidylinositol 3-kinase, root isoform OS=Glycine max PE=2 SV=1 812 1084 1.0E-24
sp|P42348|PI3K2_SOYBN Phosphatidylinositol 3-kinase, nodule isoform OS=Glycine max PE=2 SV=1 812 1084 3.0E-24
sp|P48736|PK3CG_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Homo sapiens GN=PIK3CG PE=1 SV=3 783 1079 3.0E-24
sp|Q6PF93|PK3C3_MOUSE Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Mus musculus GN=Pik3c3 PE=1 SV=1 708 1084 1.0E-23
sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2 819 1077 3.0E-23
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 298 458 4.0E-23
sp|Q8BTI9|PK3CB_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Mus musculus GN=Pik3cb PE=1 SV=2 815 1073 4.0E-23
sp|O02697|PK3CG_PIG Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Sus scrofa GN=PIK3CG PE=1 SV=2 802 1079 4.0E-23
sp|Q9Z1L0|PK3CB_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus GN=Pik3cb PE=2 SV=1 815 1073 4.0E-23
sp|Q8NEB9|PK3C3_HUMAN Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Homo sapiens GN=PIK3C3 PE=1 SV=1 708 1084 4.0E-23
sp|O88763|PK3C3_RAT Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Rattus norvegicus GN=Pik3c3 PE=1 SV=1 708 1084 5.0E-23
sp|Q9JHG7|PK3CG_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Mus musculus GN=Pik3cg PE=1 SV=2 815 1079 5.0E-23
sp|Q5D891|PK3C3_PIG Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Sus scrofa GN=PIK3C3 PE=2 SV=1 708 1084 7.0E-23
sp|Q6AZN6|PK3C3_XENLA Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Xenopus laevis GN=pik3c3 PE=2 SV=1 799 1084 1.0E-22
sp|P42339|PI3K_ARATH Phosphatidylinositol 3-kinase VPS34 OS=Arabidopsis thaliana GN=At1g60490 PE=2 SV=2 817 1084 2.0E-22
sp|O00329|PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens GN=PIK3CD PE=1 SV=2 817 1045 4.0E-22
sp|P42338|PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens GN=PIK3CB PE=1 SV=1 815 1073 4.0E-22
sp|O35904|PK3CD_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Mus musculus GN=Pik3cd PE=1 SV=2 817 1045 5.0E-22
sp|P22543|VPS34_YEAST Phosphatidylinositol 3-kinase VPS34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS34 PE=1 SV=1 819 1070 5.0E-21
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 335 455 2.0E-20
sp|P32871|PK3CA_BOVIN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Bos taurus GN=PIK3CA PE=1 SV=1 819 1023 1.0E-17
sp|P42336|PK3CA_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Homo sapiens GN=PIK3CA PE=1 SV=2 819 1023 1.0E-17
sp|P42337|PK3CA_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Mus musculus GN=Pik3ca PE=1 SV=2 819 1077 1.0E-17
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 2 207 5.0E-17
sp|P0C5E7|AGE1_CAEBR Phosphatidylinositol 3-kinase age-1 OS=Caenorhabditis briggsae GN=age-1 PE=3 SV=1 819 1008 7.0E-17
sp|Q94125|AGE1_CAEEL Phosphatidylinositol 3-kinase age-1 OS=Caenorhabditis elegans GN=age-1 PE=1 SV=6 818 1023 1.0E-16
sp|Q92213|VPS34_CANAX Phosphatidylinositol 3-kinase VPS34 OS=Candida albicans GN=VPS34 PE=3 SV=1 921 1082 6.0E-13
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 7 190 7.0E-13
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 307 438 7.0E-11
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 7 190 1.0E-09
sp|P38110|ATM_YEAST Serine/threonine-protein kinase TEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEL1 PE=1 SV=3 823 1026 3.0E-09
sp|P0CP60|ATM_CRYNJ Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEL1 PE=3 SV=1 899 1026 3.0E-08
sp|P0CP61|ATM_CRYNB Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEL1 PE=3 SV=1 899 1026 3.0E-08
sp|Q6CAD2|ATM_YARLI Serine/threonine-protein kinase TEL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEL1 PE=3 SV=1 853 1026 4.0E-08
sp|Q751J3|ATM_ASHGO Serine/threonine-protein kinase TEL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEL1 PE=3 SV=1 820 1026 2.0E-07
sp|B3EX61|PI4KB_SORAR Phosphatidylinositol 4-kinase beta OS=Sorex araneus GN=PI4KB PE=3 SV=1 346 447 3.0E-07
sp|Q8BKC8|PI4KB_MOUSE Phosphatidylinositol 4-kinase beta OS=Mus musculus GN=Pi4kb PE=1 SV=2 346 447 4.0E-07
sp|B4UT09|PI4KB_OTOGA Phosphatidylinositol 4-kinase beta OS=Otolemur garnettii GN=PI4KB PE=3 SV=1 346 447 4.0E-07
sp|B1MTG7|PI4KB_CALMO Phosphatidylinositol 4-kinase beta OS=Callicebus moloch GN=PI4KB PE=3 SV=1 346 445 4.0E-07
sp|B0KWC1|PI4KB_CALJA Phosphatidylinositol 4-kinase beta OS=Callithrix jacchus GN=PI4KB PE=3 SV=1 346 445 4.0E-07
sp|Q9UBF8|PI4KB_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens GN=PI4KB PE=1 SV=1 346 445 4.0E-07
sp|A9X1A0|PI4KB_PAPAN Phosphatidylinositol 4-kinase beta OS=Papio anubis GN=PI4KB PE=3 SV=2 346 445 4.0E-07
sp|B2KI64|PI4KB_RHIFE Phosphatidylinositol 4-kinase beta OS=Rhinolophus ferrumequinum GN=PI4KB PE=3 SV=1 346 445 4.0E-07
sp|Q49GP3|PI4KB_DANRE Phosphatidylinositol 4-kinase beta OS=Danio rerio GN=pi4kb PE=2 SV=2 348 438 4.0E-07
sp|O02810|PI4KB_BOVIN Phosphatidylinositol 4-kinase beta OS=Bos taurus GN=PI4KB PE=1 SV=2 346 445 4.0E-07
sp|Q6GN16|PI4KB_XENLA Phosphatidylinositol 4-kinase beta OS=Xenopus laevis GN=pi4kb PE=2 SV=1 346 438 4.0E-07
sp|Q6CP76|ATM_KLULA Serine/threonine-protein kinase TEL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TEL1 PE=3 SV=1 823 1067 4.0E-07
sp|O08561|PI4KB_RAT Phosphatidylinositol 4-kinase beta OS=Rattus norvegicus GN=Pi4kb PE=1 SV=1 346 445 5.0E-07
sp|A4IID4|PI4KB_XENTR Phosphatidylinositol 4-kinase beta OS=Xenopus tropicalis GN=pi4kb PE=2 SV=1 346 438 6.0E-07
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 820 993 9.0E-07
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 797 1026 1.0E-06
sp|Q5UR69|YL615_MIMIV Putative phosphatidylinositol kinase L615 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L615 PE=3 SV=1 866 1084 2.0E-06
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 820 1029 2.0E-06
sp|Q62388|ATM_MOUSE Serine-protein kinase ATM OS=Mus musculus GN=Atm PE=1 SV=2 820 1038 3.0E-06
sp|Q8SR56|VPS34_ENCCU Probable phosphatidylinositol 3-kinase VPS34 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=VPS34 PE=3 SV=2 819 1019 3.0E-06
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 910 1029 5.0E-06
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 910 1029 5.0E-06
sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens GN=ATM PE=1 SV=4 922 1038 5.0E-06
sp|Q6PQD5|ATM_PIG Serine-protein kinase ATM OS=Sus scrofa GN=ATM PE=3 SV=2 922 1038 6.0E-06
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 910 1029 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|057210
MASHALLLRLFLSPSFFSLHLALNYLRLYADNVGITYYLTRRLRELDVHQLYDVWGFICHLLVTRPSKSRALEVF
VVETAQRSTHIAMITLWYMQASLHDLSLTRRESPSFTICQRVLHKCHEIIFNDLPRPTSSPYPPFKLSARGSFAR
RRIRHHAEPAFVGMGVVLAAAPAMPALAEFTGQIALEQGRADDDGQELRSLRSIETDLVLVTAPKTADSSGIDDD
MDPETDSPPNEENGLPQADNHEALRQDAPIILRRRTVTAAQTVPALPLHLRTIRRSRASEDPLGQLDYETLPAAP
AQSSPALPATRTPPRFAAAKMADGLLEKYDLQAQTQLLRGHYCHSEVQFILDLENLCNRLLIVPKPARVSALRAE
LTALNHKLPAEVCMPMWCNSSDIPQGPNNIPKPHHRIVRIPPGESVVLNSAERAPYLLLIEIIHDDLDFDPSKRA
NKEVLRKIVSKEEEKKGASNDLVSFGRSKSKQSDAQTGTEGGDLTVDTDIPHSSLPIPVPYESFPPPDTLRSAES
DNPEEEIDLVEQLYGAEQPLRSANLDLAESIVLPPAPKNRDLDMAAWSSTANVDDTGTPRRNSAPRTPISNGNAD
SSDKSTLPPIGQVNGAYGVLSLDEYFERMRTAAIMLAQLNANLVRDQAATTYSSPPGSLSSTAQDVSSPSSSSSM
TAWIPGSGWLMGSSPLTSDASQPSPSGAAQGRMRLQHAQAQQIRDRIMKEMLALEEERMERMKENGSGFENGISW
NRAGLGIRGVDLGSASGENSVEDEGIIRRELNKADPSAVVFSESWATKKSRIKAASPYGHLANWDCVSVIVKTGG
DLRQEQLAVQLIQEFQRIWTEENCPCWVRYFRIVILGAASGLVETITDAVSIHSIKKAEYAKRLARNRLGYVTLM
DHFKSAYGDPSSAKFARAQRNFAKSLAGYSIITYLLQVKDRHNGNILLDREGHLIHIDFGFILSNTPGNIGFEAA
PFKLPLEYIEVLGGENGVPFMEFKRLFREGFEAARKHCDRILTLVELMQRDSTLPCFALYGEQTVQYLKDRFQPT
LTHSLIGEYVDRLIDTSLGSHWTRLYDSYQYYSQSIL*
Coding >Agabi119p4|057210
ATGGCCTCGCATGCGCTCCTCCTGCGGCTCTTCCTCTCGCCCTCCTTCTTCTCTCTCCACCTCGCTCTCAACTAC
CTTCGTCTCTACGCAGACAACGTCGGCATCACCTACTACCTCACCAGGAGACTCAGGGAGCTCGATGTCCACCAG
CTCTACGATGTCTGGGGCTTCATATGCCATCTTCTCGTCACTCGCCCCTCAAAGTCCAGGGCCCTCGAGGTCTTT
GTCGTCGAGACTGCCCAGCGTTCCACTCACATCGCTATGATCACACTCTGGTACATGCAAGCCTCCCTCCACGAT
CTTTCACTGACTCGCCGCGAGTCCCCCTCCTTCACCATCTGCCAACGGGTCCTCCACAAGTGCCATGAGATCATC
TTCAATGATTTACCGCGCCCCACCTCCTCACCCTATCCTCCCTTTAAATTATCCGCCCGGGGATCCTTTGCTCGG
AGACGGATCAGGCATCATGCAGAGCCCGCATTTGTTGGCATGGGCGTCGTTCTCGCTGCAGCCCCTGCCATGCCC
GCCCTCGCTGAATTTACCGGCCAGATTGCTCTAGAACAGGGCCGCGCCGATGACGACGGGCAAGAGCTGCGTAGC
CTACGCTCGATCGAAACAGACCTCGTACTCGTCACCGCACCCAAGACAGCAGACTCCTCTGGCATCGACGACGAC
ATGGACCCGGAGACCGATAGCCCACCGAATGAAGAGAATGGTCTCCCCCAGGCAGATAATCACGAGGCATTACGG
CAAGATGCTCCCATCATCCTCCGCCGCCGTACCGTCACCGCTGCCCAAACAGTACCCGCTTTACCACTACACCTC
CGTACAATTCGACGCTCCCGAGCCTCTGAAGATCCTCTTGGACAGCTGGATTATGAAACCTTGCCGGCTGCCCCC
GCTCAATCCTCTCCCGCCCTCCCTGCAACGAGGACACCGCCCCGGTTTGCCGCTGCTAAGATGGCCGATGGGCTT
CTCGAAAAGTATGATTTACAAGCTCAGACTCAACTTTTGCGAGGGCACTACTGTCATTCGGAAGTCCAATTCATC
CTAGATCTTGAAAACCTCTGCAACCGTCTCTTGATTGTACCCAAACCCGCACGAGTAAGCGCGCTCAGAGCAGAA
CTGACTGCACTGAACCATAAGCTGCCCGCTGAGGTATGTATGCCGATGTGGTGCAATTCCTCAGATATACCTCAG
GGTCCCAACAACATACCCAAACCCCATCATCGCATAGTTAGAATTCCTCCTGGCGAGAGTGTCGTGTTGAACTCT
GCAGAACGAGCCCCATACCTGTTACTAATCGAAATCATACACGACGACCTTGATTTTGATCCTTCTAAACGAGCT
AATAAAGAAGTGCTCAGGAAGATAGTATCCAAGGAGGAAGAGAAAAAAGGAGCCTCCAATGACCTCGTCTCTTTT
GGCCGCAGTAAATCCAAACAGTCGGATGCGCAAACAGGAACTGAAGGTGGTGATCTGACGGTTGATACAGACATC
CCTCACTCCTCCCTTCCCATCCCAGTACCATACGAGTCATTTCCCCCACCTGACACTCTCCGCTCTGCAGAATCA
GATAACCCGGAAGAGGAAATTGACCTGGTCGAGCAGTTGTATGGAGCAGAGCAACCTCTGCGATCAGCCAACTTA
GACCTGGCAGAATCGATCGTACTACCTCCCGCTCCAAAGAACAGAGACTTGGACATGGCAGCGTGGTCTTCTACC
GCAAATGTAGATGACACCGGAACCCCAAGGAGGAACTCGGCCCCAAGAACTCCGATCAGTAATGGGAACGCAGAC
TCATCTGACAAAAGTACGCTGCCGCCTATCGGACAGGTGAACGGTGCATATGGTGTCCTCTCCTTGGACGAGTAT
TTTGAGCGAATGCGGACAGCGGCGATCATGCTCGCGCAGCTCAATGCAAATCTCGTTCGTGACCAGGCGGCCACG
ACTTACTCCTCGCCTCCCGGTAGTCTTTCGTCTACAGCACAGGATGTTTCCTCACCCAGTTCTTCTTCGAGTATG
ACTGCCTGGATTCCCGGTTCGGGTTGGCTCATGGGTTCTTCACCTCTTACCTCTGATGCAAGCCAGCCGTCCCCG
TCCGGCGCGGCCCAGGGACGAATGCGACTTCAGCATGCCCAAGCTCAACAAATCCGGGACAGAATAATGAAAGAG
ATGTTGGCGCTCGAAGAGGAGCGGATGGAACGGATGAAAGAAAACGGGTCTGGCTTTGAGAACGGAATTAGTTGG
AATAGAGCAGGCCTTGGAATCAGGGGAGTCGATTTGGGCTCTGCAAGTGGAGAAAACAGTGTGGAGGATGAGGGT
ATTATTAGGCGGGAACTGAATAAAGCCGATCCATCCGCTGTGGTCTTTAGTGAGAGCTGGGCTACTAAGAAAAGT
CGGATAAAAGCGGCATCGCCTTATGGACATCTCGCGAATTGGGATTGCGTGTCTGTAATAGTAAAAACTGGCGGT
GACCTACGACAGGAACAATTAGCTGTACAACTCATCCAAGAGTTTCAACGGATATGGACTGAAGAGAATTGTCCG
TGCTGGGTGCGATACTTCCGCATTGTGATTCTTGGTGCGGCCTCTGGTCTGGTGGAGACCATTACAGATGCTGTA
TCAATACATTCCATCAAAAAGGCGGAGTATGCGAAACGGTTAGCACGCAACAGACTGGGATATGTGACGCTGATG
GACCACTTCAAGTCTGCTTATGGTGATCCGTCTTCTGCCAAGTTTGCTCGTGCCCAACGCAATTTTGCAAAGTCT
CTTGCTGGATATTCCATCATTACTTACCTTTTACAAGTAAAAGATCGACATAACGGCAATATTCTTCTTGATAGA
GAAGGCCACCTTATCCATATTGACTTTGGATTTATTCTTAGTAATACACCAGGAAACATTGGGTTTGAAGCTGCG
CCGTTCAAGTTGCCGTTGGAGTATATTGAAGTGCTTGGTGGTGAGAATGGAGTGCCGTTCATGGAATTTAAAAGG
TTGTTCAGGGAAGGGTTTGAAGCCGCTAGGAAACATTGCGATCGGATACTTACACTGGTAGAATTGATGCAGAGA
GACTCGACATTGCCTTGTTTTGCCCTTTATGGTGAACAGACGGTGCAATACTTGAAGGACAGGTTTCAACCTACA
TTGACACATTCGTTGATTGGGGAATACGTGGATCGGCTGATTGATACGTCTTTGGGCTCTCACTGGACGAGGCTT
TATGATTCTTATCAGTATTATTCGCAGTCTATTCTATGA
Transcript >Agabi119p4|057210
ATGGCCTCGCATGCGCTCCTCCTGCGGCTCTTCCTCTCGCCCTCCTTCTTCTCTCTCCACCTCGCTCTCAACTAC
CTTCGTCTCTACGCAGACAACGTCGGCATCACCTACTACCTCACCAGGAGACTCAGGGAGCTCGATGTCCACCAG
CTCTACGATGTCTGGGGCTTCATATGCCATCTTCTCGTCACTCGCCCCTCAAAGTCCAGGGCCCTCGAGGTCTTT
GTCGTCGAGACTGCCCAGCGTTCCACTCACATCGCTATGATCACACTCTGGTACATGCAAGCCTCCCTCCACGAT
CTTTCACTGACTCGCCGCGAGTCCCCCTCCTTCACCATCTGCCAACGGGTCCTCCACAAGTGCCATGAGATCATC
TTCAATGATTTACCGCGCCCCACCTCCTCACCCTATCCTCCCTTTAAATTATCCGCCCGGGGATCCTTTGCTCGG
AGACGGATCAGGCATCATGCAGAGCCCGCATTTGTTGGCATGGGCGTCGTTCTCGCTGCAGCCCCTGCCATGCCC
GCCCTCGCTGAATTTACCGGCCAGATTGCTCTAGAACAGGGCCGCGCCGATGACGACGGGCAAGAGCTGCGTAGC
CTACGCTCGATCGAAACAGACCTCGTACTCGTCACCGCACCCAAGACAGCAGACTCCTCTGGCATCGACGACGAC
ATGGACCCGGAGACCGATAGCCCACCGAATGAAGAGAATGGTCTCCCCCAGGCAGATAATCACGAGGCATTACGG
CAAGATGCTCCCATCATCCTCCGCCGCCGTACCGTCACCGCTGCCCAAACAGTACCCGCTTTACCACTACACCTC
CGTACAATTCGACGCTCCCGAGCCTCTGAAGATCCTCTTGGACAGCTGGATTATGAAACCTTGCCGGCTGCCCCC
GCTCAATCCTCTCCCGCCCTCCCTGCAACGAGGACACCGCCCCGGTTTGCCGCTGCTAAGATGGCCGATGGGCTT
CTCGAAAAGTATGATTTACAAGCTCAGACTCAACTTTTGCGAGGGCACTACTGTCATTCGGAAGTCCAATTCATC
CTAGATCTTGAAAACCTCTGCAACCGTCTCTTGATTGTACCCAAACCCGCACGAGTAAGCGCGCTCAGAGCAGAA
CTGACTGCACTGAACCATAAGCTGCCCGCTGAGGTATGTATGCCGATGTGGTGCAATTCCTCAGATATACCTCAG
GGTCCCAACAACATACCCAAACCCCATCATCGCATAGTTAGAATTCCTCCTGGCGAGAGTGTCGTGTTGAACTCT
GCAGAACGAGCCCCATACCTGTTACTAATCGAAATCATACACGACGACCTTGATTTTGATCCTTCTAAACGAGCT
AATAAAGAAGTGCTCAGGAAGATAGTATCCAAGGAGGAAGAGAAAAAAGGAGCCTCCAATGACCTCGTCTCTTTT
GGCCGCAGTAAATCCAAACAGTCGGATGCGCAAACAGGAACTGAAGGTGGTGATCTGACGGTTGATACAGACATC
CCTCACTCCTCCCTTCCCATCCCAGTACCATACGAGTCATTTCCCCCACCTGACACTCTCCGCTCTGCAGAATCA
GATAACCCGGAAGAGGAAATTGACCTGGTCGAGCAGTTGTATGGAGCAGAGCAACCTCTGCGATCAGCCAACTTA
GACCTGGCAGAATCGATCGTACTACCTCCCGCTCCAAAGAACAGAGACTTGGACATGGCAGCGTGGTCTTCTACC
GCAAATGTAGATGACACCGGAACCCCAAGGAGGAACTCGGCCCCAAGAACTCCGATCAGTAATGGGAACGCAGAC
TCATCTGACAAAAGTACGCTGCCGCCTATCGGACAGGTGAACGGTGCATATGGTGTCCTCTCCTTGGACGAGTAT
TTTGAGCGAATGCGGACAGCGGCGATCATGCTCGCGCAGCTCAATGCAAATCTCGTTCGTGACCAGGCGGCCACG
ACTTACTCCTCGCCTCCCGGTAGTCTTTCGTCTACAGCACAGGATGTTTCCTCACCCAGTTCTTCTTCGAGTATG
ACTGCCTGGATTCCCGGTTCGGGTTGGCTCATGGGTTCTTCACCTCTTACCTCTGATGCAAGCCAGCCGTCCCCG
TCCGGCGCGGCCCAGGGACGAATGCGACTTCAGCATGCCCAAGCTCAACAAATCCGGGACAGAATAATGAAAGAG
ATGTTGGCGCTCGAAGAGGAGCGGATGGAACGGATGAAAGAAAACGGGTCTGGCTTTGAGAACGGAATTAGTTGG
AATAGAGCAGGCCTTGGAATCAGGGGAGTCGATTTGGGCTCTGCAAGTGGAGAAAACAGTGTGGAGGATGAGGGT
ATTATTAGGCGGGAACTGAATAAAGCCGATCCATCCGCTGTGGTCTTTAGTGAGAGCTGGGCTACTAAGAAAAGT
CGGATAAAAGCGGCATCGCCTTATGGACATCTCGCGAATTGGGATTGCGTGTCTGTAATAGTAAAAACTGGCGGT
GACCTACGACAGGAACAATTAGCTGTACAACTCATCCAAGAGTTTCAACGGATATGGACTGAAGAGAATTGTCCG
TGCTGGGTGCGATACTTCCGCATTGTGATTCTTGGTGCGGCCTCTGGTCTGGTGGAGACCATTACAGATGCTGTA
TCAATACATTCCATCAAAAAGGCGGAGTATGCGAAACGGTTAGCACGCAACAGACTGGGATATGTGACGCTGATG
GACCACTTCAAGTCTGCTTATGGTGATCCGTCTTCTGCCAAGTTTGCTCGTGCCCAACGCAATTTTGCAAAGTCT
CTTGCTGGATATTCCATCATTACTTACCTTTTACAAGTAAAAGATCGACATAACGGCAATATTCTTCTTGATAGA
GAAGGCCACCTTATCCATATTGACTTTGGATTTATTCTTAGTAATACACCAGGAAACATTGGGTTTGAAGCTGCG
CCGTTCAAGTTGCCGTTGGAGTATATTGAAGTGCTTGGTGGTGAGAATGGAGTGCCGTTCATGGAATTTAAAAGG
TTGTTCAGGGAAGGGTTTGAAGCCGCTAGGAAACATTGCGATCGGATACTTACACTGGTAGAATTGATGCAGAGA
GACTCGACATTGCCTTGTTTTGCCCTTTATGGTGAACAGACGGTGCAATACTTGAAGGACAGGTTTCAACCTACA
TTGACACATTCGTTGATTGGGGAATACGTGGATCGGCTGATTGATACGTCTTTGGGCTCTCACTGGACGAGGCTT
TATGATTCTTATCAGTATTATTCGCAGTCTATTCTATGA
Gene >Agabi119p4|057210
ATGGCCTCGCATGCGCTCCTCCTGCGGCTCTTCCTCTCGCCCTCCTTCTTCTCTCTCCACCTCGCTCTCAACTAC
CTTCGTCTCTACGCAGACAACGTCGGCATCACCTACTACCTCACCAGGAGACTCAGGGAGCTCGATGTCCACCAG
CTCTACGATGTCTGGGGCTTCATATGGTCCTCTTCTTCTCTCCCCGCCCTCACCGCCCCGCTCACCCCCCTTCCT
ACAGCCATCTTCTCGTCACTCGCCCCTCAAAGTCCAGGGCCCTCGAGGTCTTTGTCGTCGAGACTGCCCAGCGTT
CCACTCACATCGCTATGATCGTACGTCTTTTCTCCTCCACCAATATTCACCTACTGTATACCCTTTTAGACACTC
TGGTACATGCAAGCCTCCCTCCACGATCTTTCACTGACTCGCCGCGAGTCCCCCTCCTTCACCATCTGCCAACGG
GTCCTCCACAAGTGCCATGAGATCATCTTCAATGATTTACCGCGCCCCACCTCCTCACCCTATCCTCCCTTTAAA
TTATCCGCCCGGGGATCCTTTGCTCGGAGACGGATCAGGCATCATGCAGAGCCCGCATTTGTTGGCATGGGCGTC
GTTCTCGCTGCAGCCCCTGCCATGCCCGCCCTCGCTGAATTTACCGGCCAGATTGCTCTAGAACAGGGCCGCGCC
GATGACGACGGGCAAGAGCTGCGTAGCCTACGCTCGATCGAAACAGACCTCGTACTCGTCACCGCACCCAAGACA
GCAGACTCCTCTGGCATCGACGACGACATGGACCCGGAGACCGATAGCCCACCGAATGAAGAGAATGGTCTCCCC
CAGGCAGATAATCACGAGGCATTACGGCAAGATGCTCCCATCATCCTCCGCCGCCGTACCGTCACCGCTGCCCAA
ACAGTACCCGCTTTACCACTACACCTCCGTACAATTCGACGCTCCCGAGCCTCTGAAGATCCTCTTGGACAGCTG
GATTATGAAACCTTGCCGGCTGCCCCCGCTCAATCCTCTCCCGCCCTCCCTGCAACGAGGACACCGCCCCGGTTT
GCCGCTGCTAAGATGGCCGATGGGCTTCTCGAAAAGTATGATTTACAAGCTCAGACTCAACTTTTGCGAGGGCAC
TACTGTCATTCGGAAGTACGTCGATCATGTTTGACTATTTTTAGCCCAATCAATAATTATAATCAGGTCCAATTC
ATCCTAGATCTTGAAAACCTCTGCAACCGTCTCTTGATTGTACCCAAACCCGCACGAGTAAGCGCGCTCAGAGCA
GAACTGACTGCACTGAACCATAAGCTGCCCGCTGAGGTATGACTTATACTATACTCAAGTCTGAGGCTCTTATAG
ATTTTTCCTCAGGTATGTATGCCGATGTGGTGCAATTCCTCAGATATACCTCAGGGTCCCAACAACATACCCAAA
CCCCATCATCGCATAGTTAGAATTCCTCCTGGCGAGAGTGTCGTGTTGAACTCTGCAGAACGAGCCCCATACCTG
TTACTAATCGAAATCATACACGACGACCTTGATTTTGATCCTTCTAAACGAGCTAATAAAGAAGTGCTCAGGAAG
ATAGTATCCAAGGAGGAAGAGAAAAAAGGAGCCTCCAATGACCTCGTCTCTTTTGGCCGCAGTAAATCCAAACAG
TCGGATGCGCAAACAGGAACTGAAGGTGGTGATCTGACGGTTGATACAGACATCCCTCACTCCTCCCTTCCCATC
CCAGTACCATACGAGTCATTTCCCCCACCTGACACTCTCCGCTCTGCAGAATCAGATAACCCGGAAGAGGAAATT
GACCTGGTCGAGCAGTTGTATGGAGCAGAGCAACCTCTGCGATCAGCCAACTTAGACCTGGCAGAATCGATCGTA
CTACCTCCCGCTCCAAAGAACAGAGACTTGGACATGGCAGCGTGGTCTTCTACCGCAAATGTAGATGACACCGGA
ACCCCAAGGAGGAACTCGGCCCCAAGAACTCCGATCAGTAATGGGAACGCAGACTCATCTGACAAAAGTACGCTG
CCGCCTATCGGACAGGTGAACGGTGCATATGGTGTCCTCTCCTTGGACGAGTATTTTGAGCGAATGCGGACAGCG
GCGATCATGCTCGCGCAGCTCAATGCAAATCTCGTTCGTGACCAGGCGGCCACGACTTACTCCTCGCCTCCCGGT
AGTCTTTCGTCTACAGCACAGGATGTTTCCTCACCCAGTTCTTCTTCGAGTATGACTGCCTGGATTCCCGGTTCG
GGTTGGCTCATGGGTTCTTCACCTCTTACCTCTGATGCAAGCCAGCCGTCCCCGTCCGGCGCGGCCCAGGGACGA
ATGCGACTTCAGCATGCCCAAGCTCAACAAATCCGGGACAGAATAATGAAAGAGATGTTGGCGCTCGAAGAGGAG
CGGATGGAACGGATGAAAGAAAACGGGTCTGGCTTTGAGAACGGAATTAGTTGGAATAGAGCAGGCCTTGGAATC
AGGGGAGTCGATTTGGGCTCTGCAAGTGGAGAAAACAGTGTGGAGGATGAGGGTATTATTAGGCGGGAACTGAAT
AAAGCCGATCCATCCGCTGTGGTCTTTAGTGAGAGCTGGGCTACTAAGAAAGTGCGTTCAAACCATTGTTATCGC
TTACTCGACTGAGCACATTTGTATAGAGTCGGATAAAAGCGGCATCGCCTTATGGACATCTCGGTGCGTATGCCG
ACTCGGTCGATCATAACCTAAATTGACGCTTCCTGTCACTTCCAATTCTTAAGCGAATTGGGATTGCGTGTCTGT
AATAGTAAAAACTGGCGGTGACCTACGACAGGAACAATTAGCTGTACAACTCATCCAAGAGTTTCAACGGATATG
GACTGAAGAGAATTGTCCGTGCTGGGTGCGATAGTAAGTTTTCTAGCTGTTGAAACTGCATTTGAGCAATCTAAC
CCCGTAAATCAGCTTCCGCATTGTGATTCTTGGTGCGGCCTCTGGTCTGGTGGAGACCATTACAGATGCTGTATC
AATACATTCCATCAAAAAGGCGGAGTATGCGAAACGGTTAGCACGCAACAGACTGGGATATGTGACGCTGATGGA
CCACTTCAAGTCTGTAAGTCAAACTCGCAGCACTGGAATCGTCATTAACTTTTTCAATAATATAAGGCTTATGGT
GATCCGTCTTCTGCCAAGTTTGCTCGTGCCCAACGCAATTTTGCAAAGTCTCTTGCTGGATATTCCATCATTACT
TACCTTTTACAAGTAAAAGATCGACATAACGGCAATATTCTTCTTGATAGAGAAGGCCACCTTATCCATATTGAC
TTTGGATTTATTCTTAGTAATACACCAGGAAACATTGGGTTTGAAGCTGCGCCGTTCAAGTTGCCGTTGGAGTAT
ATTGAAGTGCTTGGTGGTGAGAATGGAGTGCCGTTCATGGAATTTAAAAGGTTGTTCAGGGAAGGGTTTGAAGCC
GCTAGGAAACATTGCGATCGGATACTTAGTAAGTCTTTCAAAGAAAAAAAGACTGAATATTTGGCTGAAACAATT
ATGTAGCACTGGTAGAATTGATGCAGAGAGACTCGACATTGCCTTGTTTTGCCCTTTATGGTGAACAGACGGTGC
AATACTTGAAGGACAGGTTTCAACCTACATTGACACATTCGTTGATTGGGGAATACGTGGATCGGCTGATTGATA
CGTCTTTGGGCTCTCACTGGACGAGGCTTTATGATTCTGTGAGTATTCAAGTGTGTTCATTTGTTATTGTGACGC
CCAGTGTTGATGGCATGATTAGTATCAGTATTATTCGCAGTCTATTCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail