Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|057130
Gene name
Locationscaffold_03a:1128165..1132885
Strand+
Gene length (bp)4720
Transcript length (bp)3987
Coding sequence length (bp)3987
Protein length (aa) 1329

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08626 TRAPPC9-Trs120 Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit 1.1E-200 7 1265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14251|TR120_SCHPO Transport protein particle subunit trs120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs120 PE=3 SV=1 1 1281 4.0E-45
sp|Q32PH0|TPPC9_BOVIN Trafficking protein particle complex subunit 9 OS=Bos taurus GN=TRAPPC9 PE=1 SV=1 602 812 3.0E-09
sp|Q9FY61|TR120_ARATH Trafficking protein particle complex II-specific subunit 120 homolog OS=Arabidopsis thaliana GN=TRS120 PE=1 SV=1 728 949 2.0E-08
sp|Q96Q05|TPPC9_HUMAN Trafficking protein particle complex subunit 9 OS=Homo sapiens GN=TRAPPC9 PE=1 SV=2 602 812 5.0E-08
sp|Q3U0M1|TPPC9_MOUSE Trafficking protein particle complex subunit 9 OS=Mus musculus GN=Trappc9 PE=1 SV=2 602 812 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14251|TR120_SCHPO Transport protein particle subunit trs120 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trs120 PE=3 SV=1 1 1281 4.0E-45
sp|Q32PH0|TPPC9_BOVIN Trafficking protein particle complex subunit 9 OS=Bos taurus GN=TRAPPC9 PE=1 SV=1 602 812 3.0E-09
sp|Q9FY61|TR120_ARATH Trafficking protein particle complex II-specific subunit 120 homolog OS=Arabidopsis thaliana GN=TRS120 PE=1 SV=1 728 949 2.0E-08
sp|Q96Q05|TPPC9_HUMAN Trafficking protein particle complex subunit 9 OS=Homo sapiens GN=TRAPPC9 PE=1 SV=2 602 812 5.0E-08
sp|Q3U0M1|TPPC9_MOUSE Trafficking protein particle complex subunit 9 OS=Mus musculus GN=Trappc9 PE=1 SV=2 602 812 1.0E-07
sp|Q6PA97|TPPC9_XENLA Trafficking protein particle complex subunit 9 OS=Xenopus laevis GN=trappc9 PE=2 SV=1 602 812 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|057130
MDNHAFASLAHVQILLLPVGATPLASFERCVSEIRGFDTIRLGDIPTDAKGERARFMPNPLSAGHLHLNFPTHPP
PPSQYALSLLRPSQFPLAVIGIASFCQTSTLKSIYSQFNAALLDIFPASNQFPLARTCFVFEENDIATNLSASND
LPGVVIIPSMMGNKRLYIGTLLADLCSQILGEFGVVMQALESPFGNEYLNGSLLAALPPLSELPLSLDSDRRGSV
PNFSSPDVLKSDSASTSIPPMKRNSSSGPNYRLGVQPPKKRLSTIGVASSHARLYKMLGDFFLLAGRTEDSTIWY
TEALQLFKNSQDHAWHAAVLEGLATISVVEAWSAGHGLHNSTTSSKEPWSDAIEKLTQATTLYHKSPLYYEGESI
YAPLAYLYSCCVLRHSSLLFAVWSAKGWGPLAFTTMLQPGPKAHLPPTLAHDEADQWLNLERLTKYSGISRSSIS
NVLGQIHGPWLLHLHPRERLSILTTMASVYACLGYKRKEAYLLREVLGCVMDLIVCGREEDGITKVSGPRNTGLG
IENGNITPTNPLTYLDQGSVAVRMSESSLGNDSVLRILKQVCKTIGIDLDAVKLVHASTQETELAESSQNEASTN
DDGSELERPETYGWPELQVGVVREAVAVAEALPDFPAVAQFALSSLKTLQTVLSPGDQHHLYSTSMRAITTARRR
GDSKFFEYWSGRPVVSVALAPVPLVRLPVEKHLSVLSKQKSDLTPIIQGITDPFLYNPRRVTAKKDQEIVAQNEV
LEFVVVLQNPFIFDLELQCLSLSTSGVKFQSEPVRVVLPASSFHQVVIPGKVMATGILTIRGCFVQAPGGITQEF
ILPLNTAEEEERITRRKSALICEAERYKYWGLESLPWEKPKRSIKYHSSQLNPRTNLRFLECKVVPEQPLLRIRR
TSVNHGALMLYEGERSTLRITLENISLLPIDFVHLAFDDSTIEPAQQALAEGAMSSSDVYETEHSLINQPVFTWN
KSEGRLIPPGHTLSLSISCFGKSGCTNGNVHVSYSYTHRTDLEKPSDYFYTRQLSHPIMVTVYPMLQCQNMDLIP
FPSYMDYIQTPSTTTYHNNLGVDDGASWCLFSVEVRNVYGSPFEVTFEREQYGTSHSSTTTTIPPGSTSRVVLPL
RRTALSQEDTSKAIPTLSDRQFVVAKDKLSTAELHLQRELFWYREALFKSIQGYWKEVGGTRTGEMSLRQQRMTL
PMLEAFKSNVARVDLSLISCDLPKENTIDGRRVWKANEFLKLKVRITNLSSFAIPLSLTLDLEPSDCLIYEGVIA
DIPIGRLDEGMTREIEFPICFLTNGHFELVAQVRAVGFDIKPAKAEIIAAVRS*
Coding >Agabi119p4|057130
ATGGATAATCACGCCTTTGCTTCTCTCGCTCATGTTCAGATACTCCTTCTACCCGTCGGCGCCACGCCTCTGGCC
TCGTTCGAAAGATGTGTCTCTGAAATACGTGGGTTTGATACTATAAGGCTTGGAGATATCCCAACAGACGCCAAA
GGGGAAAGAGCTCGATTTATGCCGAATCCCCTCTCCGCCGGTCACCTACACCTGAACTTCCCTACTCACCCGCCG
CCGCCGTCTCAATATGCGCTCTCTCTTCTGCGACCATCACAATTCCCGCTTGCTGTCATCGGAATAGCATCATTT
TGTCAAACGAGCACACTGAAATCAATTTACTCTCAGTTCAATGCTGCATTACTCGATATCTTTCCTGCTTCAAAT
CAGTTTCCGTTGGCCAGAACATGTTTTGTGTTTGAAGAGAATGACATTGCTACCAATCTAAGTGCGAGTAATGAT
CTTCCTGGAGTGGTAATTATACCTAGCATGATGGGAAACAAGAGATTGTACATTGGGACCTTGCTGGCCGACTTG
TGTTCACAGATCCTTGGAGAGTTCGGAGTCGTGATGCAAGCACTTGAGAGTCCATTTGGCAATGAGTATCTTAAC
GGCTCTCTATTAGCTGCTTTACCACCTTTATCCGAGCTTCCGTTATCTCTTGACTCGGATAGGAGAGGATCCGTC
CCGAATTTTAGTAGTCCAGATGTGTTGAAGTCGGATTCTGCTTCGACTTCGATTCCACCCATGAAACGCAATTCA
TCCTCTGGGCCGAACTATCGACTAGGTGTACAGCCTCCCAAAAAGCGATTAAGCACAATTGGCGTGGCTTCATCC
CATGCACGTCTCTACAAAATGCTAGGCGATTTCTTTTTGCTCGCTGGCCGCACAGAAGATTCGACTATCTGGTAT
ACCGAAGCACTACAACTGTTCAAGAATTCGCAAGATCATGCATGGCACGCAGCCGTGCTCGAGGGTTTGGCCACC
ATCTCTGTCGTTGAAGCTTGGTCCGCAGGCCACGGTTTGCATAACTCGACCACTTCTTCAAAAGAACCCTGGTCA
GACGCCATTGAAAAACTCACTCAAGCTACTACACTTTATCACAAGTCACCCCTCTACTATGAGGGCGAGTCCATC
TATGCTCCCCTTGCGTATTTATATTCTTGCTGTGTGTTACGTCATTCTTCACTGCTTTTCGCAGTTTGGTCTGCC
AAGGGATGGGGTCCACTTGCATTTACCACAATGTTGCAACCAGGGCCCAAGGCGCACCTTCCGCCAACTCTAGCG
CATGATGAAGCTGATCAATGGCTCAATCTAGAACGCTTGACCAAATACTCTGGCATCTCGCGATCTTCAATATCA
AATGTCCTTGGTCAAATTCATGGTCCCTGGCTGTTACATCTTCATCCTCGGGAGAGATTGTCTATACTGACGACT
ATGGCTAGCGTTTATGCATGCCTTGGCTACAAGCGGAAGGAAGCATACTTATTGCGTGAAGTATTGGGATGTGTA
ATGGATCTTATAGTCTGTGGACGTGAAGAGGATGGTATCACGAAGGTATCAGGGCCTCGGAATACGGGACTTGGC
ATTGAAAATGGGAATATCACACCGACCAATCCTCTTACCTATCTCGACCAGGGGTCTGTTGCTGTCAGAATGAGC
GAAAGCTCATTGGGGAATGACAGTGTGCTCAGGATTCTTAAACAAGTATGCAAAACAATCGGTATTGACCTCGAT
GCTGTCAAGTTAGTGCATGCATCGACTCAAGAAACTGAATTGGCCGAGTCGAGTCAGAATGAGGCCAGTACAAAT
GATGATGGTTCGGAATTGGAGCGGCCTGAAACCTATGGATGGCCCGAATTGCAAGTGGGTGTTGTCAGGGAAGCA
GTCGCGGTGGCGGAAGCCTTGCCGGATTTCCCTGCTGTCGCCCAGTTTGCTTTGTCGTCTTTGAAAACCCTGCAA
ACAGTGCTTTCTCCTGGGGATCAACATCACCTGTATTCGACGTCTATGCGTGCCATAACGACAGCTCGTCGACGA
GGAGACTCGAAATTCTTCGAGTACTGGTCCGGACGACCGGTGGTTAGTGTCGCTCTCGCCCCTGTACCACTCGTT
AGACTGCCTGTTGAAAAGCACTTGTCGGTTTTATCGAAACAAAAGTCTGACTTAACTCCCATCATTCAGGGCATC
ACAGATCCTTTCCTGTATAATCCTCGGAGAGTCACTGCTAAAAAGGACCAAGAGATCGTGGCTCAGAATGAGGTG
CTAGAGTTCGTCGTCGTGCTGCAAAATCCCTTTATCTTTGATCTAGAACTTCAGTGCCTCTCGTTAAGTACTTCG
GGCGTAAAATTCCAATCCGAGCCGGTCCGCGTTGTCTTGCCAGCGAGTTCATTTCACCAGGTGGTTATACCAGGC
AAAGTTATGGCGACAGGCATTCTCACTATCCGGGGGTGCTTTGTACAAGCACCTGGTGGTATCACTCAAGAGTTC
ATACTGCCTCTCAATACAGCAGAGGAGGAAGAGAGGATCACCAGGAGAAAGAGCGCACTCATATGCGAGGCTGAA
CGTTACAAGTATTGGGGTTTGGAATCACTTCCATGGGAAAAACCGAAGAGGTCGATCAAATACCACTCCAGCCAG
CTGAATCCCCGCACAAATTTACGTTTCCTGGAATGTAAGGTGGTCCCTGAGCAACCGCTGTTAAGAATACGTAGA
ACATCGGTCAATCATGGAGCTTTGATGTTATATGAGGGCGAGCGATCAACTCTACGCATAACGCTTGAGAATATA
TCGTTGTTACCCATAGACTTTGTGCATCTAGCGTTCGACGACTCCACTATTGAACCTGCTCAACAGGCGTTAGCG
GAAGGGGCAATGTCCAGTTCAGATGTCTACGAGACTGAGCATAGCCTTATCAATCAGCCTGTTTTTACTTGGAAC
AAAAGTGAAGGTAGACTTATTCCTCCAGGACATACTCTGAGCCTGAGTATATCCTGTTTCGGAAAATCGGGCTGT
ACCAATGGAAATGTTCACGTCTCTTACTCATACACACATCGTACCGACCTTGAAAAACCATCTGATTATTTTTAT
ACTCGGCAGCTGTCGCATCCTATCATGGTCACCGTCTATCCGATGCTCCAGTGCCAAAATATGGATTTAATCCCG
TTTCCCTCGTATATGGACTACATACAAACGCCATCAACGACCACGTATCATAATAATTTGGGTGTAGATGATGGA
GCGAGTTGGTGTTTATTCTCGGTCGAGGTACGCAATGTATATGGGTCACCATTCGAAGTAACATTTGAGCGCGAG
CAATACGGGACATCACATTCATCTACTACGACCACCATACCGCCTGGGTCTACATCAAGGGTGGTTTTGCCATTG
AGGAGGACAGCACTGTCTCAAGAGGATACCTCAAAAGCGATACCGACTCTATCGGATCGGCAATTTGTGGTGGCT
AAAGACAAGCTGTCTACTGCTGAGCTCCACCTGCAGAGGGAATTATTCTGGTATAGAGAAGCTTTGTTCAAAAGC
ATTCAGGGTTACTGGAAAGAGGTTGGAGGCACTCGCACAGGTGAAATGTCACTCCGTCAGCAGCGTATGACATTA
CCTATGCTGGAGGCCTTTAAATCCAATGTAGCACGGGTAGACCTATCGCTGATATCTTGTGATCTACCTAAAGAG
AATACGATCGATGGGAGGCGCGTCTGGAAGGCGAATGAATTCTTGAAGCTAAAAGTACGAATAACCAACCTGTCT
TCATTTGCAATACCCCTCAGTCTGACTCTTGACCTTGAACCAAGTGACTGTTTGATTTACGAGGGTGTCATCGCC
GATATTCCTATTGGGCGCTTGGATGAGGGGATGACACGAGAGATTGAGTTTCCCATCTGCTTCCTCACGAATGGC
CATTTCGAACTCGTAGCACAAGTCCGGGCTGTAGGGTTTGATATCAAACCTGCCAAAGCAGAGATCATCGCGGCT
GTCCGCAGTTGA
Transcript >Agabi119p4|057130
ATGGATAATCACGCCTTTGCTTCTCTCGCTCATGTTCAGATACTCCTTCTACCCGTCGGCGCCACGCCTCTGGCC
TCGTTCGAAAGATGTGTCTCTGAAATACGTGGGTTTGATACTATAAGGCTTGGAGATATCCCAACAGACGCCAAA
GGGGAAAGAGCTCGATTTATGCCGAATCCCCTCTCCGCCGGTCACCTACACCTGAACTTCCCTACTCACCCGCCG
CCGCCGTCTCAATATGCGCTCTCTCTTCTGCGACCATCACAATTCCCGCTTGCTGTCATCGGAATAGCATCATTT
TGTCAAACGAGCACACTGAAATCAATTTACTCTCAGTTCAATGCTGCATTACTCGATATCTTTCCTGCTTCAAAT
CAGTTTCCGTTGGCCAGAACATGTTTTGTGTTTGAAGAGAATGACATTGCTACCAATCTAAGTGCGAGTAATGAT
CTTCCTGGAGTGGTAATTATACCTAGCATGATGGGAAACAAGAGATTGTACATTGGGACCTTGCTGGCCGACTTG
TGTTCACAGATCCTTGGAGAGTTCGGAGTCGTGATGCAAGCACTTGAGAGTCCATTTGGCAATGAGTATCTTAAC
GGCTCTCTATTAGCTGCTTTACCACCTTTATCCGAGCTTCCGTTATCTCTTGACTCGGATAGGAGAGGATCCGTC
CCGAATTTTAGTAGTCCAGATGTGTTGAAGTCGGATTCTGCTTCGACTTCGATTCCACCCATGAAACGCAATTCA
TCCTCTGGGCCGAACTATCGACTAGGTGTACAGCCTCCCAAAAAGCGATTAAGCACAATTGGCGTGGCTTCATCC
CATGCACGTCTCTACAAAATGCTAGGCGATTTCTTTTTGCTCGCTGGCCGCACAGAAGATTCGACTATCTGGTAT
ACCGAAGCACTACAACTGTTCAAGAATTCGCAAGATCATGCATGGCACGCAGCCGTGCTCGAGGGTTTGGCCACC
ATCTCTGTCGTTGAAGCTTGGTCCGCAGGCCACGGTTTGCATAACTCGACCACTTCTTCAAAAGAACCCTGGTCA
GACGCCATTGAAAAACTCACTCAAGCTACTACACTTTATCACAAGTCACCCCTCTACTATGAGGGCGAGTCCATC
TATGCTCCCCTTGCGTATTTATATTCTTGCTGTGTGTTACGTCATTCTTCACTGCTTTTCGCAGTTTGGTCTGCC
AAGGGATGGGGTCCACTTGCATTTACCACAATGTTGCAACCAGGGCCCAAGGCGCACCTTCCGCCAACTCTAGCG
CATGATGAAGCTGATCAATGGCTCAATCTAGAACGCTTGACCAAATACTCTGGCATCTCGCGATCTTCAATATCA
AATGTCCTTGGTCAAATTCATGGTCCCTGGCTGTTACATCTTCATCCTCGGGAGAGATTGTCTATACTGACGACT
ATGGCTAGCGTTTATGCATGCCTTGGCTACAAGCGGAAGGAAGCATACTTATTGCGTGAAGTATTGGGATGTGTA
ATGGATCTTATAGTCTGTGGACGTGAAGAGGATGGTATCACGAAGGTATCAGGGCCTCGGAATACGGGACTTGGC
ATTGAAAATGGGAATATCACACCGACCAATCCTCTTACCTATCTCGACCAGGGGTCTGTTGCTGTCAGAATGAGC
GAAAGCTCATTGGGGAATGACAGTGTGCTCAGGATTCTTAAACAAGTATGCAAAACAATCGGTATTGACCTCGAT
GCTGTCAAGTTAGTGCATGCATCGACTCAAGAAACTGAATTGGCCGAGTCGAGTCAGAATGAGGCCAGTACAAAT
GATGATGGTTCGGAATTGGAGCGGCCTGAAACCTATGGATGGCCCGAATTGCAAGTGGGTGTTGTCAGGGAAGCA
GTCGCGGTGGCGGAAGCCTTGCCGGATTTCCCTGCTGTCGCCCAGTTTGCTTTGTCGTCTTTGAAAACCCTGCAA
ACAGTGCTTTCTCCTGGGGATCAACATCACCTGTATTCGACGTCTATGCGTGCCATAACGACAGCTCGTCGACGA
GGAGACTCGAAATTCTTCGAGTACTGGTCCGGACGACCGGTGGTTAGTGTCGCTCTCGCCCCTGTACCACTCGTT
AGACTGCCTGTTGAAAAGCACTTGTCGGTTTTATCGAAACAAAAGTCTGACTTAACTCCCATCATTCAGGGCATC
ACAGATCCTTTCCTGTATAATCCTCGGAGAGTCACTGCTAAAAAGGACCAAGAGATCGTGGCTCAGAATGAGGTG
CTAGAGTTCGTCGTCGTGCTGCAAAATCCCTTTATCTTTGATCTAGAACTTCAGTGCCTCTCGTTAAGTACTTCG
GGCGTAAAATTCCAATCCGAGCCGGTCCGCGTTGTCTTGCCAGCGAGTTCATTTCACCAGGTGGTTATACCAGGC
AAAGTTATGGCGACAGGCATTCTCACTATCCGGGGGTGCTTTGTACAAGCACCTGGTGGTATCACTCAAGAGTTC
ATACTGCCTCTCAATACAGCAGAGGAGGAAGAGAGGATCACCAGGAGAAAGAGCGCACTCATATGCGAGGCTGAA
CGTTACAAGTATTGGGGTTTGGAATCACTTCCATGGGAAAAACCGAAGAGGTCGATCAAATACCACTCCAGCCAG
CTGAATCCCCGCACAAATTTACGTTTCCTGGAATGTAAGGTGGTCCCTGAGCAACCGCTGTTAAGAATACGTAGA
ACATCGGTCAATCATGGAGCTTTGATGTTATATGAGGGCGAGCGATCAACTCTACGCATAACGCTTGAGAATATA
TCGTTGTTACCCATAGACTTTGTGCATCTAGCGTTCGACGACTCCACTATTGAACCTGCTCAACAGGCGTTAGCG
GAAGGGGCAATGTCCAGTTCAGATGTCTACGAGACTGAGCATAGCCTTATCAATCAGCCTGTTTTTACTTGGAAC
AAAAGTGAAGGTAGACTTATTCCTCCAGGACATACTCTGAGCCTGAGTATATCCTGTTTCGGAAAATCGGGCTGT
ACCAATGGAAATGTTCACGTCTCTTACTCATACACACATCGTACCGACCTTGAAAAACCATCTGATTATTTTTAT
ACTCGGCAGCTGTCGCATCCTATCATGGTCACCGTCTATCCGATGCTCCAGTGCCAAAATATGGATTTAATCCCG
TTTCCCTCGTATATGGACTACATACAAACGCCATCAACGACCACGTATCATAATAATTTGGGTGTAGATGATGGA
GCGAGTTGGTGTTTATTCTCGGTCGAGGTACGCAATGTATATGGGTCACCATTCGAAGTAACATTTGAGCGCGAG
CAATACGGGACATCACATTCATCTACTACGACCACCATACCGCCTGGGTCTACATCAAGGGTGGTTTTGCCATTG
AGGAGGACAGCACTGTCTCAAGAGGATACCTCAAAAGCGATACCGACTCTATCGGATCGGCAATTTGTGGTGGCT
AAAGACAAGCTGTCTACTGCTGAGCTCCACCTGCAGAGGGAATTATTCTGGTATAGAGAAGCTTTGTTCAAAAGC
ATTCAGGGTTACTGGAAAGAGGTTGGAGGCACTCGCACAGGTGAAATGTCACTCCGTCAGCAGCGTATGACATTA
CCTATGCTGGAGGCCTTTAAATCCAATGTAGCACGGGTAGACCTATCGCTGATATCTTGTGATCTACCTAAAGAG
AATACGATCGATGGGAGGCGCGTCTGGAAGGCGAATGAATTCTTGAAGCTAAAAGTACGAATAACCAACCTGTCT
TCATTTGCAATACCCCTCAGTCTGACTCTTGACCTTGAACCAAGTGACTGTTTGATTTACGAGGGTGTCATCGCC
GATATTCCTATTGGGCGCTTGGATGAGGGGATGACACGAGAGATTGAGTTTCCCATCTGCTTCCTCACGAATGGC
CATTTCGAACTCGTAGCACAAGTCCGGGCTGTAGGGTTTGATATCAAACCTGCCAAAGCAGAGATCATCGCGGCT
GTCCGCAGTTGA
Gene >Agabi119p4|057130
ATGGATAATCACGCCTTTGCTTCTCTCGCTCATGTTCAGATACTCCTTCTACCCGTCGGCGCCACGCCTCTGGCC
TCGTTCGAAAGATGTGTCTCTGAAATACGTGGGTTTGATACTATAAGGCTTGGAGATATCCCAACAGACGCCAAA
GGGGAAAGAGGTGTGCTACCCGACCACACTCCTCAACGAAGAAGCCGAGCTGACGACAGGTCAAATGCCTAGCTC
GATTTATGCCGAATCCCCTCTCCGCCGGTCACCTACACCTGAACTTCCCTACTCACCCGCCGCCGCCGTCTCAAT
ATGCGCTCTCTCTTCTGCGACCATCACAATTCCCGCTTGCTGTCATCGGAATAGCATCATTTTGTCAAACGAGCA
CACTGAAATCAATTTACTCTCAGTTCAATGCTGCATTACTCGATATCTTTCCTGCTTCAAATCAGTTTCCGTTGG
CCAGAACATGTTTTGTGTTTGAAGAGAATGACATTGCTACCAATCTAAGTGCGAGTAATGATCTTCCTGGAGTGG
TAATTATACCTAGCATGATGGGAAACAAGAGATTGTACATTGGGACCTTGCTGGCCGACTTGTGTTCACAGATCC
TTGGAGAGTTCGGAGTCGTGGTTCGTAAGCATCTCATATGCTTCGGCACTTGCAAGATTTGACAATATCGTAGAT
GCAAGCACTTGAGAGTCCATTTGGCAATGAGTATCTTAACGGCTCTCTATTAGCTGCTTTACCACCTTTATCCGA
GCTTCCGTTATCTCTTGACTCGGATAGGAGAGGATCCGTCCCGAATTTTAGTAGTCCAGATGTGTTGAAGTCGGA
TTCTGCTTCGACTTCGATTCCACCCATGAAACGCAATTCATCCTCTGGGCCGAACTATCGACTAGGTGTACAGCC
TCCCAAAAAGCGATTAAGCACAATTGGCGTGGCTTCATCCCATGCACGTCTCTACAAAATGCTAGGCGATTTCTT
TTTGCTCGCTGGCCGCACAGAAGATTCGACTATCTGGTGAGTCAATTATCCTCGGTAACCCACCAAGTTAATCAG
CCGACTGAATAGGTATACCGAAGCACTACAACTGTTCAAGAATTCGCAAGATCATGCATGGCACGCAGCCGTGCT
CGAGGGTTTGGCCACCATCTCTGTCGTTGAAGCTTGGTCCGCAGGCCACGGTTTGGTATTTGTAACCTGAGATAA
CTCATCGCATATTCTAACGAGAGCGTGTCAGCATAACTCGACCACTTCTTCAAAAGAACCCTGGTCAGACGCCAT
TGAAAAACTCACTCAAGCTACTACACTTTATCACAAGTCACCCCTCTACTATGAGGGCGAGTCCATCTATGCTCC
CCTTGCGTATTTATATTCTTGCTGTGTGTTACGTCATTCTTCACTGCTTTTCGCAGTTTGGTCTGCCAAGGGATG
GGGTCCACTTGCATTTACCACAATGTTGCAACCAGGGCCCAAGGCGCACCTTCCGCCAACTCTAGCGCATGATGA
AGCTGATCAATGGCTCAATCTAGAACGCTTGACCAAATACTCTGGCATCTCGCGATCTTCAATATCAAATGTCCT
TGGTCAAATTCATGGTCCCTGGCTGTTACATCTTCATCCTCGGGAGAGATTGTCTATACTGACGACTATGGCTAG
CGTTTATGCATGCCTTGGCTACAAGCGGAAGGAAGCATACTTATTGCGTGAAGTATTGGGATGTGTAATGGATCT
TATAGTCTGTGGACGTGAAGAGGATGGTATCACGAAGGTATCAGGGCCTCGGAATACGGGACTTGGCATTGAAAA
TGGGAATATCACACCGACCAATCCTCTTACCTATCTCGACCAGGGGTCTGTTGCTGTCAGAATGAGCGAAAGCTC
ATTGGGGAATGACAGTGTGCTCAGGATTCTTAAACAAGTATGCAAAACAATCGGTATTGACCTCGATGCTGTCAA
GTTAGTGCATGCATCGACTCAAGAAACTGAATTGGCCGAGTCGAGTCAGAATGAGGCCAGTACAAATGATGATGG
TTCGGAATTGGAGCGGCCTGAAACCTATGGATGGCCCGAATTGCAAGTGGGTGTTGTCAGGGAAGCAGTCGCGGT
GGCGGAAGCCTTGCCGGGTGAGCTGCAAGATACCGTTTTTAATAATCATTCACTGATGTAGGCCAGATTTCCCTG
CTGTCGCCCAGTTTGCTTTGTCGTCTTTGAAAACCCTGCAAACAGTGCTTTCTCCTGGGGATCAACATCACCTGT
ATTCGACGTCTATGCGTGCCATAACGACAGCTCGTCGACGAGGAGACTCGAAATTCTTCGAGTACTGGTCCGGAC
GACCGGTGGTTAGTGTCGCTCTCGCCCCGTAAGTGGTGGGTCCGTCTGCTATCAGGCTTCGTATTCTGACGAGGT
GTAGTGTACCACTCGTTAGACTGCCTGTTGAAAAGCACTTGTCGGTTTTATCGAAACAAAAGTCTGACTTAACTC
CCATCATTCAGGGCATCACAGATCCTTTCCTGTATAATCCTCGGAGAGTCACTGCTAAAAAGGTTTGCGCACGCC
CGATGTATCACCAGACGCACTCACAGATGAATTCGTAGGACCAAGAGATCGTGGCTCAGAATGAGGTGCTAGAGT
TCGTCGTCGTGCTGCAAAATCCCTTTATCTTTGATCTAGAACTTCAGTGCCTCTCGTTAAGGTGAACTGGACGAC
ATGTCGGGTCACTGGGGCATTTACTCATTTTTTCCCTTAGTACTTCGGGCGTAAAATTCCAATCCGAGCCGGTCC
GCGTTGTCTTGCCAGCGAGTTCATTTCACCAGGTGGTTATACCAGGCAAAGTTATGGCGACAGGCATTCTCACTA
TCCGGGGGTGCTTTGTACAAGCACCTGGTGGTATCACTCAAGAGTTCATACTGCCTCTCAATACAGCAGAGGAGG
AAGAGAGGATCACCAGGAGAAAGAGCGCACTCATATGCGAGGCTGAACGTTACAAGTATTGGGGTTTGGAATCAC
TTCCATGGGAAAAACCGAAGAGGTCGATCAAATACCACTCCAGCCAGCTGAATCCCCGCACAAATTTACGTTTCC
TGGAATGTAAGGTGGTCCCTGAGCAACCGCTGTTAAGAATACGTAGAACATCGGTCAATCATGGAGCTTTGATGT
TATATGAGGGCGAGCGGTGAGTCTCTTTCTAGTGCTAGATATTGCATACTGAAAGGTAATGTAAGATCAACTCTA
CGCATAACGCTTGAGAATATATCGTTGTTACCCATAGACTTTGTGCATCTAGCGTTCGACGACTCCACTATTGAA
CCTGCTCAACAGGCGTTAGCGGAAGGGGCAATGTCCAGTTCAGATGTCTACGAGACTGAGCATAGCCTTATCAAT
CAGCCTGTTTTTACTTGGAACAAAAGTGAAGGTAGACTTATTCCTCCAGGACATACTCTGAGCCTGAGTATATCC
TGTTTCGGAAAATCGGGCTGGTGAGTGTCTCTCTTCCCCTCAGCTTCATTACTGATAAGCTTGTCAATAAGTACC
AATGGAAATGTTCACGTCTCTTACTCATACACACATCGTACCGACCTTGAAAAACCATCTGATTATTTTTATACT
CGGCAGCTGTCGCATCCTATCATGGTCACCGTCTATCCGATGCTCCAGTGCCAAAATATGGATTTAATCCCGTTT
CCCTCGTATATGGACTACATACAAACGCCATCAACGACCACGTATCATAATAATTTGGGTGTAGATGATGGAGCG
AGTTGGTGTTTATTCTCGGTCGAGGTACGCAATGTATATGGGTCACCATTCGAAGTAACATTTGAGCGCGAGCAA
TACGGTGCGTCAACCTGGAAGTTCCTGAAAAGATAAACTTGACATATAGACCAGGGACATCACATTCATCTACTA
CGACCACCATACCGCCTGGGTCTACATCAAGGTCTGTAAAACATCGCTAACATTTCTTTAATCTAAACATTGATG
ACGGCATATAGGGTGGTTTTGCCATTGAGGAGGACAGCACTGTCTCAAGAGGATACCTCAAAAGCGATACCGACT
CTATCGGATCGGCAATTTGTGGTGGCTAAAGACAAGCTGTCTACTGCTGAGCTCCACCTGCAGAGGGAATTATTC
TGGTATAGAGAAGCTTTGTTCAAAAGCATTCAGGGTTACTGGAAAGAGGTTCGCTCTCTTCAGTCTGTCTTGTTG
ACCAGTGAACTGACTGAAATTGCAGGTTGGAGGCACTCGCACAGGTGAAATGTCACTCCGTCAGCAGCGTATGAC
ATTACCTATGCTGGAGGCCTTTAAATCCAATGTAGCACGGGTAGACCTATCGCTGATATCTTGTGATCTACCTAA
AGAGAATACGATCGATGGGAGGCGCGTCTGGAAGGCGAATGAATTCTTGAAGCTAAAAGTACGAATAACCAACCT
GTCTTGTGAGTTGGTCCTTGATCTGGACACCGGAAGTTACCCACGAATAAATTCTCCAGCATTTGCAATACCCCT
CAGTCTGACTCTTGACCTTGAACCAAGTGACTGTTTGATTTACGAGGGTGTCATCGCCGATATTCCTATTGGGCG
CTTGGATGAGGGGATGACACGAGAGATTGAGTTTCCCATCTGCTTCCTCACGAATGGCCATTTCGAACTCGTAGC
ACAAGTCCGGGCTGTAGGGTTTGATATCAAACCTGCCAAAGCAGAGATCATCGCGGCTGTCCGCAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail