Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|057020
Gene name
Locationscaffold_03a:1100537..1104292
Strand+
Gene length (bp)3755
Transcript length (bp)3492
Coding sequence length (bp)3492
Protein length (aa) 1164

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 1.5E-67 900 1159
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 3.1E-47 901 1155
PF14847 Ras_bdg_2 Ras-binding domain of Byr2 3.7E-16 448 558
PF07647 SAM_2 SAM domain (Sterile alpha motif) 5.0E-13 77 140
PF00536 SAM_1 SAM domain (Sterile alpha motif) 1.8E-12 78 140

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 889 1160 6.0E-107
sp|A7A1P0|STE11_YEAS7 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain YJM789) GN=STE11 PE=3 SV=1 753 1159 9.0E-96
sp|P23561|STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE11 PE=1 SV=3 753 1159 4.0E-95
sp|B5VNQ3|STE11_YEAS6 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=STE11 PE=3 SV=2 753 1159 3.0E-94
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 896 1163 4.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 889 1160 6.0E-107
sp|A7A1P0|STE11_YEAS7 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain YJM789) GN=STE11 PE=3 SV=1 753 1159 9.0E-96
sp|P23561|STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE11 PE=1 SV=3 753 1159 4.0E-95
sp|B5VNQ3|STE11_YEAS6 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=STE11 PE=3 SV=2 753 1159 3.0E-94
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 896 1163 4.0E-83
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 897 1163 5.0E-80
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 894 1163 2.0E-76
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 896 1160 1.0E-75
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 896 1159 4.0E-74
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 887 1161 3.0E-73
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 897 1161 9.0E-71
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 897 1161 2.0E-70
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 897 1161 7.0E-70
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 897 1161 5.0E-67
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 890 1161 7.0E-66
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 897 1161 4.0E-65
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 895 1159 6.0E-60
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 895 1159 1.0E-59
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 885 1161 2.0E-59
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 897 1162 6.0E-59
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 895 1159 9.0E-59
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 897 1162 3.0E-58
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 897 1162 2.0E-57
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 898 1162 2.0E-56
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 900 1159 2.0E-54
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 880 1159 3.0E-54
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 880 1159 8.0E-54
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 900 1160 3.0E-53
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus GN=Map3k1 PE=1 SV=1 878 1158 5.0E-53
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 878 1158 8.0E-53
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 878 1158 9.0E-53
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 885 1162 3.0E-52
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 893 1158 4.0E-52
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 889 1162 1.0E-49
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 867 1162 2.0E-47
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 897 1160 2.0E-46
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 903 1161 3.0E-46
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 872 1162 3.0E-46
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 902 1161 1.0E-45
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 902 1161 5.0E-45
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 903 1162 1.0E-44
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 903 1162 1.0E-44
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 902 1161 1.0E-44
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 897 1161 1.0E-44
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 897 1162 3.0E-44
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 903 1162 3.0E-44
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 903 1163 5.0E-44
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 896 1159 1.0E-43
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 879 1161 6.0E-43
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 858 1161 6.0E-43
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 901 1161 7.0E-43
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 868 1159 1.0E-42
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 903 1162 1.0E-42
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 879 1161 1.0E-42
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 902 1162 1.0E-42
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 903 1159 3.0E-42
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 903 1159 4.0E-42
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 904 1163 4.0E-42
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 904 1163 6.0E-42
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 903 1162 1.0E-41
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 903 1162 1.0E-41
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 903 1159 2.0E-40
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 903 1161 2.0E-40
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 896 1161 2.0E-40
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 896 1161 2.0E-40
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 896 1161 2.0E-40
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 894 1159 3.0E-40
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 896 1161 3.0E-40
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 896 1161 4.0E-40
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 896 1161 4.0E-40
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 903 1162 4.0E-40
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 896 1161 4.0E-40
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 896 1161 5.0E-40
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 896 1161 6.0E-40
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 895 1161 6.0E-40
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 896 1161 6.0E-40
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 896 1161 6.0E-40
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 896 1161 6.0E-40
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 903 1159 7.0E-40
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 903 1159 2.0E-39
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 894 1159 2.0E-39
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 903 1162 3.0E-39
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 903 1159 3.0E-39
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 894 1154 4.0E-39
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 903 1159 5.0E-39
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 896 1159 1.0E-38
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 903 1162 2.0E-38
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 904 1161 3.0E-38
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 897 1160 4.0E-38
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 903 1159 5.0E-38
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 903 1162 6.0E-38
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 903 1162 6.0E-38
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 903 1161 7.0E-38
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 903 1161 8.0E-38
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 903 1159 8.0E-38
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 897 1159 9.0E-38
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 903 1161 9.0E-38
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 903 1159 9.0E-38
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 903 1159 9.0E-38
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 897 1159 1.0E-37
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 897 1159 1.0E-37
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 897 1162 1.0E-37
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 897 1160 1.0E-37
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 903 1159 1.0E-37
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 903 1161 1.0E-37
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 903 1161 1.0E-37
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 883 1159 1.0E-37
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 896 1159 2.0E-37
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 903 1159 2.0E-37
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 897 1160 2.0E-37
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 866 1159 3.0E-37
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 903 1161 3.0E-37
sp|P48562|CLA4_YEAST Serine/threonine-protein kinase CLA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLA4 PE=1 SV=1 920 1159 3.0E-37
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 903 1161 3.0E-37
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 897 1160 3.0E-37
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 896 1159 3.0E-37
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 897 1160 3.0E-37
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 896 1159 3.0E-37
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 903 1161 3.0E-37
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 903 1161 4.0E-37
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 903 1161 4.0E-37
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 903 1161 4.0E-37
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 903 1161 4.0E-37
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 903 1161 5.0E-37
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 903 1162 5.0E-37
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 894 1159 5.0E-37
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 903 1161 5.0E-37
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 903 1161 6.0E-37
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 903 1161 6.0E-37
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 903 1159 6.0E-37
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 903 1161 6.0E-37
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 903 1159 8.0E-37
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 903 1159 1.0E-36
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 900 1162 1.0E-36
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 903 1161 1.0E-36
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 903 1162 1.0E-36
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 903 1160 1.0E-36
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 893 1157 2.0E-36
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 903 1161 3.0E-36
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 892 1160 3.0E-36
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 902 1159 4.0E-36
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 903 1162 4.0E-36
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 903 1161 1.0E-35
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 903 1159 2.0E-35
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 897 1159 3.0E-35
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 902 1161 3.0E-35
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 900 1162 6.0E-35
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 903 1159 6.0E-35
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 903 1159 8.0E-35
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 897 1160 9.0E-35
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 885 1159 9.0E-35
sp|Q9R011|PLK3_RAT Serine/threonine-protein kinase PLK3 OS=Rattus norvegicus GN=Plk3 PE=1 SV=2 874 1159 9.0E-35
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 903 1162 1.0E-34
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 895 1162 1.0E-34
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 897 1160 1.0E-34
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 903 1160 1.0E-34
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 888 1162 1.0E-34
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 897 1160 2.0E-34
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 903 1160 2.0E-34
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 897 1157 2.0E-34
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 902 1159 3.0E-34
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 903 1160 3.0E-34
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 902 1159 3.0E-34
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 903 1161 3.0E-34
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 903 1157 3.0E-34
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 903 1161 5.0E-34
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 903 1160 5.0E-34
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 903 1161 5.0E-34
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 903 1157 5.0E-34
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 903 1159 7.0E-34
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 903 1160 7.0E-34
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 903 1159 8.0E-34
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 903 1163 9.0E-34
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 903 1160 1.0E-33
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 897 1159 1.0E-33
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 901 1148 1.0E-33
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 896 1161 2.0E-33
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 902 1163 2.0E-33
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 903 1159 2.0E-33
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 902 1159 3.0E-33
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 902 1162 3.0E-33
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 902 1159 3.0E-33
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 903 1159 3.0E-33
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 902 1159 4.0E-33
sp|A8X775|DLK1_CAEBR Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis briggsae GN=dlk-1 PE=3 SV=1 903 1157 5.0E-33
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 903 1161 6.0E-33
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 884 1151 6.0E-33
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 878 1159 8.0E-33
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 902 1159 8.0E-33
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 902 1159 1.0E-32
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 878 1159 1.0E-32
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 897 1159 1.0E-32
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 902 1159 2.0E-32
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 902 1162 2.0E-32
sp|Q8C0V7|SMKW_MOUSE Putative sperm motility kinase W OS=Mus musculus GN=Stk-ps2 PE=5 SV=2 903 1162 2.0E-32
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 901 1161 3.0E-32
sp|Q12469|SKM1_YEAST Serine/threonine-protein kinase SKM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKM1 PE=1 SV=1 920 1159 4.0E-32
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 878 1159 4.0E-32
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 902 1159 4.0E-32
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 897 1163 4.0E-32
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 900 1159 5.0E-32
sp|Q54C77|Y3184_DICDI Probable inactive serine/threonine-protein kinase DDB_G0293184 OS=Dictyostelium discoideum GN=DDB_G0293184 PE=3 SV=1 906 1159 6.0E-32
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 902 1159 9.0E-32
sp|O01700|DLK1_CAEEL Mitogen-activated protein kinase kinase kinase dlk-1 OS=Caenorhabditis elegans GN=dlk-1 PE=1 SV=4 903 1157 1.0E-31
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 903 1105 1.0E-31
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 903 1162 1.0E-31
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 902 1159 1.0E-31
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 889 1154 1.0E-31
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 903 1156 1.0E-31
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 884 1159 1.0E-31
sp|Q6NW76|AURKB_DANRE Aurora kinase B OS=Danio rerio GN=aurkb PE=2 SV=1 888 1161 2.0E-31
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 864 1159 2.0E-31
sp|Q59S66|IPL1_CANAL Spindle assembly checkpoint kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=IPL1 PE=3 SV=1 900 1157 2.0E-31
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 900 1159 2.0E-31
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 903 1159 3.0E-31
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 902 1159 3.0E-31
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 900 1159 3.0E-31
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 900 1105 4.0E-31
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 894 1159 4.0E-31
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 903 1159 4.0E-31
sp|Q61XD3|AIR2_CAEBR Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis briggsae GN=air-2 PE=3 SV=1 882 1157 5.0E-31
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 902 1159 5.0E-31
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 903 1161 6.0E-31
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 902 1159 6.0E-31
sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 888 1159 6.0E-31
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 895 1162 6.0E-31
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 878 1161 7.0E-31
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 902 1163 7.0E-31
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 903 1105 7.0E-31
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 902 1159 8.0E-31
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 885 1157 1.0E-30
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 891 1161 1.0E-30
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 903 1159 1.0E-30
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 902 1162 1.0E-30
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 902 1162 2.0E-30
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 874 1159 2.0E-30
sp|Q64702|PLK4_MOUSE Serine/threonine-protein kinase PLK4 OS=Mus musculus GN=Plk4 PE=1 SV=2 900 1162 2.0E-30
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 897 1159 2.0E-30
sp|O01427|AIR2_CAEEL Aurora/IPL1-related protein kinase 2 OS=Caenorhabditis elegans GN=air-2 PE=1 SV=2 900 1161 2.0E-30
sp|Q55DD4|PAKD_DICDI Serine/threonine-protein kinase pakD OS=Dictyostelium discoideum GN=pakD PE=3 SV=1 902 1162 2.0E-30
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 903 1161 2.0E-30
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 902 1159 3.0E-30
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 903 1105 3.0E-30
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 819 1105 3.0E-30
sp|B2GUY1|PLK4_RAT Serine/threonine-protein kinase PLK4 OS=Rattus norvegicus GN=Plk4 PE=2 SV=1 900 1162 3.0E-30
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 874 1159 3.0E-30
sp|Q07832|PLK1_MOUSE Serine/threonine-protein kinase PLK1 OS=Mus musculus GN=Plk1 PE=1 SV=2 883 1159 4.0E-30
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 886 1159 4.0E-30
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 896 1163 4.0E-30
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 895 1162 4.0E-30
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 901 1154 4.0E-30
sp|F4I1N8|ATG1T_ARATH Serine/threonine-protein kinase ATG1t OS=Arabidopsis thaliana GN=At1g49180 PE=2 SV=1 942 1120 5.0E-30
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 902 1162 5.0E-30
sp|Q90336|MK14A_CYPCA Mitogen-activated protein kinase 14A OS=Cyprinus carpio GN=mapk14a PE=1 SV=1 903 1161 5.0E-30
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 903 1156 5.0E-30
sp|Q86SG6|NEK8_HUMAN Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 896 1162 6.0E-30
sp|Q91ZR4|NEK8_MOUSE Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 896 1162 7.0E-30
sp|Q9DGE2|MK14A_DANRE Mitogen-activated protein kinase 14A OS=Danio rerio GN=mapk14a PE=1 SV=1 903 1161 8.0E-30
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 903 1159 8.0E-30
sp|Q54TN4|MKCE_DICDI Probable serine/threonine-protein kinase mkcE OS=Dictyostelium discoideum GN=mkcE PE=3 SV=1 906 1159 8.0E-30
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 897 1159 9.0E-30
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 900 1161 1.0E-29
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 902 1163 1.0E-29
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 902 1161 1.0E-29
sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 902 1159 1.0E-29
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 866 1161 1.0E-29
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 896 1162 1.0E-29
sp|Q8S8Y8|WNK6_ARATH Probable serine/threonine-protein kinase WNK6 OS=Arabidopsis thaliana GN=WNK6 PE=2 SV=1 902 1161 1.0E-29
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 903 1161 1.0E-29
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 937 1162 1.0E-29
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 903 1159 2.0E-29
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 894 1159 2.0E-29
sp|P34103|PK4_DICDI Protein kinase 4 (Fragment) OS=Dictyostelium discoideum GN=pkgD PE=3 SV=2 902 1159 2.0E-29
sp|A2VDZ4|PLK4_BOVIN Serine/threonine-protein kinase PLK4 OS=Bos taurus GN=PLK4 PE=2 SV=1 900 1162 2.0E-29
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 902 1159 2.0E-29
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 902 1159 2.0E-29
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 894 1163 2.0E-29
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 894 1159 2.0E-29
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 902 1159 2.0E-29
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 903 1161 3.0E-29
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 894 1161 3.0E-29
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 897 1161 3.0E-29
sp|O88445|AURKC_MOUSE Aurora kinase C OS=Mus musculus GN=Aurkc PE=1 SV=1 895 1161 3.0E-29
sp|Q05609|CTR1_ARATH Serine/threonine-protein kinase CTR1 OS=Arabidopsis thaliana GN=CTR1 PE=1 SV=1 877 1150 3.0E-29
sp|O00444|PLK4_HUMAN Serine/threonine-protein kinase PLK4 OS=Homo sapiens GN=PLK4 PE=1 SV=3 900 1162 3.0E-29
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 896 1163 3.0E-29
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 903 1156 3.0E-29
sp|Q55FT4|TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum GN=tsuA PE=1 SV=1 903 1161 4.0E-29
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 895 1162 4.0E-29
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 903 1159 4.0E-29
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 902 1105 4.0E-29
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 896 1162 6.0E-29
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 903 1161 6.0E-29
sp|P06784|STE7_YEAST Serine/threonine-protein kinase STE7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE7 PE=1 SV=1 903 1162 7.0E-29
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 902 1141 7.0E-29
sp|Q551H4|FRAY2_DICDI Serine/threonine-protein kinase fray2 OS=Dictyostelium discoideum GN=fray2 PE=3 SV=1 903 1162 7.0E-29
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 902 1161 8.0E-29
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 896 1162 9.0E-29
sp|Q5RJI5|BRSK1_MOUSE Serine/threonine-protein kinase BRSK1 OS=Mus musculus GN=Brsk1 PE=1 SV=1 903 1159 9.0E-29
sp|A7J1T0|M313B_XENLA Mitogen-activated protein kinase kinase kinase 13-B OS=Xenopus laevis GN=map3k13-b PE=2 SV=1 903 1121 9.0E-29
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 903 1132 9.0E-29
sp|B2DD29|BRSK1_RAT Serine/threonine-protein kinase BRSK1 OS=Rattus norvegicus GN=Brsk1 PE=1 SV=1 903 1159 9.0E-29
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 903 1132 1.0E-28
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 900 1159 1.0E-28
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 896 1159 1.0E-28
sp|Q8LST2|WNK7_ARATH Probable serine/threonine-protein kinase WNK7 OS=Arabidopsis thaliana GN=WNK7 PE=2 SV=1 902 1159 1.0E-28
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 894 1159 1.0E-28
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 902 1163 1.0E-28
sp|Q9N2L7|PLK2_CAEEL Serine/threonine-protein kinase plk-2 OS=Caenorhabditis elegans GN=plk-2 PE=2 SV=1 883 1105 1.0E-28
sp|Q62673|PLK1_RAT Serine/threonine-protein kinase PLK1 OS=Rattus norvegicus GN=Plk1 PE=2 SV=2 883 1159 1.0E-28
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 903 1154 1.0E-28
sp|A7J1T2|M313A_XENLA Mitogen-activated protein kinase kinase kinase 13-A OS=Xenopus laevis GN=map3k13-a PE=2 SV=1 903 1121 1.0E-28
sp|Q8TDC3|BRSK1_HUMAN Serine/threonine-protein kinase BRSK1 OS=Homo sapiens GN=BRSK1 PE=1 SV=2 903 1159 2.0E-28
sp|Q86CS2|ATG1_DICDI Serine/threonine-protein kinase atg1 OS=Dictyostelium discoideum GN=atg1 PE=3 SV=1 897 1159 2.0E-28
sp|Q9NAH6|KS6B_CAEEL Ribosomal protein S6 kinase beta OS=Caenorhabditis elegans GN=rsks-1 PE=1 SV=2 902 1159 2.0E-28
sp|Q5R9Z7|PLK4_PONAB Serine/threonine-protein kinase PLK4 OS=Pongo abelii GN=PLK4 PE=2 SV=1 900 1159 2.0E-28
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 866 1161 2.0E-28
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 885 1159 2.0E-28
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 902 1159 2.0E-28
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 902 1159 2.0E-28
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 903 1132 2.0E-28
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 903 1154 2.0E-28
sp|Q1HKZ5|M3K13_MOUSE Mitogen-activated protein kinase kinase kinase 13 OS=Mus musculus GN=Map3k13 PE=1 SV=1 903 1121 2.0E-28
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 900 1161 2.0E-28
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 902 1141 3.0E-28
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 902 1154 3.0E-28
sp|X5M5N0|WNK_CAEEL Serine/threonine-protein kinase WNK OS=Caenorhabditis elegans GN=wnk-1 PE=1 SV=1 877 1148 3.0E-28
sp|Q6ICW6|WNK11_ARATH Probable serine/threonine-protein kinase WNK11 OS=Arabidopsis thaliana GN=WNK11 PE=2 SV=1 880 1159 3.0E-28
sp|Q54UZ1|Y1639_DICDI Probable serine/threonine-protein kinase DDB_G0280717 OS=Dictyostelium discoideum GN=DDB_G0280717 PE=3 SV=1 903 1159 3.0E-28
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 897 1162 3.0E-28
sp|Q7ZVS3|PLK4_DANRE Serine/threonine-protein kinase PLK4 OS=Danio rerio GN=plk4 PE=2 SV=2 887 1159 3.0E-28
sp|Q8K1R7|NEK9_MOUSE Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 902 1146 3.0E-28
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 900 1161 3.0E-28
sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 896 1162 4.0E-28
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 898 1162 4.0E-28
sp|P67998|KS6B1_RABIT Ribosomal protein S6 kinase beta-1 OS=Oryctolagus cuniculus GN=RPS6KB1 PE=2 SV=1 902 1159 4.0E-28
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 902 1162 4.0E-28
sp|P67999|KS6B1_RAT Ribosomal protein S6 kinase beta-1 OS=Rattus norvegicus GN=Rps6kb1 PE=1 SV=1 902 1159 4.0E-28
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 896 1163 4.0E-28
sp|A7MBB4|M3K13_BOVIN Mitogen-activated protein kinase kinase kinase 13 OS=Bos taurus GN=MAP3K13 PE=2 SV=1 903 1121 5.0E-28
sp|P23443|KS6B1_HUMAN Ribosomal protein S6 kinase beta-1 OS=Homo sapiens GN=RPS6KB1 PE=1 SV=2 902 1159 5.0E-28
sp|A7SNN5|PLK4_NEMVE Serine/threonine-protein kinase PLK4 OS=Nematostella vectensis GN=v1g246408 PE=3 SV=1 902 1159 5.0E-28
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 903 1121 5.0E-28
sp|O43283|M3K13_HUMAN Mitogen-activated protein kinase kinase kinase 13 OS=Homo sapiens GN=MAP3K13 PE=1 SV=1 903 1121 5.0E-28
sp|Q6TJY3|KS6B1_BOVIN Ribosomal protein S6 kinase beta-1 OS=Bos taurus GN=RPS6KB1 PE=2 SV=1 902 1159 5.0E-28
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 903 1159 5.0E-28
sp|Q9I958|MK14B_CYPCA Mitogen-activated protein kinase 14B OS=Cyprinus carpio GN=mapk14b PE=1 SV=1 903 1161 5.0E-28
sp|Q944Q0|WNK8_ARATH Serine/threonine-protein kinase WNK8 OS=Arabidopsis thaliana GN=WNK8 PE=1 SV=1 902 1162 6.0E-28
sp|Q8BSK8|KS6B1_MOUSE Ribosomal protein S6 kinase beta-1 OS=Mus musculus GN=Rps6kb1 PE=1 SV=2 902 1159 6.0E-28
sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 896 1162 7.0E-28
sp|Q08942|NRKA_TRYBB Putative serine/threonine-protein kinase A OS=Trypanosoma brucei brucei GN=NRKA PE=2 SV=1 896 1162 7.0E-28
sp|P53350|PLK1_HUMAN Serine/threonine-protein kinase PLK1 OS=Homo sapiens GN=PLK1 PE=1 SV=1 902 1159 7.0E-28
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 894 1162 7.0E-28
sp|O55099|AURKB_RAT Aurora kinase B OS=Rattus norvegicus GN=Aurkb PE=1 SV=1 903 1161 8.0E-28
sp|B0WAU8|PLK4_CULQU Serine/threonine-protein kinase PLK4 OS=Culex quinquefasciatus GN=SAK PE=3 SV=1 902 1162 8.0E-28
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 902 1161 8.0E-28
sp|F4JY37|RUK_ARATH Serine/threonine-protein kinase RUNKEL OS=Arabidopsis thaliana GN=RUK PE=1 SV=1 903 1163 9.0E-28
sp|P16912|KDC2_DROME Protein kinase DC2 OS=Drosophila melanogaster GN=Pka-C3 PE=2 SV=2 903 1161 9.0E-28
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 900 1162 1.0E-27
sp|Q14004|CDK13_HUMAN Cyclin-dependent kinase 13 OS=Homo sapiens GN=CDK13 PE=1 SV=2 885 1129 1.0E-27
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 897 1159 1.0E-27
sp|Q2TA25|PLK1_BOVIN Serine/threonine-protein kinase PLK1 OS=Bos taurus GN=PLK1 PE=2 SV=2 902 1159 1.0E-27
sp|P36887|KAPCA_PIG cAMP-dependent protein kinase catalytic subunit alpha OS=Sus scrofa GN=PRKACA PE=1 SV=4 903 1148 1.0E-27
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 885 1162 1.0E-27
sp|O02812|MK14_CANLF Mitogen-activated protein kinase 14 OS=Canis lupus familiaris GN=MAPK14 PE=2 SV=3 903 1161 1.0E-27
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 903 1161 1.0E-27
sp|Q5R8X7|M3K13_PONAB Mitogen-activated protein kinase kinase kinase 13 OS=Pongo abelii GN=MAP3K13 PE=2 SV=1 903 1121 1.0E-27
sp|Q16539|MK14_HUMAN Mitogen-activated protein kinase 14 OS=Homo sapiens GN=MAPK14 PE=1 SV=3 903 1161 1.0E-27
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 903 1121 1.0E-27
sp|Q9TXJ0|CMK1_CAEEL Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis elegans GN=cmk-1 PE=1 SV=1 902 1159 2.0E-27
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 903 1121 2.0E-27
sp|O01775|NEKL2_CAEEL Serine/threonine-protein kinase nekl-2 OS=Caenorhabditis elegans GN=nekl-2 PE=2 SV=1 895 1160 2.0E-27
sp|A8X6H4|CMK1_CAEBR Calcium/calmodulin-dependent protein kinase type 1 OS=Caenorhabditis briggsae GN=cmk-1 PE=3 SV=3 890 1159 2.0E-27
sp|Q54MV2|MRKB_DICDI Probable serine/threonine-protein kinase MARK-B OS=Dictyostelium discoideum GN=mrkB PE=3 SV=1 893 1162 2.0E-27
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 902 1161 2.0E-27
sp|Q69ZA1|CDK13_MOUSE Cyclin-dependent kinase 13 OS=Mus musculus GN=Cdk13 PE=1 SV=3 885 1129 2.0E-27
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 900 1159 2.0E-27
sp|Q12236|PKH2_YEAST Serine/threonine-protein kinase PKH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH2 PE=1 SV=1 900 1159 2.0E-27
sp|Q8MJ44|KAPCA_CANLF cAMP-dependent protein kinase catalytic subunit alpha OS=Canis lupus familiaris GN=PRKACA PE=1 SV=3 903 1148 2.0E-27
sp|P22612|KAPCG_HUMAN cAMP-dependent protein kinase catalytic subunit gamma OS=Homo sapiens GN=PRKACG PE=1 SV=3 889 1148 2.0E-27
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 900 1146 3.0E-27
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 898 1163 3.0E-27
sp|Q6A1A2|PDPK2_HUMAN Putative 3-phosphoinositide-dependent protein kinase 2 OS=Homo sapiens GN=PDPK2P PE=5 SV=1 900 1161 3.0E-27
sp|Q8SSV3|MKCD_DICDI Probable serine/threonine-protein kinase mkcD OS=Dictyostelium discoideum GN=mkcD PE=3 SV=1 906 1162 3.0E-27
sp|O55173|PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus GN=Pdpk1 PE=1 SV=2 900 1161 3.0E-27
sp|Q9DGE1|MK14B_DANRE Mitogen-activated protein kinase 14B OS=Danio rerio GN=mapk14b PE=1 SV=1 903 1161 3.0E-27
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 896 1139 3.0E-27
sp|E1BB52|CDK13_BOVIN Cyclin-dependent kinase 13 OS=Bos taurus GN=CDK13 PE=3 SV=1 885 1129 3.0E-27
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 903 1159 4.0E-27
sp|Q54TM7|DRKD_DICDI Probable serine/threonine-protein kinase drkD OS=Dictyostelium discoideum GN=drkD PE=2 SV=1 900 1154 4.0E-27
sp|P51955|NEK2_HUMAN Serine/threonine-protein kinase Nek2 OS=Homo sapiens GN=NEK2 PE=1 SV=1 903 1159 4.0E-27
sp|Q9SCU5|WNK5_ARATH Probable serine/threonine-protein kinase WNK5 OS=Arabidopsis thaliana GN=WNK5 PE=1 SV=2 882 1122 4.0E-27
sp|Q9MZD9|KAPCA_SHEEP cAMP-dependent protein kinase catalytic subunit alpha OS=Ovis aries GN=PRKACA PE=1 SV=3 903 1148 5.0E-27
sp|P27791|KAPCA_RAT cAMP-dependent protein kinase catalytic subunit alpha OS=Rattus norvegicus GN=Prkaca PE=1 SV=2 903 1148 5.0E-27
sp|P54666|CC2H3_TRYBB Cell division control protein 2 homolog 3 OS=Trypanosoma brucei brucei GN=CRK3 PE=3 SV=1 902 1159 5.0E-27
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 895 1162 5.0E-27
sp|P00517|KAPCA_BOVIN cAMP-dependent protein kinase catalytic subunit alpha OS=Bos taurus GN=PRKACA PE=1 SV=3 903 1148 5.0E-27
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 902 1162 5.0E-27
sp|Q6EU49|WNK4_ORYSJ Probable serine/threonine-protein kinase WNK4 OS=Oryza sativa subsp. japonica GN=WNK4 PE=2 SV=1 902 1159 5.0E-27
sp|Q14AX6|CDK12_MOUSE Cyclin-dependent kinase 12 OS=Mus musculus GN=Cdk12 PE=1 SV=2 901 1159 6.0E-27
sp|P22694|KAPCB_HUMAN cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens GN=PRKACB PE=1 SV=2 882 1148 6.0E-27
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 868 1159 6.0E-27
sp|P17612|KAPCA_HUMAN cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens GN=PRKACA PE=1 SV=2 903 1148 6.0E-27
sp|P25321|KAPCA_CRIGR cAMP-dependent protein kinase catalytic subunit alpha OS=Cricetulus griseus GN=PRKACA PE=1 SV=2 903 1148 6.0E-27
sp|Q2QAV0|TIO_ARATH Serine/threonine-protein kinase TIO OS=Arabidopsis thaliana GN=TIO PE=1 SV=1 902 1161 6.0E-27
sp|Q9Z2A0|PDPK1_MOUSE 3-phosphoinositide-dependent protein kinase 1 OS=Mus musculus GN=Pdpk1 PE=1 SV=2 900 1161 7.0E-27
sp|P68182|KAPCB_RAT cAMP-dependent protein kinase catalytic subunit beta OS=Rattus norvegicus GN=Prkacb PE=1 SV=2 903 1148 7.0E-27
sp|P68181|KAPCB_MOUSE cAMP-dependent protein kinase catalytic subunit beta OS=Mus musculus GN=Prkacb PE=1 SV=2 903 1148 7.0E-27
sp|P68180|KAPCB_CRIGR cAMP-dependent protein kinase catalytic subunit beta OS=Cricetulus griseus GN=PRKACB PE=2 SV=2 903 1148 7.0E-27
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 902 1162 7.0E-27
sp|Q54H45|DRKB_DICDI Probable serine/threonine-protein kinase drkB OS=Dictyostelium discoideum GN=drkB PE=3 SV=1 900 1126 8.0E-27
sp|P47812|MK14_XENLA Mitogen-activated protein kinase 14 OS=Xenopus laevis GN=mapk14 PE=2 SV=1 903 1161 8.0E-27
sp|O61661|CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster GN=grp PE=1 SV=2 897 1107 8.0E-27
sp|Q6FV07|IPL1_CANGA Spindle assembly checkpoint kinase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IPL1 PE=3 SV=1 882 1159 8.0E-27
sp|P05131|KAPCB_BOVIN cAMP-dependent protein kinase catalytic subunit beta OS=Bos taurus GN=PRKACB PE=1 SV=2 903 1148 9.0E-27
sp|Q8S8Y9|WNK2_ARATH Serine/threonine-protein kinase WNK2 OS=Arabidopsis thaliana GN=WNK2 PE=1 SV=1 877 1161 1.0E-26
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 902 1162 1.0E-26
sp|D2H526|CDK12_AILME Cyclin-dependent kinase 12 OS=Ailuropoda melanoleuca GN=CDK12 PE=3 SV=1 901 1159 1.0E-26
sp|Q9NYV4|CDK12_HUMAN Cyclin-dependent kinase 12 OS=Homo sapiens GN=CDK12 PE=1 SV=2 901 1159 1.0E-26
sp|P05383|KAPCB_PIG cAMP-dependent protein kinase catalytic subunit beta OS=Sus scrofa GN=PRKACB PE=1 SV=3 903 1148 1.0E-26
sp|Q3MJK5|CDK12_RAT Cyclin-dependent kinase 12 OS=Rattus norvegicus GN=Cdk12 PE=1 SV=1 901 1159 1.0E-26
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 903 1163 1.0E-26
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 859 1157 1.0E-26
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 869 1161 1.0E-26
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 903 1156 1.0E-26
sp|P47811|MK14_MOUSE Mitogen-activated protein kinase 14 OS=Mus musculus GN=Mapk14 PE=1 SV=3 903 1161 1.0E-26
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 902 1159 1.0E-26
sp|P70618|MK14_RAT Mitogen-activated protein kinase 14 OS=Rattus norvegicus GN=Mapk14 PE=1 SV=3 903 1161 2.0E-26
sp|O15530|PDPK1_HUMAN 3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens GN=PDPK1 PE=1 SV=1 900 1161 2.0E-26
sp|O80396|M2K3_ARATH Mitogen-activated protein kinase kinase 3 OS=Arabidopsis thaliana GN=MKK3 PE=1 SV=1 903 1162 2.0E-26
sp|P22987|KIN1_SCHPO Protein kinase kin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kin1 PE=1 SV=3 897 1162 2.0E-26
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 902 1161 2.0E-26
sp|Q8IWQ3|BRSK2_HUMAN Serine/threonine-protein kinase BRSK2 OS=Homo sapiens GN=BRSK2 PE=1 SV=3 903 1157 2.0E-26
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 896 1162 2.0E-26
sp|B5DE93|CDK12_XENTR Cyclin-dependent kinase 12 OS=Xenopus tropicalis GN=cdk12 PE=2 SV=1 901 1129 2.0E-26
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 903 1149 2.0E-26
sp|Q39238|TSL_ARATH Serine/threonine-protein kinase TOUSLED OS=Arabidopsis thaliana GN=TOUSLED PE=1 SV=1 902 1159 2.0E-26
sp|P05132|KAPCA_MOUSE cAMP-dependent protein kinase catalytic subunit alpha OS=Mus musculus GN=Prkaca PE=1 SV=3 882 1148 3.0E-26
sp|Q95NE7|MK14_PANTR Mitogen-activated protein kinase 14 OS=Pan troglodytes GN=MAPK14 PE=2 SV=3 903 1161 3.0E-26
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 902 1161 3.0E-26
sp|Q5A3P6|PKH2_CANAL Serine/threonine-protein kinase PKH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PKH2 PE=1 SV=1 863 1161 3.0E-26
sp|D3ZML2|BRSK2_RAT Serine/threonine-protein kinase BRSK2 OS=Rattus norvegicus GN=Brsk2 PE=1 SV=1 903 1157 4.0E-26
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 897 1162 4.0E-26
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 903 1163 4.0E-26
sp|O35942|NEK2_MOUSE Serine/threonine-protein kinase Nek2 OS=Mus musculus GN=Nek2 PE=1 SV=2 903 1159 4.0E-26
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 902 1154 4.0E-26
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 903 1163 4.0E-26
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 884 1162 4.0E-26
sp|E1BB50|CDK12_BOVIN Cyclin-dependent kinase 12 OS=Bos taurus GN=CDK12 PE=3 SV=1 901 1129 4.0E-26
sp|P87050|CDR2_SCHPO Mitosis inducer protein kinase cdr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdr2 PE=1 SV=1 888 1159 4.0E-26
sp|P70032|PLK1_XENLA Serine/threonine-protein kinase PLK1 OS=Xenopus laevis GN=plk1 PE=1 SV=1 902 1159 4.0E-26
sp|Q8GVC7|PKZ1_PHYIN Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans GN=PKZ1 PE=1 SV=1 890 1159 4.0E-26
sp|D0N4E2|PKZ1_PHYIT Serine/threonine-protein kinase PKZ1 OS=Phytophthora infestans (strain T30-4) GN=PKZ1 PE=3 SV=1 890 1159 5.0E-26
sp|Q95KR7|LCK_SAISC Proto-oncogene tyrosine-protein kinase LCK OS=Saimiri sciureus GN=LCK PE=1 SV=3 903 1154 5.0E-26
sp|Q16W24|PLK4_AEDAE Serine/threonine-protein kinase PLK4 OS=Aedes aegypti GN=SAK PE=3 SV=1 902 1162 5.0E-26
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 902 1159 5.0E-26
sp|Q6PAD2|PLK4_XENLA Serine/threonine-protein kinase PLK4 OS=Xenopus laevis GN=plk4 PE=2 SV=1 902 1159 5.0E-26
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 903 1163 5.0E-26
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 903 1154 5.0E-26
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 888 1162 6.0E-26
sp|Q69Z98|BRSK2_MOUSE Serine/threonine-protein kinase BRSK2 OS=Mus musculus GN=Brsk2 PE=1 SV=2 903 1157 6.0E-26
sp|A6QGC0|PRKC_STAAE Serine/threonine-protein kinase PrkC OS=Staphylococcus aureus (strain Newman) GN=prkC PE=1 SV=1 903 1129 6.0E-26
sp|Q96L34|MARK4_HUMAN MAP/microtubule affinity-regulating kinase 4 OS=Homo sapiens GN=MARK4 PE=1 SV=1 903 1105 7.0E-26
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 900 1159 7.0E-26
sp|Q03957|CTK1_YEAST CTD kinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTK1 PE=1 SV=1 884 1117 7.0E-26
sp|P12370|KAPC_DROME cAMP-dependent protein kinase catalytic subunit OS=Drosophila melanogaster GN=Pka-C1 PE=1 SV=3 903 1148 7.0E-26
sp|G5EEN4|GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans GN=gck-3 PE=1 SV=1 903 1162 7.0E-26
sp|Q9CAU7|NEK2_ARATH Serine/threonine-protein kinase Nek2 OS=Arabidopsis thaliana GN=NEK2 PE=2 SV=1 903 1161 7.0E-26
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 902 1159 8.0E-26
sp|Q9TW45|PAR1_CAEEL Serine/threonine-protein kinase par-1 OS=Caenorhabditis elegans GN=par-1 PE=1 SV=1 903 1105 8.0E-26
sp|Q07174|M3K8_MOUSE Mitogen-activated protein kinase kinase kinase 8 OS=Mus musculus GN=Map3k8 PE=1 SV=1 898 1157 8.0E-26
sp|P18106|FPS_DROME Tyrosine-protein kinase Fps85D OS=Drosophila melanogaster GN=Fps85D PE=2 SV=3 903 1154 8.0E-26
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 895 1162 8.0E-26
sp|Q9LPQ3|M2K7_ARATH Mitogen-activated protein kinase kinase 7 OS=Arabidopsis thaliana GN=MKK7 PE=1 SV=1 902 1161 8.0E-26
sp|Q8CIP4|MARK4_MOUSE MAP/microtubule affinity-regulating kinase 4 OS=Mus musculus GN=Mark4 PE=1 SV=1 903 1105 8.0E-26
sp|Q12701|KSG1_SCHPO Serine/threonine-protein kinase ksg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ksg1 PE=1 SV=2 900 1159 9.0E-26
sp|A8WYE4|PAR1_CAEBR Serine/threonine-protein kinase par-1 OS=Caenorhabditis briggsae GN=par-1 PE=3 SV=1 903 1105 9.0E-26
sp|Q03306|PKH3_YEAST Serine/threonine-protein kinase PKH3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKH3 PE=1 SV=1 903 1162 9.0E-26
sp|P06239|LCK_HUMAN Tyrosine-protein kinase Lck OS=Homo sapiens GN=LCK PE=1 SV=6 903 1141 9.0E-26
sp|B3DL84|PLK4_XENTR Serine/threonine-protein kinase PLK4 OS=Xenopus tropicalis GN=plk4 PE=2 SV=1 902 1159 9.0E-26
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 887 1162 1.0E-25
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 903 1161 1.0E-25
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 903 1159 1.0E-25
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 903 1160 1.0E-25
sp|P11837|NIMA_EMENI G2-specific protein kinase nimA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nimA PE=1 SV=1 903 1158 1.0E-25
sp|Q96NX5|KCC1G_HUMAN Calcium/calmodulin-dependent protein kinase type 1G OS=Homo sapiens GN=CAMK1G PE=1 SV=3 880 1159 1.0E-25
sp|Q91VB2|KCC1G_MOUSE Calcium/calmodulin-dependent protein kinase type 1G OS=Mus musculus GN=Camk1g PE=1 SV=1 880 1159 1.0E-25
sp|B3M6I4|PLK4_DROAN Serine/threonine-protein kinase PLK4 OS=Drosophila ananassae GN=SAK PE=3 SV=1 902 1163 1.0E-25
sp|Q03428|NRKB_TRYBB Putative serine/threonine-protein kinase B OS=Trypanosoma brucei brucei GN=NRKB PE=2 SV=2 896 1162 1.0E-25
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 887 1162 1.0E-25
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 900 1162 1.0E-25
sp|Q7TNJ7|KCC1G_RAT Calcium/calmodulin-dependent protein kinase type 1G OS=Rattus norvegicus GN=Camk1g PE=2 SV=1 880 1159 1.0E-25
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 903 1161 1.0E-25
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 903 1161 1.0E-25
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 903 1161 1.0E-25
sp|P38070|YPK3_YEAST AGC kinase YPK3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK3 PE=1 SV=1 902 1137 2.0E-25
sp|Q5PXS1|LCK_AOTNA Tyrosine-protein kinase Lck OS=Aotus nancymaae GN=LCK PE=2 SV=4 903 1137 2.0E-25
sp|P41279|M3K8_HUMAN Mitogen-activated protein kinase kinase kinase 8 OS=Homo sapiens GN=MAP3K8 PE=1 SV=2 898 1157 2.0E-25
sp|Q7RAH3|CDPK1_PLAYO Calcium-dependent protein kinase 1 OS=Plasmodium yoelii yoelii GN=CPK1 PE=3 SV=3 867 1153 2.0E-25
sp|Q9R117|TYK2_MOUSE Non-receptor tyrosine-protein kinase TYK2 OS=Mus musculus GN=Tyk2 PE=1 SV=2 903 1100 2.0E-25
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 900 1154 7.0E-21
sp|P18652|KS6AA_CHICK Ribosomal protein S6 kinase 2 alpha OS=Gallus gallus GN=RPS6KA PE=2 SV=1 894 1163 2.0E-17
sp|Q21734|KS6A1_CAEEL Putative ribosomal protein S6 kinase alpha-1 OS=Caenorhabditis elegans GN=rskn-1 PE=3 SV=4 941 1163 4.0E-17
sp|Q15349|KS6A2_HUMAN Ribosomal protein S6 kinase alpha-2 OS=Homo sapiens GN=RPS6KA2 PE=1 SV=2 951 1160 1.0E-16
sp|P51812|KS6A3_HUMAN Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens GN=RPS6KA3 PE=1 SV=1 903 1159 1.0E-16
sp|P18654|KS6A3_MOUSE Ribosomal protein S6 kinase alpha-3 OS=Mus musculus GN=Rps6ka3 PE=1 SV=2 903 1159 1.0E-16
sp|Q15418|KS6A1_HUMAN Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens GN=RPS6KA1 PE=1 SV=2 894 1163 2.0E-16
sp|Q7TPS0|KS6A6_MOUSE Ribosomal protein S6 kinase alpha-6 OS=Mus musculus GN=Rps6ka6 PE=1 SV=2 903 1163 2.0E-16
sp|Q9WUT3|KS6A2_MOUSE Ribosomal protein S6 kinase alpha-2 OS=Mus musculus GN=Rps6ka2 PE=1 SV=1 951 1159 3.0E-16
sp|P18653|KS6A1_MOUSE Ribosomal protein S6 kinase alpha-1 OS=Mus musculus GN=Rps6ka1 PE=1 SV=1 894 1163 6.0E-16
sp|Q63531|KS6A1_RAT Ribosomal protein S6 kinase alpha-1 OS=Rattus norvegicus GN=Rps6ka1 PE=1 SV=1 894 1163 1.0E-15
sp|Q9UK32|KS6A6_HUMAN Ribosomal protein S6 kinase alpha-6 OS=Homo sapiens GN=RPS6KA6 PE=1 SV=1 905 1159 2.0E-15
sp|P10665|KS6AA_XENLA Ribosomal protein S6 kinase 2 alpha OS=Xenopus laevis GN=rps6ka PE=1 SV=1 951 1163 1.0E-14
sp|Q6PFQ0|KS6A6_DANRE Ribosomal protein S6 kinase alpha-6 OS=Danio rerio GN=rps6ka6 PE=2 SV=1 951 1159 4.0E-14
sp|P10666|KS6AB_XENLA Ribosomal protein S6 kinase 2 beta OS=Xenopus laevis PE=2 SV=1 951 1106 5.0E-14
sp|Q5F3L1|KS6A5_CHICK Ribosomal protein S6 kinase alpha-5 OS=Gallus gallus GN=RPS6KA5 PE=2 SV=1 942 1161 1.0E-13
sp|Q9Z2B9|KS6A4_MOUSE Ribosomal protein S6 kinase alpha-4 OS=Mus musculus GN=Rps6ka4 PE=1 SV=2 949 1105 2.0E-09
sp|O75676|KS6A4_HUMAN Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens GN=RPS6KA4 PE=1 SV=1 992 1105 8.0E-09
sp|Q9V3I5|JIL1_DROME Chromosomal serine/threonine-protein kinase JIL-1 OS=Drosophila melanogaster GN=JIL-1 PE=1 SV=1 900 1107 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005524 ATP binding Yes
GO:0006468 protein phosphorylation Yes
GO:0004672 protein kinase activity Yes
GO:0032559 adenyl ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0019538 protein metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0008152 metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:0016301 kinase activity No
GO:0016740 transferase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016310 phosphorylation No
GO:1901564 organonitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032553 ribonucleotide binding No
GO:0008150 biological_process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0036211 protein modification process No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0043168 anion binding No
GO:0043412 macromolecule modification No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|057020
MSTLTASNAFYSLDDSPPKPSSPVTPTGQPSVAARSFMNLNPEVRGHHAPFPITPTATTLNPPLDPPPGISFADH
LKTWSDTQTAKWLADCKCSHHAETFKANDIRGDIILELDQATLKEMGIASIGDRLRMLNAVKHLRQRASNRPTAV
SSRHTISSNQPKTDGVPTTRSHTKRPAPLRLNGTLTQNDLPAIAREPPPDSAKSTNLGASFRPLPQPGQQSNQSL
GGSFSSHTNAHPITPNHPRAQLPPLPPPSRAPPPPPGRRAGQRAATPTQEAPPSYTAGSLPLAPQQSQLLTPSNN
WVSPYHSPPDSRPGNATGKISSRSTSPLPVRGARPNAINPIHGRNGSGSLVSPSSSSSPSTKLPPRPSTTGTNYH
PYANPQATALQPPPGYPGHALSPIEEQFNASQSALNSPSPHSQYPGSRGPVHGNSGSGSGQQLSYEEIRRKLIKF
VLPDEGLTYTIDAVTCTGGVEVLEKVLKKFGKGVSRAADGDTSLEYAITPQGGLTVDGWGVYLDMGQQDGPGEPL
TEAELLSVCHAPPDHPTREHGLVLRRTKVPRRTESPSHLNPNSSIKTPKRASSISILSSLGVRNPERALDPPSPT
SASGRLSPTTISATAKRPSKLRHFFGQRPPSELITNHLPEYFPNTEKKILERTARHSMMLKAKRESFASVREQPL
PSRFSISTRGSTSPSRTSFSSSLAPPVPDKYNDSSEVLPRMSLSMEDGRSIDLGPDVSTTASVTSTNTSDSSGKP
LLPPIPFPTESLSEIIEGAAKKRMSRTISTSSRRMSYMTELRSRRDRSDTASLMTVDEITAEVESRRGSTTVAGT
SEMDDWTKVDVEETPDAPVDEKDVVAEQEEVEVSDGSEDEDEDVDDGVGVTLNGEDDDIPKSVETNSKSNKWIKG
ALIGAGSFGKVYLGMDASNGLLMAVKQVELPTGSLPNQERKKSMLNALEREIELLKNLQHENIVQYLYSSVDDEF
LNIFLEYVPGGSVATLLRNYGAFEETLVKNFVRQILSGLSYLHERDIIHRDIKGANILVDNKGGVKISDFGISKK
VNDNLLATKMHRFSLQGSVFWMAPEVVKQSGHTLKADIWSVGCLVVEMLTGEHPWAQLTQMQAIFKIGSSARPSM
PSDISSEAVDFLETTFILDQNARPSAPELSQHPFAQRK*
Coding >Agabi119p4|057020
ATGTCCACCCTCACCGCGAGCAATGCCTTTTATTCTCTTGACGACTCTCCCCCAAAGCCCTCTTCTCCCGTCACT
CCCACAGGACAGCCCTCCGTCGCCGCACGCTCTTTCATGAACTTGAACCCCGAAGTCAGAGGCCACCACGCCCCT
TTTCCAATCACCCCGACTGCGACCACTCTCAATCCTCCACTCGATCCTCCTCCCGGAATATCTTTCGCCGATCAT
CTCAAAACATGGTCAGACACCCAGACCGCGAAATGGCTCGCAGATTGCAAATGTTCTCATCATGCCGAAACGTTT
AAAGCAAATGACATTCGAGGGGATATCATCCTCGAATTGGATCAAGCTACGTTGAAAGAGATGGGCATTGCCAGC
ATAGGTGACCGACTGCGCATGTTAAATGCTGTCAAGCATCTCAGACAGCGCGCCTCCAATCGGCCAACCGCTGTC
TCCAGCCGTCACACTATTTCCAGCAATCAGCCAAAGACTGATGGCGTCCCGACCACTCGATCTCATACGAAGCGA
CCTGCACCTCTCAGGCTCAATGGTACTCTCACGCAGAATGATCTCCCTGCTATTGCTCGCGAACCACCCCCAGAT
TCCGCTAAAAGTACCAATCTTGGTGCTAGCTTTCGTCCACTTCCTCAGCCAGGCCAACAGTCCAACCAGTCTCTC
GGTGGTTCCTTTAGTAGCCACACCAACGCCCACCCCATTACCCCCAATCATCCACGAGCTCAGCTCCCTCCACTT
CCACCCCCGTCGCGTGCACCACCCCCTCCTCCTGGACGACGCGCTGGGCAAAGGGCAGCCACACCTACTCAAGAG
GCTCCTCCGAGTTACACTGCTGGGAGTCTTCCCCTAGCCCCTCAACAATCTCAACTCCTTACACCCTCAAATAAT
TGGGTCAGTCCCTACCATTCCCCTCCGGATTCCAGACCAGGCAACGCAACTGGTAAAATATCATCGCGCTCGACT
TCTCCCCTTCCGGTCCGTGGGGCACGACCCAATGCGATCAATCCAATCCACGGGCGTAATGGGTCAGGTTCCCTT
GTTTCGCCAAGCTCAAGCAGCAGTCCTTCCACCAAATTGCCCCCGCGACCTTCCACAACTGGCACCAATTATCAT
CCATATGCCAACCCTCAAGCCACAGCTCTCCAACCCCCACCAGGATACCCGGGGCATGCTCTTTCTCCCATCGAG
GAACAATTCAATGCATCGCAATCTGCGCTCAACAGTCCTTCTCCACATTCTCAGTATCCTGGTAGTCGTGGCCCT
GTTCATGGTAATAGTGGGTCTGGTAGTGGACAACAGCTGTCTTATGAGGAGATCAGGCGCAAACTTATTAAATTT
GTATTGCCTGATGAGGGCCTCACATATACCATAGACGCCGTAACGTGTACAGGTGGCGTCGAGGTCCTTGAAAAG
GTCCTCAAAAAATTCGGTAAAGGCGTTTCGAGGGCCGCCGATGGTGATACATCATTGGAATACGCAATCACACCT
CAAGGCGGACTAACCGTCGATGGCTGGGGTGTTTATCTCGACATGGGTCAGCAAGACGGCCCTGGTGAACCACTG
ACCGAAGCGGAGCTATTGTCAGTATGTCACGCCCCTCCGGACCACCCAACTCGCGAACATGGACTTGTACTACGC
CGGACTAAAGTCCCTCGTAGGACCGAGAGTCCTTCACACCTCAACCCCAACTCCTCCATCAAAACGCCAAAGCGT
GCCAGCTCGATCAGTATCCTCAGTTCTCTTGGCGTTCGAAATCCCGAACGTGCCCTTGATCCGCCTTCACCTACC
TCTGCTTCAGGTCGTCTCAGTCCGACAACAATAAGTGCAACTGCTAAACGCCCTTCCAAGTTGCGCCACTTCTTT
GGCCAACGTCCACCTAGCGAGCTCATCACAAATCACCTTCCTGAATATTTCCCCAACACTGAAAAGAAGATTCTG
GAACGAACTGCTAGGCATAGTATGATGCTCAAGGCAAAGCGAGAAAGCTTTGCATCGGTCAGGGAACAACCTTTA
CCTTCAAGATTCAGTATCAGTACCAGAGGATCGACATCACCCTCTCGGACTTCATTTTCCTCTAGTCTGGCCCCA
CCAGTACCAGATAAATATAATGACAGTTCGGAGGTTTTGCCTCGGATGTCATTATCAATGGAGGATGGTCGGTCG
ATTGACTTGGGACCTGACGTTTCAACCACCGCATCTGTCACTTCAACCAACACATCCGATTCGAGCGGGAAACCT
CTGTTGCCGCCGATACCATTCCCAACGGAATCACTATCAGAAATTATTGAAGGTGCGGCAAAGAAACGAATGTCA
AGAACGATATCGACGTCGTCGAGAAGAATGAGCTATATGACAGAATTGAGGAGTAGAAGGGATAGATCGGACACG
GCCAGTTTGATGACTGTGGATGAAATAACTGCAGAGGTAGAAAGTAGAAGAGGGAGCACTACGGTAGCTGGAACT
TCAGAGATGGATGATTGGACAAAGGTGGACGTGGAGGAGACTCCTGATGCACCAGTTGATGAAAAAGATGTTGTT
GCAGAGCAGGAAGAAGTGGAAGTTAGTGATGGAAGTGAAGATGAAGATGAAGATGTAGACGATGGAGTGGGAGTC
ACGCTCAATGGGGAGGATGATGACATCCCCAAGAGTGTCGAGACGAATTCAAAGTCGAACAAATGGATAAAGGGC
GCCCTTATCGGCGCTGGGTCTTTTGGCAAAGTGTACCTTGGAATGGATGCGTCTAACGGTCTCCTTATGGCCGTG
AAGCAGGTCGAATTACCTACTGGTTCATTGCCTAACCAGGAACGTAAGAAGAGCATGTTAAATGCTCTCGAACGC
GAAATTGAACTTCTCAAGAACTTGCAACATGAAAATATTGTACAATATCTTTATTCATCTGTTGATGACGAATTT
TTGAATATCTTCCTTGAATACGTGCCTGGTGGCTCTGTCGCGACGCTTCTTCGCAATTATGGTGCCTTTGAAGAA
ACTCTGGTCAAGAACTTTGTCAGACAGATTTTGTCCGGCTTGAGTTACTTGCACGAACGTGATATCATTCATCGA
GACATCAAAGGGGCCAACATCCTTGTCGACAACAAGGGTGGTGTCAAAATATCTGACTTTGGAATTTCGAAGAAA
GTTAATGACAATCTTTTGGCGACCAAGATGCACAGATTTTCGTTACAGGGTTCAGTGTTCTGGATGGCCCCAGAA
GTTGTCAAACAGAGTGGACACACGCTGAAAGCCGATATATGGAGCGTGGGTTGCCTTGTCGTCGAGATGCTGACC
GGTGAACATCCTTGGGCACAACTCACGCAGATGCAAGCGATCTTTAAGATCGGATCATCAGCTAGACCTAGTATG
CCCTCTGATATCTCCTCAGAAGCCGTCGACTTCCTGGAAACGACTTTTATATTGGACCAAAATGCACGGCCATCG
GCACCGGAACTTTCACAACATCCCTTTGCTCAAAGAAAATAA
Transcript >Agabi119p4|057020
ATGTCCACCCTCACCGCGAGCAATGCCTTTTATTCTCTTGACGACTCTCCCCCAAAGCCCTCTTCTCCCGTCACT
CCCACAGGACAGCCCTCCGTCGCCGCACGCTCTTTCATGAACTTGAACCCCGAAGTCAGAGGCCACCACGCCCCT
TTTCCAATCACCCCGACTGCGACCACTCTCAATCCTCCACTCGATCCTCCTCCCGGAATATCTTTCGCCGATCAT
CTCAAAACATGGTCAGACACCCAGACCGCGAAATGGCTCGCAGATTGCAAATGTTCTCATCATGCCGAAACGTTT
AAAGCAAATGACATTCGAGGGGATATCATCCTCGAATTGGATCAAGCTACGTTGAAAGAGATGGGCATTGCCAGC
ATAGGTGACCGACTGCGCATGTTAAATGCTGTCAAGCATCTCAGACAGCGCGCCTCCAATCGGCCAACCGCTGTC
TCCAGCCGTCACACTATTTCCAGCAATCAGCCAAAGACTGATGGCGTCCCGACCACTCGATCTCATACGAAGCGA
CCTGCACCTCTCAGGCTCAATGGTACTCTCACGCAGAATGATCTCCCTGCTATTGCTCGCGAACCACCCCCAGAT
TCCGCTAAAAGTACCAATCTTGGTGCTAGCTTTCGTCCACTTCCTCAGCCAGGCCAACAGTCCAACCAGTCTCTC
GGTGGTTCCTTTAGTAGCCACACCAACGCCCACCCCATTACCCCCAATCATCCACGAGCTCAGCTCCCTCCACTT
CCACCCCCGTCGCGTGCACCACCCCCTCCTCCTGGACGACGCGCTGGGCAAAGGGCAGCCACACCTACTCAAGAG
GCTCCTCCGAGTTACACTGCTGGGAGTCTTCCCCTAGCCCCTCAACAATCTCAACTCCTTACACCCTCAAATAAT
TGGGTCAGTCCCTACCATTCCCCTCCGGATTCCAGACCAGGCAACGCAACTGGTAAAATATCATCGCGCTCGACT
TCTCCCCTTCCGGTCCGTGGGGCACGACCCAATGCGATCAATCCAATCCACGGGCGTAATGGGTCAGGTTCCCTT
GTTTCGCCAAGCTCAAGCAGCAGTCCTTCCACCAAATTGCCCCCGCGACCTTCCACAACTGGCACCAATTATCAT
CCATATGCCAACCCTCAAGCCACAGCTCTCCAACCCCCACCAGGATACCCGGGGCATGCTCTTTCTCCCATCGAG
GAACAATTCAATGCATCGCAATCTGCGCTCAACAGTCCTTCTCCACATTCTCAGTATCCTGGTAGTCGTGGCCCT
GTTCATGGTAATAGTGGGTCTGGTAGTGGACAACAGCTGTCTTATGAGGAGATCAGGCGCAAACTTATTAAATTT
GTATTGCCTGATGAGGGCCTCACATATACCATAGACGCCGTAACGTGTACAGGTGGCGTCGAGGTCCTTGAAAAG
GTCCTCAAAAAATTCGGTAAAGGCGTTTCGAGGGCCGCCGATGGTGATACATCATTGGAATACGCAATCACACCT
CAAGGCGGACTAACCGTCGATGGCTGGGGTGTTTATCTCGACATGGGTCAGCAAGACGGCCCTGGTGAACCACTG
ACCGAAGCGGAGCTATTGTCAGTATGTCACGCCCCTCCGGACCACCCAACTCGCGAACATGGACTTGTACTACGC
CGGACTAAAGTCCCTCGTAGGACCGAGAGTCCTTCACACCTCAACCCCAACTCCTCCATCAAAACGCCAAAGCGT
GCCAGCTCGATCAGTATCCTCAGTTCTCTTGGCGTTCGAAATCCCGAACGTGCCCTTGATCCGCCTTCACCTACC
TCTGCTTCAGGTCGTCTCAGTCCGACAACAATAAGTGCAACTGCTAAACGCCCTTCCAAGTTGCGCCACTTCTTT
GGCCAACGTCCACCTAGCGAGCTCATCACAAATCACCTTCCTGAATATTTCCCCAACACTGAAAAGAAGATTCTG
GAACGAACTGCTAGGCATAGTATGATGCTCAAGGCAAAGCGAGAAAGCTTTGCATCGGTCAGGGAACAACCTTTA
CCTTCAAGATTCAGTATCAGTACCAGAGGATCGACATCACCCTCTCGGACTTCATTTTCCTCTAGTCTGGCCCCA
CCAGTACCAGATAAATATAATGACAGTTCGGAGGTTTTGCCTCGGATGTCATTATCAATGGAGGATGGTCGGTCG
ATTGACTTGGGACCTGACGTTTCAACCACCGCATCTGTCACTTCAACCAACACATCCGATTCGAGCGGGAAACCT
CTGTTGCCGCCGATACCATTCCCAACGGAATCACTATCAGAAATTATTGAAGGTGCGGCAAAGAAACGAATGTCA
AGAACGATATCGACGTCGTCGAGAAGAATGAGCTATATGACAGAATTGAGGAGTAGAAGGGATAGATCGGACACG
GCCAGTTTGATGACTGTGGATGAAATAACTGCAGAGGTAGAAAGTAGAAGAGGGAGCACTACGGTAGCTGGAACT
TCAGAGATGGATGATTGGACAAAGGTGGACGTGGAGGAGACTCCTGATGCACCAGTTGATGAAAAAGATGTTGTT
GCAGAGCAGGAAGAAGTGGAAGTTAGTGATGGAAGTGAAGATGAAGATGAAGATGTAGACGATGGAGTGGGAGTC
ACGCTCAATGGGGAGGATGATGACATCCCCAAGAGTGTCGAGACGAATTCAAAGTCGAACAAATGGATAAAGGGC
GCCCTTATCGGCGCTGGGTCTTTTGGCAAAGTGTACCTTGGAATGGATGCGTCTAACGGTCTCCTTATGGCCGTG
AAGCAGGTCGAATTACCTACTGGTTCATTGCCTAACCAGGAACGTAAGAAGAGCATGTTAAATGCTCTCGAACGC
GAAATTGAACTTCTCAAGAACTTGCAACATGAAAATATTGTACAATATCTTTATTCATCTGTTGATGACGAATTT
TTGAATATCTTCCTTGAATACGTGCCTGGTGGCTCTGTCGCGACGCTTCTTCGCAATTATGGTGCCTTTGAAGAA
ACTCTGGTCAAGAACTTTGTCAGACAGATTTTGTCCGGCTTGAGTTACTTGCACGAACGTGATATCATTCATCGA
GACATCAAAGGGGCCAACATCCTTGTCGACAACAAGGGTGGTGTCAAAATATCTGACTTTGGAATTTCGAAGAAA
GTTAATGACAATCTTTTGGCGACCAAGATGCACAGATTTTCGTTACAGGGTTCAGTGTTCTGGATGGCCCCAGAA
GTTGTCAAACAGAGTGGACACACGCTGAAAGCCGATATATGGAGCGTGGGTTGCCTTGTCGTCGAGATGCTGACC
GGTGAACATCCTTGGGCACAACTCACGCAGATGCAAGCGATCTTTAAGATCGGATCATCAGCTAGACCTAGTATG
CCCTCTGATATCTCCTCAGAAGCCGTCGACTTCCTGGAAACGACTTTTATATTGGACCAAAATGCACGGCCATCG
GCACCGGAACTTTCACAACATCCCTTTGCTCAAAGAAAATAA
Gene >Agabi119p4|057020
ATGTCCACCCTCACCGCGAGCAATGCCTTTTATTCTCTTGACGACTCTCCCCCAAAGCCCTCTTCTCCCGTCACT
CCCACAGGACAGCCCTCCGTCGCCGCACGCTCTTTCATGAACTTGAACCCCGAAGTCAGAGGCCACCACGCCCCT
TTTCCAATCACCCCGACTGCGACCACTCTCAATCCTCCACTCGATCCTCCTCCCGGAATATCTTTCGCCGATCAT
CTCAAAACATGGTCAGACACCCAGACCGCGAAATGGCTCGCAGATTGCAAATGTTCTCATCATGCCGAAACGTTT
AAAGCAAATGACATTCGAGGGGATATCATCCTCGAATTGGATCAAGCTACGTTGAAAGAGATGGGCATTGCCAGC
ATAGGTGACCGACTGCGCATGTTAAATGCTGTCAAGCATCTCAGACAGCGCGCCTCCAATCGGCCAACCGCTGTC
TCCAGCCGTCACACTATTTCCAGCAATCAGCCAAAGACTGATGGCGTCCCGACCACTCGATCTCATACGAAGCGA
CCTGCACCTCTCAGGCTCAATGGTACTCTCACGCAGAATGATCTCCCTGCTATTGCTCGCGAACCACCCCCAGAT
TCCGCTAAAAGTACCAATCTTGGTGCTAGCTTTCGTCCACTTCCTCAGCCAGGCCAACAGTCCAACCAGTCTCTC
GGTGGTTCCTTTAGTAGCCACACCAACGCCCACCCCATTACCCCCAATCATCCACGAGCTCAGCTCCCTCCACTT
CCACCCCCGTCGCGTGCACCACCCCCTCCTCCTGGACGACGCGCTGGGCAAAGGGCAGCCACACCTACTCAAGAG
GCTCCTCCGAGTTACACTGCTGGGAGTCTTCCCCTAGCCCCTCAACAATCTCAACTCCTTACACCCTCAAATAAT
TGGGTCAGTCCCTACCATTCCCCTCCGGATTCCAGACCAGGCAACGCAACTGGTAAAATATCATCGCGCTCGACT
TCTCCCCTTCCGGTCCGTGGGGCACGACCCAATGCGATCAATCCAATCCACGGGCGTAATGGGTCAGGTTCCCTT
GTTTCGCCAAGCTCAAGCAGCAGTCCTTCCACCAAATTGCCCCCGCGACCTTCCACAACTGGCACCAATTATCAT
CCATATGCCAACCCTCAAGCCACAGCTCTCCAACCCCCACCAGGATACCCGGGGCATGCTCTTTCTCCCATCGAG
GAACAATTCAATGCATCGCAATCTGCGCTCAACAGTCCTTCTCCACATTCTCAGTATCCTGGTAGTCGTGGCCCT
GTTCATGGTAATAGTGGGTCTGGTAGTGGACAACAGCTGTCTTATGAGGAGATCAGGCGCAAACTTATTAAATTT
GTATTGCCTGATGAGGGCCTCACATATACCATAGACGCCGTAACGTGTACAGGTGGCGTCGAGGTCCTTGAAAAG
GTCCTCAAAAAATTCGGTAAAGGCGTTTCGAGGGCCGCCGATGGTGATACATCATTGGAATACGCAATCACACCT
CAAGGCGGACTAACCGTCGATGGCTGGGGTGTTTATCTCGACATGGGTCAGCAAGACGGCCCTGGTAAGTTTCGC
TTTTGTCTATAGTCTACAATTCTCAGATTATTTACAGGTGAACCACTGACCGAAGCGGAGCTATTGTCAGTATGT
CACGCCCCTCCGGACCACCCAACTCGCGAACATGGACTTGTACTACGCCGGACTAAAGTCCCTCGTAGGACCGAG
AGTCCTTCACACCTCAACCCCAACTCCTCCATCAAAACGCCAAAGCGTGCCAGCTCGATCAGTATCCTCAGTTCT
CTTGGCGTTCGAAATCCCGAACGTGCCCTTGATCCGCCTTCACCTACCTCTGCTTCAGGTCGTCTCAGTCCGACA
ACAATAAGTGCAACTGCTAAACGCCCTTCCAAGTTGCGCCACTTCTTTGGCCAACGTCCACCTAGCGAGCTCATC
ACAAATCACCTTCCTGAATATTTCCCCAACACTGAAAAGAAGATTCTGGAACGAACTGCTAGGCATAGTATGATG
CTCAAGGCAAAGCGAGAAAGCTTTGCATCGGTCAGGGAACAACCTTTACCTTCAAGATTCAGTATCAGTACCAGA
GGATCGACATCACCCTCTCGGACTTCATTTTCCTCTAGTCTGGCCCCACCAGTACCAGATAAATATAATGACAGT
TCGGAGGTTTTGCCTCGGATGTCATTATCAATGGAGGATGGTCGGTCGATTGACTTGGGACCTGACGTTTCAACC
ACCGCATCTGTCACTTCAACCAACACATCCGATTCGAGCGGGAAACCTCTGTTGCCGCCGATACCATTCCCAACG
GAATCACTATCAGAAATTATTGAAGGTGCGGCAAAGAAACGAATGTCAAGAACGATATCGACGTCGTCGAGAAGA
ATGAGCTATATGACAGAATTGAGGAGTAGAAGGGATAGATCGGACACGGCCAGTTTGATGACTGTGGATGAAATA
ACTGCAGAGGTAGAAAGTAGAAGAGGGAGCACTACGGTAGCTGGAACTTCAGAGATGGATGATTGGACAAAGGTG
GACGTGGAGGAGACTCCTGATGCACCAGTTGATGAAAAAGATGTTGTTGCAGAGCAGGAAGAAGTGGAAGTTAGT
GATGGAAGTGAAGATGAAGATGAAGATGTAGACGATGGAGTGGGAGTCACGCTCAATGGGGAGGATGATGACATC
CCCAAGAGTGTCGAGACGAATTCAAAGTGTAAGTTTCGTTGTCAAATCAGCCTTTGAAAATGCTTACATGAATAA
CGGCAGCGAACAAATGGATAAAGGGCGCCCTTATCGGCGCTGGGTCTTTTGGCAAAGTGTACCTTGGAATGGATG
CGTCTAACGGTCTCCTTATGGCCGTGAAGCAGGTCGAATTACCTACTGGTTCATTGCCTAACCAGGAACGTAAGA
AGAGCATGTTAAATGCTCTCGAACGCGAAATTGAACTTCTCAAGAACTTGCAACATGAAAATATTGTACAATATC
TTTGTATGTTTTATTACCCCGACATTTTCTCCTGCTGATTGATGTTGGTCAGATTCATCTGTTGATGACGAATTT
TTGAATATCTTCCTTGAATACGTGCCTGGTGGCTCTGTCGCGACGCTTCTTCGCAATTATGGTGCCTTTGAAGAA
ACTCTGGTCAAGAACTTTGTCAGACAGATTTTGTCCGGCTTGAGTTACTTGCACGAACGTGATATCATTCATCGA
GACATCAAAGGGGCCAACATCCTTGTCGACAACAAGGGTGGTGTCAAAATATCTGACTTTGGAATTTCGAAGAAA
GTTAATGACAGTGAGTGTTAGCTCTGCATATATTGACTCTCAAGTTCATATACAATTTTACGTGACTTAGATCTT
TTGGCGACCAAGATGCACAGATTTTCGTTACAGGGTTCAGTGTTCTGGATGGCCCCAGAAGTTGTCAAACAGAGT
GGACACACGCTGAAAGCCGATATATGGAGCGTGGGTTGCCTTGTCGTCGAGATGCTGACCGGTGAACATCCTTGG
GCACAACTCACGCAGATGCAAGCGATCTTTAAGGTGAATTTCACTTTACCTGTCGACTTGCCATTGTTTTTGATC
GTATTCTGTAGATCGGATCATCAGCTAGACCTAGTATGCCCTCTGATATCTCCTCAGAAGCCGTCGACTTCCTGG
AAACGACTTTTATATTGGACCAAAATGCACGGCCATCGGCACCGGAACTTTCACAACATCCCTTTGCTCAAAGAA
AATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail