Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|057010
Gene name
Locationscaffold_03a:1092386..1100215
Strand-
Gene length (bp)7829
Transcript length (bp)6957
Coding sequence length (bp)6957
Protein length (aa) 2319

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00128 Alpha-amylase Alpha amylase, catalytic domain 2.5E-17 100 500
PF08323 Glyco_transf_5 Starch synthase catalytic domain 5.5E-16 1151 1357
PF00534 Glycos_transf_1 Glycosyl transferases group 1 8.4E-07 1442 1543

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y719|MOK13_SCHPO Cell wall alpha-1,3-glucan synthase mok13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mok13 PE=3 SV=2 6 2318 0.0E+00
sp|Q09854|MOK11_SCHPO Cell wall alpha-1,3-glucan synthase mok11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mok11 PE=3 SV=2 19 2318 0.0E+00
sp|Q9UUL4|MOK12_SCHPO Cell wall alpha-1,3-glucan synthase mok12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mok12 PE=3 SV=1 15 2316 0.0E+00
sp|Q9USK8|AGS1_SCHPO Cell wall alpha-1,3-glucan synthase ags1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ags1 PE=1 SV=3 2 1629 0.0E+00
sp|Q9Y704|MOK14_SCHPO Cell wall alpha-1,3-glucan synthase mok14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mok14 PE=1 SV=1 1031 1625 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y719|MOK13_SCHPO Cell wall alpha-1,3-glucan synthase mok13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mok13 PE=3 SV=2 6 2318 0.0E+00
sp|Q09854|MOK11_SCHPO Cell wall alpha-1,3-glucan synthase mok11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mok11 PE=3 SV=2 19 2318 0.0E+00
sp|Q9UUL4|MOK12_SCHPO Cell wall alpha-1,3-glucan synthase mok12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mok12 PE=3 SV=1 15 2316 0.0E+00
sp|Q9USK8|AGS1_SCHPO Cell wall alpha-1,3-glucan synthase ags1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ags1 PE=1 SV=3 2 1629 0.0E+00
sp|Q9Y704|MOK14_SCHPO Cell wall alpha-1,3-glucan synthase mok14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mok14 PE=1 SV=1 1031 1625 0.0E+00
sp|Q9USK8|AGS1_SCHPO Cell wall alpha-1,3-glucan synthase ags1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ags1 PE=1 SV=3 1758 2318 3.0E-148
sp|Q9Y704|MOK14_SCHPO Cell wall alpha-1,3-glucan synthase mok14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mok14 PE=1 SV=1 1763 2318 2.0E-103
sp|Q8DPS3|GLGA_STRR6 Glycogen synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=glgA PE=3 SV=1 1169 1582 4.0E-16
sp|Q04KG5|GLGA_STRP2 Glycogen synthase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=glgA PE=3 SV=1 1169 1582 4.0E-16
sp|B5YG91|GLGA_THEYD Glycogen synthase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=glgA PE=3 SV=1 1223 1640 4.0E-16
sp|B1IBR0|GLGA_STRPI Glycogen synthase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=glgA PE=3 SV=1 1169 1582 2.0E-15
sp|B2IPY4|GLGA_STRPS Glycogen synthase OS=Streptococcus pneumoniae (strain CGSP14) GN=glgA PE=3 SV=1 1169 1582 2.0E-15
sp|Q97QS5|GLGA_STRPN Glycogen synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=glgA PE=3 SV=1 1169 1582 2.0E-15
sp|C1CEB0|GLGA_STRZJ Glycogen synthase OS=Streptococcus pneumoniae (strain JJA) GN=glgA PE=3 SV=1 1169 1582 3.0E-15
sp|A9BG68|GLGA_PETMO Glycogen synthase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=glgA PE=3 SV=1 1278 1559 4.0E-15
sp|C1CRM3|GLGA_STRZT Glycogen synthase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=glgA PE=3 SV=1 1169 1582 4.0E-15
sp|C1CKI7|GLGA_STRZP Glycogen synthase OS=Streptococcus pneumoniae (strain P1031) GN=glgA PE=3 SV=1 1169 1582 4.0E-15
sp|C1C7B7|GLGA_STRP7 Glycogen synthase OS=Streptococcus pneumoniae (strain 70585) GN=glgA PE=3 SV=1 1169 1582 4.0E-15
sp|B7LSE0|GLGA_ESCF3 Glycogen synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=glgA PE=3 SV=1 1281 1559 5.0E-15
sp|Q18A79|GLGA_PEPD6 Glycogen synthase OS=Peptoclostridium difficile (strain 630) GN=glgA PE=3 SV=1 1169 1559 7.0E-15
sp|Q1R5J7|GLGA_ECOUT Glycogen synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=glgA PE=3 SV=1 1281 1559 8.0E-15
sp|B5E4N6|GLGA_STRP4 Glycogen synthase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=glgA PE=3 SV=1 1169 1582 1.0E-14
sp|B1LC39|GLGA_THESQ Glycogen synthase OS=Thermotoga sp. (strain RQ2) GN=glgA PE=3 SV=1 1154 1599 1.0E-14
sp|A5IIN8|GLGA_THEP1 Glycogen synthase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=glgA PE=3 SV=1 1154 1599 1.0E-14
sp|Q3YW96|GLGA_SHISS Glycogen synthase OS=Shigella sonnei (strain Ss046) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|Q31VJ4|GLGA_SHIBS Glycogen synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|B1LI90|GLGA_ECOSM Glycogen synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|B6I2Z5|GLGA_ECOSE Glycogen synthase OS=Escherichia coli (strain SE11) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|B7NE39|GLGA_ECOLU Glycogen synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|P0A6U8|GLGA_ECOLI Glycogen synthase OS=Escherichia coli (strain K12) GN=glgA PE=1 SV=1 1281 1559 1.0E-14
sp|B1IP35|GLGA_ECOLC Glycogen synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|P0A6U9|GLGA_ECOL6 Glycogen synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|Q0TC30|GLGA_ECOL5 Glycogen synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|A1AGW2|GLGA_ECOK1 Glycogen synthase OS=Escherichia coli O1:K1 / APEC GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|A8A5N9|GLGA_ECOHS Glycogen synthase OS=Escherichia coli O9:H4 (strain HS) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|B1X774|GLGA_ECODH Glycogen synthase OS=Escherichia coli (strain K12 / DH10B) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|C4ZVX9|GLGA_ECOBW Glycogen synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|B7M2J2|GLGA_ECO8A Glycogen synthase OS=Escherichia coli O8 (strain IAI1) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|B7N176|GLGA_ECO81 Glycogen synthase OS=Escherichia coli O81 (strain ED1a) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|B7NMJ4|GLGA_ECO7I Glycogen synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|B5YUI5|GLGA_ECO5E Glycogen synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|P0A6V0|GLGA_ECO57 Glycogen synthase OS=Escherichia coli O157:H7 GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|B7L4W1|GLGA_ECO55 Glycogen synthase OS=Escherichia coli (strain 55989 / EAEC) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|B7MDR4|GLGA_ECO45 Glycogen synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|B7UKD4|GLGA_ECO27 Glycogen synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|A7ZSW2|GLGA_ECO24 Glycogen synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=glgA PE=3 SV=1 1281 1559 1.0E-14
sp|B2U4G3|GLGA_SHIB3 Glycogen synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=glgA PE=3 SV=1 1281 1559 2.0E-14
sp|B8ZPW5|GLGA_STRPJ Glycogen synthase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=glgA PE=3 SV=1 1169 1582 2.0E-14
sp|C0Q0K9|GLGA_SALPC Glycogen synthase OS=Salmonella paratyphi C (strain RKS4594) GN=glgA PE=3 SV=1 1281 1559 2.0E-14
sp|Q57IU1|GLGA_SALCH Glycogen synthase OS=Salmonella choleraesuis (strain SC-B67) GN=glgA PE=3 SV=1 1281 1559 2.0E-14
sp|Q83PV4|GLGA_SHIFL Glycogen synthase OS=Shigella flexneri GN=glgA PE=3 SV=1 1281 1559 3.0E-14
sp|P05416|GLGA_SALTY Glycogen synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=glgA PE=3 SV=2 1281 1559 4.0E-14
sp|B4TY86|GLGA_SALSV Glycogen synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=glgA PE=3 SV=1 1281 1559 4.0E-14
sp|B5BHH9|GLGA_SALPK Glycogen synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=glgA PE=3 SV=1 1281 1559 4.0E-14
sp|A9MTV1|GLGA_SALPB Glycogen synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=glgA PE=3 SV=1 1281 1559 4.0E-14
sp|Q5PM09|GLGA_SALPA Glycogen synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=glgA PE=3 SV=1 1281 1559 4.0E-14
sp|B4SVN2|GLGA_SALNS Glycogen synthase OS=Salmonella newport (strain SL254) GN=glgA PE=3 SV=1 1281 1559 4.0E-14
sp|B4T867|GLGA_SALHS Glycogen synthase OS=Salmonella heidelberg (strain SL476) GN=glgA PE=3 SV=1 1281 1559 4.0E-14
sp|B5R394|GLGA_SALEP Glycogen synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=glgA PE=3 SV=1 1281 1559 4.0E-14
sp|B5FKF4|GLGA_SALDC Glycogen synthase OS=Salmonella dublin (strain CT_02021853) GN=glgA PE=3 SV=1 1281 1559 4.0E-14
sp|B5F8Q1|GLGA_SALA4 Glycogen synthase OS=Salmonella agona (strain SL483) GN=glgA PE=3 SV=1 1281 1559 4.0E-14
sp|A7MGE0|GLGA_CROS8 Glycogen synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=glgA PE=3 SV=1 1270 1559 4.0E-14
sp|Q32AV6|GLGA_SHIDS Glycogen synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=glgA PE=3 SV=1 1281 1559 4.0E-14
sp|B5XTR0|GLGA_KLEP3 Glycogen synthase OS=Klebsiella pneumoniae (strain 342) GN=glgA PE=3 SV=1 1281 1559 5.0E-14
sp|A8AQY0|GLGA_CITK8 Glycogen synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=glgA PE=3 SV=1 1281 1559 6.0E-14
sp|A6TF48|GLGA_KLEP7 Glycogen synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=glgA PE=3 SV=1 1281 1559 7.0E-14
sp|A9MMA3|GLGA_SALAR Glycogen synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=glgA PE=3 SV=1 1281 1559 8.0E-14
sp|A3CM04|GLGA_STRSV Glycogen synthase OS=Streptococcus sanguinis (strain SK36) GN=glgA PE=3 SV=1 1169 1559 8.0E-14
sp|A8AYH0|GLGA_STRGC Glycogen synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=glgA PE=3 SV=1 1169 1559 9.0E-14
sp|Q0SZN5|GLGA_SHIF8 Glycogen synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=glgA PE=3 SV=1 1281 1559 9.0E-14
sp|Q8Z232|GLGA_SALTI Glycogen synthase OS=Salmonella typhi GN=glgA PE=3 SV=1 1281 1559 1.0E-13
sp|Q9WZZ7|GLGA_THEMA Glycogen synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glgA PE=3 SV=1 1154 1599 1.0E-13
sp|Q05884|AMY_STRLI Alpha-amylase OS=Streptomyces lividans GN=amy PE=1 SV=1 99 522 2.0E-13
sp|B3W9A1|GLGA_LACCB Glycogen synthase OS=Lactobacillus casei (strain BL23) GN=glgA PE=3 SV=1 1169 1559 3.0E-13
sp|Q036T0|GLGA_LACC3 Glycogen synthase OS=Lactobacillus casei (strain ATCC 334) GN=glgA PE=3 SV=1 1169 1559 3.0E-13
sp|A4WFL2|GLGA_ENT38 Glycogen synthase OS=Enterobacter sp. (strain 638) GN=glgA PE=3 SV=1 1281 1559 4.0E-13
sp|B2VJU7|GLGA_ERWT9 Glycogen synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=glgA PE=3 SV=1 1281 1559 5.0E-13
sp|Q8RF65|GLGA_FUSNN Glycogen synthase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=glgA PE=3 SV=1 1168 1602 7.0E-13
sp|Q9CHM9|GLGA_LACLA Glycogen synthase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=glgA PE=3 SV=2 1263 1599 8.0E-13
sp|Q8XT73|GLGA_RALSO Glycogen synthase OS=Ralstonia solanacearum (strain GMI1000) GN=glgA PE=3 SV=1 1277 1559 1.0E-12
sp|P39125|GLGA_BACSU Glycogen synthase OS=Bacillus subtilis (strain 168) GN=glgA PE=2 SV=1 1168 1559 1.0E-12
sp|B2A6E4|GLGA_NATTJ Glycogen synthase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=glgA PE=3 SV=1 1151 1559 1.0E-12
sp|B7HBC4|GLGA_BACC4 Glycogen synthase OS=Bacillus cereus (strain B4264) GN=glgA PE=3 SV=1 1229 1559 1.0E-12
sp|B7GK04|GLGA_ANOFW Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=glgA PE=3 SV=1 1223 1559 1.0E-12
sp|A5FUS8|GLGA_ACICJ Glycogen synthase OS=Acidiphilium cryptum (strain JF-5) GN=glgA PE=3 SV=1 1281 1559 2.0E-12
sp|Q2J308|GLGA_RHOP2 Glycogen synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=glgA PE=3 SV=1 1281 1559 2.0E-12
sp|Q890I8|GLGA_LACPL Glycogen synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glgA PE=3 SV=1 1169 1559 2.0E-12
sp|B1YK70|GLGA_EXIS2 Glycogen synthase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=glgA PE=3 SV=1 1263 1559 3.0E-12
sp|A9IMI9|GLGA_BORPD Glycogen synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=glgA PE=3 SV=1 1281 1560 3.0E-12
sp|Q8LL05|SSG1B_HORVU Granule-bound starch synthase 1b, chloroplastic/amyloplastic (Fragment) OS=Hordeum vulgare PE=1 SV=1 1282 1559 3.0E-12
sp|B6IUD9|GLGA_RHOCS Glycogen synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=glgA PE=3 SV=1 1281 1559 4.0E-12
sp|Q9CN91|GLGA_PASMU Glycogen synthase OS=Pasteurella multocida (strain Pm70) GN=glgA PE=3 SV=1 1281 1559 4.0E-12
sp|Q816G8|GLGA_BACCR Glycogen synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=glgA PE=3 SV=1 1229 1559 6.0E-12
sp|B3Q9C2|GLGA_RHOPT Glycogen synthase OS=Rhodopseudomonas palustris (strain TIE-1) GN=glgA PE=3 SV=1 1168 1559 1.0E-11
sp|Q6NCT7|GLGA_RHOPA Glycogen synthase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=glgA PE=3 SV=1 1168 1559 1.0E-11
sp|Q13EA7|GLGA_RHOPS Glycogen synthase OS=Rhodopseudomonas palustris (strain BisB5) GN=glgA PE=3 SV=1 1168 1559 2.0E-11
sp|A8GKU7|GLGA_SERP5 Glycogen synthase OS=Serratia proteamaculans (strain 568) GN=glgA PE=3 SV=1 1270 1559 2.0E-11
sp|B8G1G3|GLGA_DESHD Glycogen synthase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=glgA PE=3 SV=1 1151 1559 3.0E-11
sp|Q7XE48|SSY21_ORYSJ Soluble starch synthase 2-1, chloroplastic/amyloplastic OS=Oryza sativa subsp. japonica GN=SSII-1 PE=2 SV=2 1169 1572 3.0E-11
sp|Q30Z13|GLGA_DESAG Glycogen synthase OS=Desulfovibrio alaskensis (strain G20) GN=glgA PE=3 SV=1 1200 1559 3.0E-11
sp|Q65FS7|GLGA_BACLD Glycogen synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glgA PE=3 SV=1 1168 1559 3.0E-11
sp|P25718|AMY1_ECOLI Alpha-amylase OS=Escherichia coli (strain K12) GN=malS PE=1 SV=1 51 198 4.0E-11
sp|Q8ET54|GLGA_OCEIH Glycogen synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glgA PE=3 SV=1 1168 1559 4.0E-11
sp|Q9MAC8|SSY2_ARATH Starch synthase 2, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=SS2 PE=1 SV=1 1169 1606 4.0E-11
sp|B4U626|GLGA_HYDS0 Glycogen synthase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=glgA PE=3 SV=1 1168 1560 5.0E-11
sp|Q1WSN1|GLGA_LACS1 Glycogen synthase OS=Lactobacillus salivarius (strain UCC118) GN=glgA PE=3 SV=1 1227 1603 5.0E-11
sp|Q8PDD2|GLGA_XANCP Glycogen synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=glgA PE=3 SV=1 1168 1559 7.0E-11
sp|Q4UZL8|GLGA_XANC8 Glycogen synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=glgA PE=3 SV=1 1168 1559 7.0E-11
sp|Q43847|SSY2_SOLTU Granule-bound starch synthase 2, chloroplastic/amyloplastic OS=Solanum tuberosum GN=SS2 PE=1 SV=3 1169 1559 1.0E-10
sp|Q43784|SSG1_MANES Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Manihot esculenta GN=WAXY PE=2 SV=1 1425 1559 1.0E-10
sp|A6VUP1|GLGA_MARMS Glycogen synthase OS=Marinomonas sp. (strain MWYL1) GN=glgA PE=3 SV=1 1168 1560 2.0E-10
sp|P21543|AMYB_PAEPO Beta/alpha-amylase OS=Paenibacillus polymyxa PE=1 SV=1 58 187 2.0E-10
sp|C6DH76|GLGA_PECCP Glycogen synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=glgA PE=3 SV=1 1281 1559 2.0E-10
sp|P0C585|SSG1_ORYSA Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Oryza sativa GN=WAXY PE=3 SV=1 1282 1559 3.0E-10
sp|Q6CZK3|GLGA_PECAS Glycogen synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=glgA PE=3 SV=1 1281 1559 3.0E-10
sp|Q7W6L5|GLGA_BORPA Glycogen synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glgA PE=3 SV=1 1282 1559 3.0E-10
sp|Q88FN9|GLGA_PSEPK Glycogen synthase OS=Pseudomonas putida (strain KT2440) GN=glgA PE=3 SV=1 1149 1559 4.0E-10
sp|B8DL94|GLGA_DESVM Glycogen synthase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=glgA PE=3 SV=1 1200 1559 4.0E-10
sp|Q8UK38|GLGA2_AGRFC Glycogen synthase 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=glgA2 PE=3 SV=2 1281 1560 4.0E-10
sp|Q42968|SSG1_ORYGL Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Oryza glaberrima GN=WAXY PE=1 SV=1 1430 1559 6.0E-10
sp|Q0DEV5|SSG1_ORYSJ Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Oryza sativa subsp. japonica GN=WAXY PE=1 SV=1 1430 1559 6.0E-10
sp|A2Y8X2|SSG1_ORYSI Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Oryza sativa subsp. indica GN=WAXY PE=3 SV=2 1430 1559 6.0E-10
sp|Q42857|SSG1_IPOBA Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Ipomoea batatas GN=WAXY PE=2 SV=2 1425 1559 7.0E-10
sp|Q3JD12|GLGA2_NITOC Glycogen synthase 2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=glgA2 PE=3 SV=1 1235 1559 7.0E-10
sp|Q8PQA3|GLGA_XANAC Glycogen synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=glgA PE=3 SV=1 1282 1559 7.0E-10
sp|Q0BPL3|GLGA_GRABC Glycogen synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=glgA PE=3 SV=1 1281 1587 1.0E-09
sp|B2SVT3|GLGA_XANOP Glycogen synthase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=glgA PE=3 SV=1 1282 1559 1.0E-09
sp|O14154|MDE5_SCHPO Alpha-amylase mde5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mde5 PE=2 SV=1 57 178 1.0E-09
sp|Q2W5G0|GLGA_MAGSA Glycogen synthase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=glgA PE=3 SV=1 1282 1559 2.0E-09
sp|Q43092|SSG1_PEA Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Pisum sativum PE=1 SV=1 1282 1591 2.0E-09
sp|Q3KD65|GLGA_PSEPF Glycogen synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=glgA PE=3 SV=2 1149 1559 2.0E-09
sp|Q46LU1|GLGA_PROMT Glycogen synthase OS=Prochlorococcus marinus (strain NATL2A) GN=glgA PE=3 SV=1 1168 1559 2.0E-09
sp|Q5H6Q4|GLGA_XANOR Glycogen synthase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=glgA PE=3 SV=2 1282 1559 2.0E-09
sp|Q2P9F6|GLGA_XANOM Glycogen synthase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=glgA PE=3 SV=1 1282 1559 2.0E-09
sp|A2C167|GLGA_PROM1 Glycogen synthase OS=Prochlorococcus marinus (strain NATL1A) GN=glgA PE=3 SV=1 1168 1559 2.0E-09
sp|Q3BYI1|GLGA_XANC5 Glycogen synthase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=glgA PE=3 SV=2 1282 1559 2.0E-09
sp|Q74ED9|GLGA1_GEOSL Glycogen synthase 1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=glgA1 PE=3 SV=1 1254 1625 2.0E-09
sp|Q43134|SSG1_SORBI Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Sorghum bicolor GN=WAXY PE=2 SV=1 1402 1559 2.0E-09
sp|Q4KCP0|GLGA_PSEF5 Glycogen synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=glgA PE=3 SV=2 1108 1587 3.0E-09
sp|O82627|SSG1_ANTMA Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Antirrhinum majus GN=WAXY PE=2 SV=1 1425 1559 3.0E-09
sp|Q01117|AMY1_LIPKO Alpha-amylase 1 OS=Lipomyces kononenkoae GN=LKA1 PE=1 SV=2 53 517 4.0E-09
sp|Q2RS50|GLGA_RHORT Glycogen synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=glgA PE=3 SV=1 1281 1559 4.0E-09
sp|B9M2J2|GLGA_GEODF Glycogen synthase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=glgA PE=3 SV=1 1281 1559 4.0E-09
sp|Q97GX6|GLGA_CLOAB Glycogen synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=glgA PE=3 SV=1 1168 1559 5.0E-09
sp|Q165E4|GLGA_ROSDO Glycogen synthase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=glgA PE=3 SV=1 1281 1559 5.0E-09
sp|A5GBI7|GLGA_GEOUR Glycogen synthase OS=Geobacter uraniireducens (strain Rf4) GN=glgA PE=3 SV=1 1281 1559 6.0E-09
sp|Q6Z2T8|SSY22_ORYSJ Soluble starch synthase 2-2, chloroplastic/amyloplastic OS=Oryza sativa subsp. japonica GN=SSII-2 PE=2 SV=2 1168 1559 6.0E-09
sp|P04713|SSG1_MAIZE Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Zea mays GN=WAXY PE=3 SV=1 1415 1559 6.0E-09
sp|Q5NXZ7|GLGA_AROAE Glycogen synthase OS=Aromatoleum aromaticum (strain EbN1) GN=glgA PE=3 SV=1 1281 1559 7.0E-09
sp|Q7UPY2|GLGA_RHOBA Glycogen synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=glgA PE=3 SV=1 1236 1560 7.0E-09
sp|B1I4F5|GLGA_DESAP Glycogen synthase OS=Desulforudis audaxviator (strain MP104C) GN=glgA PE=3 SV=1 1281 1628 7.0E-09
sp|O13996|YEI1_SCHPO Uncharacterized glycosyl hydrolase C27E2.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC27E2.01 PE=3 SV=1 40 256 9.0E-09
sp|Q3A0B8|GLGA_PELCD Glycogen synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=glgA PE=3 SV=1 1281 1559 9.0E-09
sp|Q00775|SSG1_SOLTU Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Solanum tuberosum GN=WAXY PE=1 SV=1 1425 1559 1.0E-08
sp|Q9MAQ0|SSG1_ARATH Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Arabidopsis thaliana GN=GBSS1 PE=1 SV=1 1425 1559 1.0E-08
sp|Q82SP3|GLGA_NITEU Glycogen synthase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=glgA PE=3 SV=1 1281 1559 2.0E-08
sp|A6LJ53|GLGA_THEM4 Glycogen synthase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=glgA PE=3 SV=1 1154 1560 2.0E-08
sp|P58393|GLGA1_RHIME Glycogen synthase 1 OS=Rhizobium meliloti (strain 1021) GN=glgA1 PE=3 SV=1 1281 1559 2.0E-08
sp|B1Y0P9|GLGA_LEPCP Glycogen synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=glgA PE=3 SV=1 1282 1559 2.0E-08
sp|P09842|SSG1_HORVU Granule-bound starch synthase 1, chloroplastic/amyloplastic OS=Hordeum vulgare GN=WAXY PE=1 SV=1 1402 1559 2.0E-08
sp|Q2RH55|GLGA_MOOTA Glycogen synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=glgA PE=3 SV=1 1281 1559 3.0E-08
sp|Q0I9Y8|GLGA_SYNS3 Glycogen synthase OS=Synechococcus sp. (strain CC9311) GN=glgA PE=3 SV=1 1168 1559 3.0E-08
sp|P05618|CDGT_BACS0 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 1011) GN=cgt PE=1 SV=1 51 173 4.0E-08
sp|P09121|CDGT_BACS3 Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 38-2) GN=cgt PE=1 SV=2 51 173 4.0E-08
sp|A0Q596|GLGA_FRATN Glycogen synthase OS=Francisella tularensis subsp. novicida (strain U112) GN=glgA PE=3 SV=1 1168 1560 5.0E-08
sp|P74521|GLGA1_SYNY3 Glycogen synthase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=glgA1 PE=3 SV=1 1281 1580 5.0E-08
sp|A7H6L1|GLGA_ANADF Glycogen synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=glgA PE=3 SV=1 1282 1559 6.0E-08
sp|P45179|GLGA_HAEIN Glycogen synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=glgA PE=3 SV=1 1281 1559 6.0E-08
sp|A8F720|GLGA_PSELT Glycogen synthase OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=glgA PE=3 SV=1 1255 1585 7.0E-08
sp|Q39XS5|GLGA1_GEOMG Glycogen synthase 1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=glgA1 PE=3 SV=1 1281 1625 7.0E-08
sp|P19531|AMYM_GEOSE Maltogenic alpha-amylase OS=Geobacillus stearothermophilus GN=amyM PE=1 SV=2 65 237 8.0E-08
sp|Q0DDE3|SSY23_ORYSJ Soluble starch synthase 2-3, chloroplastic/amyloplastic OS=Oryza sativa subsp. japonica GN=SSII-3 PE=1 SV=1 1168 1559 1.0E-07
sp|P0C586|SSY23_ORYSI Soluble starch synthase 2-3, chloroplastic/amyloplastic OS=Oryza sativa subsp. indica GN=SSII-3 PE=1 SV=1 1168 1559 1.0E-07
sp|A5UEJ5|GLGA_HAEIG Glycogen synthase OS=Haemophilus influenzae (strain PittGG) GN=glgA PE=3 SV=1 1281 1559 1.0E-07
sp|A5UBW8|GLGA_HAEIE Glycogen synthase OS=Haemophilus influenzae (strain PittEE) GN=glgA PE=3 SV=1 1281 1559 1.0E-07
sp|Q08751|NEPU2_THEVU Neopullulanase 2 OS=Thermoactinomyces vulgaris GN=tvaII PE=1 SV=1 55 180 1.0E-07
sp|A1TRG5|GLGA_ACIAC Glycogen synthase OS=Acidovorax citrulli (strain AAC00-1) GN=glgA PE=3 SV=1 1281 1539 1.0E-07
sp|Q08341|CDAS_LYSSH Cyclomaltodextrinase OS=Lysinibacillus sphaericus PE=1 SV=1 65 172 1.0E-07
sp|Q2IM81|GLGA_ANADE Glycogen synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=glgA PE=3 SV=1 1160 1559 1.0E-07
sp|B3PGN5|GLGA_CELJU Glycogen synthase OS=Cellvibrio japonicus (strain Ueda107) GN=glgA PE=3 SV=1 1168 1559 2.0E-07
sp|Q8A1G0|SUSA_BACTN Neopullulanase SusA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=susA PE=3 SV=1 35 255 2.0E-07
sp|P08704|CDGT_KLEOX Cyclomaltodextrin glucanotransferase OS=Klebsiella oxytoca GN=cgt PE=3 SV=1 45 164 2.0E-07
sp|A1JSI5|GLGA_YERE8 Glycogen synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=glgA PE=3 SV=1 1281 1559 3.0E-07
sp|Q7VBP0|GLGA_PROMA Glycogen synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=glgA PE=3 SV=1 1168 1559 4.0E-07
sp|O06988|BBMA_BACSU Intracellular maltogenic amylase OS=Bacillus subtilis (strain 168) GN=bbmA PE=3 SV=2 65 172 4.0E-07
sp|O42918|AMY4_SCHPO Alpha-amylase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=meu7 PE=1 SV=1 55 216 4.0E-07
sp|B3H0J4|GLGA_ACTP7 Glycogen synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=glgA PE=3 SV=1 1281 1559 5.0E-07
sp|A3MZ67|GLGA_ACTP2 Glycogen synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=glgA PE=3 SV=1 1281 1559 5.0E-07
sp|A1U0K2|GLGA_MARHV Glycogen synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=glgA PE=3 SV=1 1281 1559 5.0E-07
sp|P31835|CDGT2_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans PE=1 SV=1 58 173 5.0E-07
sp|P58394|GLGA2_RHIME Glycogen synthase 2 OS=Rhizobium meliloti (strain 1021) GN=glgA2 PE=3 SV=1 1168 1559 5.0E-07
sp|Q2YB48|GLGA_NITMU Glycogen synthase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=glgA PE=3 SV=1 1281 1539 9.0E-07
sp|Q91WV7|SLC31_MOUSE Neutral and basic amino acid transport protein rBAT OS=Mus musculus GN=Slc3a1 PE=1 SV=1 59 180 1.0E-06
sp|Q47IJ4|GLGA_DECAR Glycogen synthase OS=Dechloromonas aromatica (strain RCB) GN=glgA PE=3 SV=1 1281 1560 1.0E-06
sp|Q9R9H8|BBMA_BACIU Intracellular maltogenic amylase OS=Bacillus subtilis GN=bbmA PE=1 SV=2 65 172 1.0E-06
sp|Q7NM37|GLGA_GLOVI Glycogen synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=glgA PE=3 SV=1 1279 1595 1.0E-06
sp|Q64319|SLC31_RAT Neutral and basic amino acid transport protein rBAT OS=Rattus norvegicus GN=Slc3a1 PE=1 SV=1 59 180 1.0E-06
sp|Q8XPA1|GLGA_CLOPE Glycogen synthase OS=Clostridium perfringens (strain 13 / Type A) GN=glgA PE=3 SV=1 1148 1559 1.0E-06
sp|P31747|CDGT_BACSS Cyclomaltodextrin glucanotransferase OS=Bacillus sp. (strain 6.6.3) GN=cgt PE=3 SV=1 65 173 1.0E-06
sp|P36905|APU_THESA Amylopullulanase OS=Thermoanaerobacterium saccharolyticum GN=apu PE=3 SV=2 77 187 1.0E-06
sp|P30920|CDGT1_BACCI Cyclomaltodextrin glucanotransferase OS=Bacillus circulans PE=1 SV=1 51 173 1.0E-06
sp|P14014|CDGT_BACLI Cyclomaltodextrin glucanotransferase OS=Bacillus licheniformis GN=cgtA PE=3 SV=1 51 173 2.0E-06
sp|O66935|GLGA_AQUAE Glycogen synthase OS=Aquifex aeolicus (strain VF5) GN=glgA PE=3 SV=1 1279 1559 2.0E-06
sp|B0TD37|GLGA_HELMI Glycogen synthase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=glgA PE=3 SV=1 1281 1559 2.0E-06
sp|B8EN59|GLGA_METSB Glycogen synthase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=glgA PE=3 SV=1 1281 1559 2.0E-06
sp|A0PVZ1|MSHA_MYCUA D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=mshA PE=3 SV=1 1410 1625 2.0E-06
sp|Q2JRJ4|GLGA2_SYNJA Glycogen synthase 2 OS=Synechococcus sp. (strain JA-3-3Ab) GN=glgA2 PE=3 SV=1 1281 1559 2.0E-06
sp|P04830|CDGT1_PAEMA Cyclomaltodextrin glucanotransferase OS=Paenibacillus macerans GN=cgtM PE=1 SV=2 65 173 2.0E-06
sp|P30292|AMY_ASPSH Alpha-amylase OS=Aspergillus shirousami GN=amy PE=1 SV=1 58 178 3.0E-06
sp|P0C1B3|AMYA1_ASPOR Alpha-amylase A type-1/2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy1 PE=1 SV=1 58 178 3.0E-06
sp|B2HQV2|MSHA_MYCMM D-inositol 3-phosphate glycosyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=mshA PE=3 SV=1 1410 1625 3.0E-06
sp|Q02906|AMYB_ASPAW Alpha-amylase B OS=Aspergillus awamori GN=amyB PE=3 SV=1 58 178 3.0E-06
sp|A4SIE1|GLGA_AERS4 Glycogen synthase OS=Aeromonas salmonicida (strain A449) GN=glgA PE=3 SV=1 1227 1559 3.0E-06
sp|C7QKE8|MSHA2_CATAD D-inositol 3-phosphate glycosyltransferase 2 OS=Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC 102108 / JCM 14897) GN=mshA2 PE=3 SV=1 1410 1560 3.0E-06
sp|P93568|SSY1_SOLTU Soluble starch synthase 1, chloroplastic/amyloplastic OS=Solanum tuberosum PE=2 SV=1 1424 1597 4.0E-06
sp|Q02905|AMYA_ASPAW Alpha-amylase A OS=Aspergillus awamori GN=amyA PE=3 SV=1 58 178 4.0E-06
sp|P32818|AMYM_BACAD Maltogenic alpha-amylase OS=Bacillus acidopullulyticus PE=3 SV=1 65 348 4.0E-06
sp|P16950|APU_THETY Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus GN=apu PE=1 SV=1 98 187 5.0E-06
sp|Q9K8U9|O16G_BACHD Oligo-1,6-glucosidase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=malL PE=3 SV=1 100 194 5.0E-06
sp|B4ULD8|GLGA_ANASK Glycogen synthase OS=Anaeromyxobacter sp. (strain K) GN=glgA PE=3 SV=1 1169 1559 6.0E-06
sp|P38939|APU_THEP3 Amylopullulanase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=apu PE=1 SV=2 65 187 6.0E-06
sp|Q21BQ1|GLGA_RHOPB Glycogen synthase OS=Rhodopseudomonas palustris (strain BisB18) GN=glgA PE=3 SV=1 1281 1559 7.0E-06
sp|D6Z995|MSHA_SEGRD D-inositol 3-phosphate glycosyltransferase OS=Segniliparus rotundus (strain ATCC BAA-972 / CDC 1076 / CIP 108378 / DSM 44985 / JCM 13578) GN=mshA PE=3 SV=1 1426 1559 7.0E-06
sp|P0C1B4|AMYA3_ASPOR Alpha-amylase A type-3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=amy3 PE=3 SV=1 58 178 9.0E-06
sp|Q08806|AMY2_SCHOC Alpha-amylase 2 OS=Schwanniomyces occidentalis GN=SWA2 PE=3 SV=1 59 246 9.0E-06
sp|P08137|AMY_BACCI Alpha-amylase OS=Bacillus circulans PE=3 SV=1 45 173 9.0E-06
sp|P29094|O16G_GEOTM Oligo-1,6-glucosidase OS=Geobacillus thermoglucosidasius GN=malL PE=1 SV=1 100 180 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016757 glycosyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 1068 1090 22
2 1896 1918 22
3 1928 1947 19
4 1954 1976 22
5 1986 2008 22
6 2020 2042 22
7 2057 2079 22
8 2140 2162 22
9 2195 2217 22
10 2238 2260 22
11 2288 2310 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|057010
MRLLSALSALSFLAQLVAASPWREDLVDYNLNVNKNANSPLEYDAERPNSTYTPSPQNWRALPTYTILLDKFADG
DPTNNDYFGTPYESDYRETQLRYGGDLRGLELRLDYLQGMGIKIVFLSGTPFVNMLWQADSYSPLDFSVLDPHWG
KISDWRHLIDEIHARGMYFMADFTVGTMSDLIAFEGYQNTSTPFSTDEHTALWKNPDYMPWNFTEYRDFTIRNEH
NSSCELPKFWDDSGSLVDVRTNGCMTSDFDQYGDMEAFGVHPDWQRQLAKFASVQDRLREWQPSVMDRIKVFSCL
AIKALDIDSIRVDKATQVTVDALATWASSTRACAAGLGKNNFYIAGEITGGDTFGSLYLGRGRTPTQLPPGFLAA
ANLTSDQDEFFLRDAPLNGLDGAAFHYSIYRSLSRFLGMDGNLQVAYDLDVNFVTAWNQMFVNNDFLNAQNGKLD
PRHMFGTSNFDVFRWPSLENGTQRSVLATFITNLVMPGIPLFYYGEEQNFYLYDNGASNYLYGRQAMISTPTWKR
HGCYTLGSEQYFNMPLEKALFGCYDDWNALDHFDPTTDSRRLMAHFLHLRQVYGSLQDGFNLVQRGNWTYRIERP
GSNGTQTEMGLWSVSRAGLPGIQNLTGTFNDQVWLLYTNENSTKTWSYDCKQDLWISSPYTSDTIVRNLFPPYET
YSLKESLSAFNNDSKAPWFGCLGQVTMEPYGFKVLVPQEQWVAHPPTITKFNPGHDHRLLVDPNDVNATTVDVSI
EFNIPMDCQGVTDSITLNATTSGKGGQPSITNVKCGTVSNPDPAKIVGVDVSSWSWSATLTDLADGVLTLTVNNP
PARSGNATTGTKDHLLLRKGAANNVVVFPENDYDTKDSFKFSDGKYTFEHKAFGADKLRFSWNFGKNWTEWRNWE
DTTTIEASVFQQSENFWDGDHIMVQYWSEATLSVAAVVHADTQYSGPQRRMPQLLVRGPYNHWGFDQGLPTKMEL
NQDGKWELELMASWPTYVQINVWGYDDYYYGDADGDGVLDRLPPNSVAPNYLNMSAPPKPHLAWSLLIDDATMTW
SLEPRGQAAVGVVMYSLLLSIPLITGVLAVVIFMWTFYGIKHNQYGVKAKNHSTYFPILAALGNKSTTDFKDTSA
MSEKIFGHKQPTEIIGWPEAKNKRRKVLIATLEYEIIDWKMKVKIGGLGVMSSLMGKAMTDVDLVWVVPKVKDLD
YPAGDPAEPIEVIIFGEPYLIEVETHQLDNITYVIVDSPVFRAQTKSDPYPSRMDDLSSAIFYSTWNQAIAATIR
RFPDIDIYHINDYHGALAPIYLLPKVMPTCLSLHNAEFQGLWPLRTKEEMKEVCSAFNISKEHCTKYVQFGNTFN
LLHAGASFISTHQKSVGVAGVSDKYGKRSWARYPALWTLKHVDSLPNPDPSDIAALDETPMKAKDVQIDEEAEAA
RPELKRQAQEWAGIKQDPDSDLFVFVGRWSKQKGVDVIADVMPSLLEKRPSIQLIAVGPVIDLYGRFAAEKLARL
MEMYPDRVYSKPEFTALPPYLFSGADFALIPSRDEPFGLVAVEFGRKGALGVGSRLGGLGLMPGWWFPVESSSTA
HLISQLTKTIKMALRSTEEERAILRARSAVQRFPVVEWRQRMEDLHKRSITLSRHLSGTNAWRPGDGGGAGMRTM
ADTDDWDPVTQAYPNQPDWDTGSVNSYMNSPAHRSQESVAQVPRIGGDEDYFSQKGGTHSNQGYTDFLERANRVI
AKDNKGAPDPFSDGGLSPSRPFGDHSRVSSVESISSIVEEKSNSPLNKAIASFTDADGGVASEFVQKLQMLDAKN
SARELSIEKYLTKSEEAFFGKVRKDKLSSAASIISSQRESVWGTPSPSIYSRPDSPSTHVFSHTEYDGNLQNDSP
QPNVVPMTRLQIAMSREIAGWPLYTIVIALGQMLSATSFQITLLTGRNSQDDLQLYVLGAVFLVASAIWYPMFRL
KPSIYVLSLPWIFFGLAFFLIGLPSVGSVFVPAHQGLASAATWAYAVASSAGFLFFGLNFGEEAGAATEVWTMRA
CIVQGSQQIWVAALWYWGNSLNGQSADNIPPWWICVIVWPLACLSLLFAYVMLYGLPEYYRQTPPKVPHFLKTLF
RRKLVLWFLASEILRDYWLSGPYGRNWAFLWSVNVPKWQILLLVITFFIFVWALMLLVLTHFSKTHTWLLPVFAV
GLGAPRWCQMLWGTSSLALYIPWAGSGGPYLGISLWLWLGVLDAIQGVGLGMILLQTLSRLHVCATLAFAQIIGS
VCVMIARATAPNRLGPGSVFPDASKWDFSDGLEGSPMASAPFWVALICQLIIVLGYFWFYRKEQLARP*
Coding >Agabi119p4|057010
ATGCGGCTTTTGTCCGCGCTCTCCGCTCTCTCCTTCCTCGCCCAGCTCGTGGCCGCCTCTCCCTGGCGTGAAGAC
CTAGTAGACTACAACCTCAACGTCAACAAGAACGCAAACTCCCCCCTCGAATATGATGCTGAGCGTCCCAATTCA
ACCTACACCCCATCGCCCCAAAACTGGCGTGCCCTTCCCACATACACTATCCTCCTAGACAAGTTTGCAGATGGT
GACCCTACCAACAACGACTACTTCGGCACTCCCTACGAGTCCGACTACCGTGAAACTCAGCTTCGTTATGGAGGC
GACCTCCGGGGTTTGGAATTACGCCTCGATTATCTACAGGGCATGGGCATCAAAATCGTTTTTCTCTCCGGTACC
CCCTTTGTCAACATGCTCTGGCAAGCCGATAGTTATTCACCTCTCGACTTCAGCGTCCTTGACCCGCACTGGGGA
AAAATCAGTGATTGGCGCCATCTGATCGACGAAATCCATGCCCGCGGCATGTACTTTATGGCCGATTTCACTGTC
GGCACCATGTCCGATCTTATCGCATTCGAAGGTTATCAAAACACAAGTACTCCCTTCAGCACTGACGAGCACACT
GCCCTCTGGAAAAATCCGGACTATATGCCATGGAATTTTACCGAGTACCGTGATTTTACGATTCGCAATGAACAC
AACTCTTCCTGTGAGTTGCCCAAGTTTTGGGATGACTCAGGATCACTTGTAGACGTACGGACAAACGGTTGCATG
ACGTCCGATTTTGACCAGTATGGAGACATGGAAGCCTTCGGTGTGCATCCCGATTGGCAGCGCCAGCTTGCAAAA
TTCGCTTCGGTACAGGATCGTCTTCGCGAGTGGCAACCATCGGTAATGGACAGGATCAAAGTCTTTTCTTGCCTC
GCTATCAAAGCCCTCGACATCGATTCTATTCGGGTTGACAAGGCCACTCAAGTTACCGTTGATGCCCTTGCTACA
TGGGCTTCCAGTACGAGAGCATGTGCCGCAGGCCTCGGCAAAAACAATTTCTACATCGCAGGCGAGATTACAGGT
GGTGACACTTTTGGTTCTCTATACCTTGGCCGTGGCCGCACCCCGACCCAGCTTCCTCCAGGATTCTTGGCAGCA
GCAAACCTCACTTCGGATCAGGATGAATTTTTCCTCAGGGATGCCCCCCTCAATGGTTTGGATGGCGCAGCGTTC
CATTATTCAATCTACCGTTCGCTTTCGCGTTTCCTTGGAATGGACGGCAATCTTCAAGTTGCCTATGACCTTGAT
GTCAACTTTGTCACAGCCTGGAATCAGATGTTCGTAAACAATGATTTTCTCAATGCGCAAAACGGCAAGCTCGAC
CCCCGTCATATGTTCGGGACCAGCAACTTTGATGTTTTCCGTTGGCCTAGTCTAGAGAATGGGACACAGAGAAGC
GTCTTAGCTACTTTCATCACTAACTTGGTCATGCCTGGAATCCCTTTGTTTTATTATGGTGAAGAGCAAAACTTC
TATTTGTATGACAATGGCGCTTCCAATTATCTATATGGCCGGCAAGCGATGATCAGTACCCCTACCTGGAAACGC
CATGGTTGCTACACCTTGGGCTCTGAGCAGTACTTTAACATGCCATTAGAGAAGGCTTTATTCGGTTGTTACGAT
GATTGGAATGCACTCGATCATTTTGATCCGACTACTGACAGTCGCCGGCTCATGGCCCATTTCCTCCATTTACGA
CAGGTGTATGGCTCCCTTCAAGACGGTTTCAACCTCGTACAACGTGGAAATTGGACGTATCGGATTGAGCGACCC
GGATCTAATGGGACTCAGACTGAAATGGGCCTATGGTCTGTTTCACGTGCTGGACTTCCAGGTATTCAGAATTTG
ACTGGGACGTTCAATGATCAAGTTTGGTTGCTGTACACGAATGAAAATTCGACCAAGACGTGGAGTTACGACTGC
AAACAGGATTTGTGGATTTCGTCGCCCTATACCTCCGATACTATTGTGCGGAATCTCTTCCCTCCCTACGAAACT
TACTCCCTCAAGGAGTCGTTGTCCGCTTTCAATAATGACAGCAAGGCACCATGGTTTGGCTGTCTTGGACAGGTA
ACTATGGAACCTTACGGATTCAAGGTCCTCGTACCTCAGGAACAATGGGTTGCACATCCTCCTACCATCACCAAA
TTCAATCCCGGTCATGATCACCGCCTTCTCGTTGATCCCAATGACGTGAATGCGACCACCGTCGATGTCTCGATA
GAGTTCAATATCCCCATGGACTGCCAAGGTGTCACAGACAGTATTACTCTGAACGCAACTACATCCGGAAAAGGC
GGACAACCGAGCATCACAAATGTAAAATGTGGAACTGTGTCGAATCCAGATCCTGCTAAAATTGTCGGTGTCGAT
GTATCTTCCTGGTCCTGGTCTGCGACTTTGACAGATCTCGCGGATGGAGTTTTGACACTCACTGTCAACAATCCG
CCAGCACGAAGTGGTAATGCTACGACGGGGACGAAAGATCATCTGCTGCTACGCAAGGGCGCCGCCAATAATGTG
GTAGTTTTCCCCGAGAACGATTATGATACCAAGGACTCGTTCAAGTTCTCCGACGGAAAATACACCTTTGAACAT
AAGGCCTTCGGCGCTGACAAATTAAGGTTCTCGTGGAACTTTGGAAAAAATTGGACAGAGTGGAGAAACTGGGAA
GATACCACTACCATCGAGGCTTCGGTCTTCCAGCAGTCTGAAAATTTCTGGGACGGTGATCACATTATGGTACAA
TACTGGAGCGAAGCCACACTTTCTGTTGCCGCGGTTGTGCATGCTGACACGCAGTATTCCGGTCCTCAGCGCCGC
ATGCCCCAACTTCTTGTTCGTGGTCCCTACAATCATTGGGGCTTTGATCAAGGTTTACCAACCAAGATGGAGTTG
AACCAAGACGGCAAATGGGAGCTTGAGCTTATGGCTTCCTGGCCGACTTATGTTCAGATCAACGTCTGGGGCTAC
GACGATTATTATTATGGTGATGCCGACGGTGATGGTGTCTTGGATCGTCTTCCACCGAATAGTGTCGCGCCGAAT
TACCTTAATATGTCTGCTCCCCCAAAACCACATCTCGCTTGGTCACTGCTCATCGATGATGCCACCATGACATGG
TCACTAGAGCCCCGCGGTCAAGCTGCCGTCGGAGTCGTCATGTATTCCCTCCTCCTCTCGATACCCCTTATTACC
GGTGTTCTTGCCGTTGTCATCTTCATGTGGACTTTCTATGGAATCAAACATAATCAGTATGGCGTTAAAGCGAAG
AATCATTCAACCTATTTCCCCATTCTAGCAGCTCTTGGAAACAAATCTACTACGGACTTCAAGGATACCTCGGCG
ATGTCAGAGAAAATATTTGGACATAAACAACCTACAGAAATAATTGGATGGCCAGAAGCCAAAAACAAACGGAGA
AAAGTGCTGATCGCGACTTTGGAATACGAAATCATCGACTGGAAGATGAAGGTCAAGATTGGTGGTCTCGGTGTC
ATGTCAAGTCTGATGGGCAAAGCTATGACAGACGTTGATCTTGTGTGGGTAGTTCCTAAGGTCAAAGACCTAGAT
TACCCTGCTGGGGATCCCGCGGAACCCATCGAGGTCATCATCTTTGGCGAACCTTACCTCATTGAAGTCGAGACT
CATCAACTGGACAACATCACCTACGTTATCGTCGACAGCCCTGTCTTCCGTGCTCAGACAAAGTCAGATCCTTAC
CCGTCCCGTATGGACGATCTTAGCTCTGCGATCTTTTATTCGACTTGGAATCAAGCCATAGCGGCCACTATTCGG
CGATTCCCTGACATTGACATCTATCACATCAATGACTACCATGGAGCGCTCGCGCCCATCTACCTCCTTCCGAAA
GTTATGCCCACCTGTTTGTCGTTGCATAATGCCGAGTTCCAGGGTTTATGGCCGTTGCGAACGAAAGAAGAGATG
AAGGAAGTTTGTTCAGCATTCAACATCAGCAAAGAACACTGCACGAAATATGTTCAATTCGGGAACACGTTCAAT
CTGTTACACGCCGGCGCGTCGTTCATTAGTACACACCAAAAGAGTGTTGGTGTAGCTGGTGTGTCTGACAAGTAT
GGTAAACGGAGTTGGGCGAGGTATCCTGCACTGTGGACGTTGAAGCATGTTGATTCACTTCCTAATCCTGATCCG
TCTGATATTGCGGCGTTGGACGAAACACCCATGAAAGCTAAAGATGTACAAATTGATGAAGAGGCTGAAGCTGCG
AGGCCGGAGTTAAAGAGGCAGGCACAGGAATGGGCTGGCATCAAACAGGATCCTGATTCTGATTTGTTTGTGTTC
GTTGGTCGTTGGTCGAAACAGAAAGGTGTTGATGTGATTGCTGATGTTATGCCTTCATTACTTGAGAAAAGACCT
TCGATTCAACTGATTGCGGTTGGTCCTGTCATCGATCTGTATGGAAGATTTGCAGCGGAAAAGTTGGCCAGGTTG
ATGGAGATGTACCCTGATCGCGTTTACTCCAAGCCAGAATTTACTGCTCTACCTCCTTATCTATTCAGTGGAGCT
GACTTCGCTTTGATTCCCTCTCGTGATGAACCGTTCGGTCTTGTGGCCGTTGAATTCGGAAGGAAAGGTGCTCTT
GGTGTGGGCTCGCGTTTGGGTGGTCTTGGTCTCATGCCTGGTTGGTGGTTCCCTGTCGAATCAAGCTCCACTGCT
CATCTAATCTCACAATTGACGAAAACCATCAAGATGGCTTTGAGGTCTACAGAAGAAGAGCGTGCAATACTTCGC
GCCCGTTCAGCAGTCCAGAGATTCCCTGTCGTCGAGTGGCGCCAAAGGATGGAAGATCTACATAAACGGAGTATC
ACACTAAGTCGACATTTATCTGGCACGAATGCCTGGAGGCCTGGCGATGGTGGAGGTGCTGGTATGCGTACTATG
GCCGACACGGATGATTGGGACCCGGTTACACAAGCTTATCCTAATCAACCTGACTGGGATACTGGCAGTGTGAAT
AGTTACATGAATTCACCTGCGCATAGGAGTCAAGAGTCGGTGGCACAGGTACCTCGGATTGGCGGCGACGAAGAC
TACTTTAGTCAAAAGGGCGGCACCCATTCGAATCAGGGATATACCGATTTTCTGGAGAGGGCAAATAGAGTAATT
GCAAAAGACAACAAAGGCGCACCGGACCCATTTTCGGACGGCGGCCTATCGCCTTCAAGGCCTTTCGGTGATCAT
TCACGGGTATCTTCTGTGGAGTCTATTTCTTCAATCGTTGAAGAGAAGTCAAATTCGCCGCTGAATAAAGCGATT
GCTTCGTTCACGGACGCTGACGGTGGTGTTGCTTCTGAATTCGTTCAAAAACTCCAAATGCTCGACGCCAAGAAT
TCTGCACGGGAGCTATCGATTGAAAAATACCTCACGAAAAGTGAAGAAGCATTCTTTGGCAAAGTGCGAAAGGAC
AAACTCTCTAGTGCTGCTAGTATCATATCGTCTCAACGTGAATCCGTCTGGGGTACTCCGTCACCCTCTATCTAT
TCTCGTCCTGATTCACCCAGCACGCATGTATTCTCGCACACAGAATATGATGGCAATCTTCAAAATGATTCTCCT
CAGCCTAACGTGGTTCCCATGACTCGCTTGCAAATTGCCATGTCACGAGAAATTGCGGGGTGGCCATTGTATACC
ATTGTCATAGCTCTGGGCCAAATGCTGAGTGCAACGAGCTTCCAGATTACCTTGCTTACAGGTCGCAACAGCCAA
GACGATTTACAGCTCTATGTCCTTGGCGCTGTTTTCCTTGTAGCGTCCGCAATTTGGTACCCTATGTTCCGCTTG
AAACCTTCTATCTACGTGCTGTCCTTGCCTTGGATATTCTTTGGTCTAGCCTTCTTCCTTATTGGTCTTCCCTCG
GTCGGTTCTGTCTTCGTTCCCGCCCATCAAGGTTTAGCAAGTGCTGCAACGTGGGCATATGCCGTGGCATCCTCA
GCTGGATTCTTGTTCTTTGGTCTTAATTTCGGTGAAGAAGCCGGAGCTGCTACGGAGGTTTGGACAATGCGGGCC
TGCATCGTTCAAGGTTCTCAACAGATTTGGGTCGCTGCATTGTGGTATTGGGGCAACTCACTCAATGGCCAGTCA
GCTGATAACATTCCACCTTGGTGGATCTGTGTGATTGTCTGGCCACTGGCCTGTTTGAGCCTCCTCTTCGCCTAC
GTCATGCTCTATGGCTTACCGGAATACTATCGTCAAACACCACCAAAAGTACCTCATTTCCTCAAAACACTCTTC
CGTCGCAAGCTGGTTCTTTGGTTCCTCGCTTCAGAAATTCTACGGGACTACTGGCTAAGTGGACCGTATGGACGC
AACTGGGCCTTCCTTTGGAGTGTGAATGTGCCGAAATGGCAGATTCTGTTGCTCGTAATCACATTTTTCATATTC
GTTTGGGCTCTTATGCTACTCGTCCTCACACACTTCAGTAAAACACATACCTGGTTGCTTCCCGTCTTCGCTGTT
GGCCTTGGCGCTCCTCGGTGGTGCCAAATGTTATGGGGAACATCATCACTCGCACTCTACATACCTTGGGCTGGC
TCAGGAGGTCCTTATCTCGGCATCTCACTGTGGTTATGGTTGGGGGTCCTAGATGCTATCCAAGGTGTTGGCTTG
GGAATGATTCTGCTGCAGACATTGTCCCGCCTTCATGTTTGTGCCACGCTTGCATTTGCCCAGATTATCGGTTCC
GTTTGTGTCATGATCGCACGTGCAACTGCTCCCAATCGTCTTGGACCCGGATCCGTATTCCCAGATGCCTCAAAA
TGGGACTTTAGCGATGGTCTTGAAGGGAGTCCAATGGCATCTGCACCCTTCTGGGTCGCTCTTATCTGCCAATTA
ATTATTGTTCTCGGCTATTTCTGGTTTTACCGCAAAGAGCAACTTGCACGGCCATAA
Transcript >Agabi119p4|057010
ATGCGGCTTTTGTCCGCGCTCTCCGCTCTCTCCTTCCTCGCCCAGCTCGTGGCCGCCTCTCCCTGGCGTGAAGAC
CTAGTAGACTACAACCTCAACGTCAACAAGAACGCAAACTCCCCCCTCGAATATGATGCTGAGCGTCCCAATTCA
ACCTACACCCCATCGCCCCAAAACTGGCGTGCCCTTCCCACATACACTATCCTCCTAGACAAGTTTGCAGATGGT
GACCCTACCAACAACGACTACTTCGGCACTCCCTACGAGTCCGACTACCGTGAAACTCAGCTTCGTTATGGAGGC
GACCTCCGGGGTTTGGAATTACGCCTCGATTATCTACAGGGCATGGGCATCAAAATCGTTTTTCTCTCCGGTACC
CCCTTTGTCAACATGCTCTGGCAAGCCGATAGTTATTCACCTCTCGACTTCAGCGTCCTTGACCCGCACTGGGGA
AAAATCAGTGATTGGCGCCATCTGATCGACGAAATCCATGCCCGCGGCATGTACTTTATGGCCGATTTCACTGTC
GGCACCATGTCCGATCTTATCGCATTCGAAGGTTATCAAAACACAAGTACTCCCTTCAGCACTGACGAGCACACT
GCCCTCTGGAAAAATCCGGACTATATGCCATGGAATTTTACCGAGTACCGTGATTTTACGATTCGCAATGAACAC
AACTCTTCCTGTGAGTTGCCCAAGTTTTGGGATGACTCAGGATCACTTGTAGACGTACGGACAAACGGTTGCATG
ACGTCCGATTTTGACCAGTATGGAGACATGGAAGCCTTCGGTGTGCATCCCGATTGGCAGCGCCAGCTTGCAAAA
TTCGCTTCGGTACAGGATCGTCTTCGCGAGTGGCAACCATCGGTAATGGACAGGATCAAAGTCTTTTCTTGCCTC
GCTATCAAAGCCCTCGACATCGATTCTATTCGGGTTGACAAGGCCACTCAAGTTACCGTTGATGCCCTTGCTACA
TGGGCTTCCAGTACGAGAGCATGTGCCGCAGGCCTCGGCAAAAACAATTTCTACATCGCAGGCGAGATTACAGGT
GGTGACACTTTTGGTTCTCTATACCTTGGCCGTGGCCGCACCCCGACCCAGCTTCCTCCAGGATTCTTGGCAGCA
GCAAACCTCACTTCGGATCAGGATGAATTTTTCCTCAGGGATGCCCCCCTCAATGGTTTGGATGGCGCAGCGTTC
CATTATTCAATCTACCGTTCGCTTTCGCGTTTCCTTGGAATGGACGGCAATCTTCAAGTTGCCTATGACCTTGAT
GTCAACTTTGTCACAGCCTGGAATCAGATGTTCGTAAACAATGATTTTCTCAATGCGCAAAACGGCAAGCTCGAC
CCCCGTCATATGTTCGGGACCAGCAACTTTGATGTTTTCCGTTGGCCTAGTCTAGAGAATGGGACACAGAGAAGC
GTCTTAGCTACTTTCATCACTAACTTGGTCATGCCTGGAATCCCTTTGTTTTATTATGGTGAAGAGCAAAACTTC
TATTTGTATGACAATGGCGCTTCCAATTATCTATATGGCCGGCAAGCGATGATCAGTACCCCTACCTGGAAACGC
CATGGTTGCTACACCTTGGGCTCTGAGCAGTACTTTAACATGCCATTAGAGAAGGCTTTATTCGGTTGTTACGAT
GATTGGAATGCACTCGATCATTTTGATCCGACTACTGACAGTCGCCGGCTCATGGCCCATTTCCTCCATTTACGA
CAGGTGTATGGCTCCCTTCAAGACGGTTTCAACCTCGTACAACGTGGAAATTGGACGTATCGGATTGAGCGACCC
GGATCTAATGGGACTCAGACTGAAATGGGCCTATGGTCTGTTTCACGTGCTGGACTTCCAGGTATTCAGAATTTG
ACTGGGACGTTCAATGATCAAGTTTGGTTGCTGTACACGAATGAAAATTCGACCAAGACGTGGAGTTACGACTGC
AAACAGGATTTGTGGATTTCGTCGCCCTATACCTCCGATACTATTGTGCGGAATCTCTTCCCTCCCTACGAAACT
TACTCCCTCAAGGAGTCGTTGTCCGCTTTCAATAATGACAGCAAGGCACCATGGTTTGGCTGTCTTGGACAGGTA
ACTATGGAACCTTACGGATTCAAGGTCCTCGTACCTCAGGAACAATGGGTTGCACATCCTCCTACCATCACCAAA
TTCAATCCCGGTCATGATCACCGCCTTCTCGTTGATCCCAATGACGTGAATGCGACCACCGTCGATGTCTCGATA
GAGTTCAATATCCCCATGGACTGCCAAGGTGTCACAGACAGTATTACTCTGAACGCAACTACATCCGGAAAAGGC
GGACAACCGAGCATCACAAATGTAAAATGTGGAACTGTGTCGAATCCAGATCCTGCTAAAATTGTCGGTGTCGAT
GTATCTTCCTGGTCCTGGTCTGCGACTTTGACAGATCTCGCGGATGGAGTTTTGACACTCACTGTCAACAATCCG
CCAGCACGAAGTGGTAATGCTACGACGGGGACGAAAGATCATCTGCTGCTACGCAAGGGCGCCGCCAATAATGTG
GTAGTTTTCCCCGAGAACGATTATGATACCAAGGACTCGTTCAAGTTCTCCGACGGAAAATACACCTTTGAACAT
AAGGCCTTCGGCGCTGACAAATTAAGGTTCTCGTGGAACTTTGGAAAAAATTGGACAGAGTGGAGAAACTGGGAA
GATACCACTACCATCGAGGCTTCGGTCTTCCAGCAGTCTGAAAATTTCTGGGACGGTGATCACATTATGGTACAA
TACTGGAGCGAAGCCACACTTTCTGTTGCCGCGGTTGTGCATGCTGACACGCAGTATTCCGGTCCTCAGCGCCGC
ATGCCCCAACTTCTTGTTCGTGGTCCCTACAATCATTGGGGCTTTGATCAAGGTTTACCAACCAAGATGGAGTTG
AACCAAGACGGCAAATGGGAGCTTGAGCTTATGGCTTCCTGGCCGACTTATGTTCAGATCAACGTCTGGGGCTAC
GACGATTATTATTATGGTGATGCCGACGGTGATGGTGTCTTGGATCGTCTTCCACCGAATAGTGTCGCGCCGAAT
TACCTTAATATGTCTGCTCCCCCAAAACCACATCTCGCTTGGTCACTGCTCATCGATGATGCCACCATGACATGG
TCACTAGAGCCCCGCGGTCAAGCTGCCGTCGGAGTCGTCATGTATTCCCTCCTCCTCTCGATACCCCTTATTACC
GGTGTTCTTGCCGTTGTCATCTTCATGTGGACTTTCTATGGAATCAAACATAATCAGTATGGCGTTAAAGCGAAG
AATCATTCAACCTATTTCCCCATTCTAGCAGCTCTTGGAAACAAATCTACTACGGACTTCAAGGATACCTCGGCG
ATGTCAGAGAAAATATTTGGACATAAACAACCTACAGAAATAATTGGATGGCCAGAAGCCAAAAACAAACGGAGA
AAAGTGCTGATCGCGACTTTGGAATACGAAATCATCGACTGGAAGATGAAGGTCAAGATTGGTGGTCTCGGTGTC
ATGTCAAGTCTGATGGGCAAAGCTATGACAGACGTTGATCTTGTGTGGGTAGTTCCTAAGGTCAAAGACCTAGAT
TACCCTGCTGGGGATCCCGCGGAACCCATCGAGGTCATCATCTTTGGCGAACCTTACCTCATTGAAGTCGAGACT
CATCAACTGGACAACATCACCTACGTTATCGTCGACAGCCCTGTCTTCCGTGCTCAGACAAAGTCAGATCCTTAC
CCGTCCCGTATGGACGATCTTAGCTCTGCGATCTTTTATTCGACTTGGAATCAAGCCATAGCGGCCACTATTCGG
CGATTCCCTGACATTGACATCTATCACATCAATGACTACCATGGAGCGCTCGCGCCCATCTACCTCCTTCCGAAA
GTTATGCCCACCTGTTTGTCGTTGCATAATGCCGAGTTCCAGGGTTTATGGCCGTTGCGAACGAAAGAAGAGATG
AAGGAAGTTTGTTCAGCATTCAACATCAGCAAAGAACACTGCACGAAATATGTTCAATTCGGGAACACGTTCAAT
CTGTTACACGCCGGCGCGTCGTTCATTAGTACACACCAAAAGAGTGTTGGTGTAGCTGGTGTGTCTGACAAGTAT
GGTAAACGGAGTTGGGCGAGGTATCCTGCACTGTGGACGTTGAAGCATGTTGATTCACTTCCTAATCCTGATCCG
TCTGATATTGCGGCGTTGGACGAAACACCCATGAAAGCTAAAGATGTACAAATTGATGAAGAGGCTGAAGCTGCG
AGGCCGGAGTTAAAGAGGCAGGCACAGGAATGGGCTGGCATCAAACAGGATCCTGATTCTGATTTGTTTGTGTTC
GTTGGTCGTTGGTCGAAACAGAAAGGTGTTGATGTGATTGCTGATGTTATGCCTTCATTACTTGAGAAAAGACCT
TCGATTCAACTGATTGCGGTTGGTCCTGTCATCGATCTGTATGGAAGATTTGCAGCGGAAAAGTTGGCCAGGTTG
ATGGAGATGTACCCTGATCGCGTTTACTCCAAGCCAGAATTTACTGCTCTACCTCCTTATCTATTCAGTGGAGCT
GACTTCGCTTTGATTCCCTCTCGTGATGAACCGTTCGGTCTTGTGGCCGTTGAATTCGGAAGGAAAGGTGCTCTT
GGTGTGGGCTCGCGTTTGGGTGGTCTTGGTCTCATGCCTGGTTGGTGGTTCCCTGTCGAATCAAGCTCCACTGCT
CATCTAATCTCACAATTGACGAAAACCATCAAGATGGCTTTGAGGTCTACAGAAGAAGAGCGTGCAATACTTCGC
GCCCGTTCAGCAGTCCAGAGATTCCCTGTCGTCGAGTGGCGCCAAAGGATGGAAGATCTACATAAACGGAGTATC
ACACTAAGTCGACATTTATCTGGCACGAATGCCTGGAGGCCTGGCGATGGTGGAGGTGCTGGTATGCGTACTATG
GCCGACACGGATGATTGGGACCCGGTTACACAAGCTTATCCTAATCAACCTGACTGGGATACTGGCAGTGTGAAT
AGTTACATGAATTCACCTGCGCATAGGAGTCAAGAGTCGGTGGCACAGGTACCTCGGATTGGCGGCGACGAAGAC
TACTTTAGTCAAAAGGGCGGCACCCATTCGAATCAGGGATATACCGATTTTCTGGAGAGGGCAAATAGAGTAATT
GCAAAAGACAACAAAGGCGCACCGGACCCATTTTCGGACGGCGGCCTATCGCCTTCAAGGCCTTTCGGTGATCAT
TCACGGGTATCTTCTGTGGAGTCTATTTCTTCAATCGTTGAAGAGAAGTCAAATTCGCCGCTGAATAAAGCGATT
GCTTCGTTCACGGACGCTGACGGTGGTGTTGCTTCTGAATTCGTTCAAAAACTCCAAATGCTCGACGCCAAGAAT
TCTGCACGGGAGCTATCGATTGAAAAATACCTCACGAAAAGTGAAGAAGCATTCTTTGGCAAAGTGCGAAAGGAC
AAACTCTCTAGTGCTGCTAGTATCATATCGTCTCAACGTGAATCCGTCTGGGGTACTCCGTCACCCTCTATCTAT
TCTCGTCCTGATTCACCCAGCACGCATGTATTCTCGCACACAGAATATGATGGCAATCTTCAAAATGATTCTCCT
CAGCCTAACGTGGTTCCCATGACTCGCTTGCAAATTGCCATGTCACGAGAAATTGCGGGGTGGCCATTGTATACC
ATTGTCATAGCTCTGGGCCAAATGCTGAGTGCAACGAGCTTCCAGATTACCTTGCTTACAGGTCGCAACAGCCAA
GACGATTTACAGCTCTATGTCCTTGGCGCTGTTTTCCTTGTAGCGTCCGCAATTTGGTACCCTATGTTCCGCTTG
AAACCTTCTATCTACGTGCTGTCCTTGCCTTGGATATTCTTTGGTCTAGCCTTCTTCCTTATTGGTCTTCCCTCG
GTCGGTTCTGTCTTCGTTCCCGCCCATCAAGGTTTAGCAAGTGCTGCAACGTGGGCATATGCCGTGGCATCCTCA
GCTGGATTCTTGTTCTTTGGTCTTAATTTCGGTGAAGAAGCCGGAGCTGCTACGGAGGTTTGGACAATGCGGGCC
TGCATCGTTCAAGGTTCTCAACAGATTTGGGTCGCTGCATTGTGGTATTGGGGCAACTCACTCAATGGCCAGTCA
GCTGATAACATTCCACCTTGGTGGATCTGTGTGATTGTCTGGCCACTGGCCTGTTTGAGCCTCCTCTTCGCCTAC
GTCATGCTCTATGGCTTACCGGAATACTATCGTCAAACACCACCAAAAGTACCTCATTTCCTCAAAACACTCTTC
CGTCGCAAGCTGGTTCTTTGGTTCCTCGCTTCAGAAATTCTACGGGACTACTGGCTAAGTGGACCGTATGGACGC
AACTGGGCCTTCCTTTGGAGTGTGAATGTGCCGAAATGGCAGATTCTGTTGCTCGTAATCACATTTTTCATATTC
GTTTGGGCTCTTATGCTACTCGTCCTCACACACTTCAGTAAAACACATACCTGGTTGCTTCCCGTCTTCGCTGTT
GGCCTTGGCGCTCCTCGGTGGTGCCAAATGTTATGGGGAACATCATCACTCGCACTCTACATACCTTGGGCTGGC
TCAGGAGGTCCTTATCTCGGCATCTCACTGTGGTTATGGTTGGGGGTCCTAGATGCTATCCAAGGTGTTGGCTTG
GGAATGATTCTGCTGCAGACATTGTCCCGCCTTCATGTTTGTGCCACGCTTGCATTTGCCCAGATTATCGGTTCC
GTTTGTGTCATGATCGCACGTGCAACTGCTCCCAATCGTCTTGGACCCGGATCCGTATTCCCAGATGCCTCAAAA
TGGGACTTTAGCGATGGTCTTGAAGGGAGTCCAATGGCATCTGCACCCTTCTGGGTCGCTCTTATCTGCCAATTA
ATTATTGTTCTCGGCTATTTCTGGTTTTACCGCAAAGAGCAACTTGCACGGCCATAA
Gene >Agabi119p4|057010
ATGCGGCTTTTGTCCGCGCTCTCCGCTCTCTCCTTCCTCGCCCAGCTCGTGGCCGCCTCTCCCTGGCGTGAAGAC
CTAGTAGACTACAACCTCAACGTCAACAAGAACGCAAACTCCCCCCTCGAATATGATGCTGAGCGTCCCAATTCA
ACCTACACCCCATCGCCCCAAAACTGGCGTGCCCTTCCCACATACACTATCCTCCTAGACAAGTTTGCAGATGGT
GACCCTACCAACAACGACTACTTCGGCACTCCCTACGAGTCCGACTACCGTGAAACTCAGCTTCGTTATGGAGGC
GACCTCCGGGGTTTGGAATTACGCCTCGATTATCTACAGGGCATGGGCATCAAAATCGTTTTTCTCTCCGGTACC
CCCTTTGTCAACATGCTCTGGCAAGCCGATAGTTAGTCCTGCCACTATTTCGGTTTCATCCGCCCTCATTTATCT
ACTTTAAACAGGTTATTCACCTCTCGACTTCAGCGTCCTTGACCCGCACTGGGGAAAAATCAGTGATTGGCGCCA
TCTGATCGACGAAATCCATGCCCGCGGCATGTACTTTATGGCCGATTTCACTGTCGGCACCATGTCCGATCTTAT
CGCATTCGAAGGGTTTGTGGGCGACTAATGCATCGTGTTGACCGAGCTCTTACTTAGCCTTTACAGTTATCAAAA
CACAAGTACTCCCTTCAGCACTGACGAGCACACTGCCCTCTGGAAAAATCCGGACTATATGCCATGGAATTTTAC
CGAGTACCGTGATTTTACGGTGAGTTCGAGCTCTCAAAGTGACCCATTCAATTTCCGTTTATTGTAATCCCTACT
CAGATTCGCAATGAACACAACTCTTCCTGTGAGTTGCCCAAGTTTTGGGATGACTCAGGATCACTTGTAGACGTA
CGGACAAACGGTTGCATGACGTCCGATTTTGACCAGTATGGAGACATGGAAGCCTTCGGTGTGCATCCCGATTGG
CAGCGCCAGCTTGCAAAATTCGCTTCGGTACAGGATCGTCTTCGCGAGTGGCAACCATCGGTAATGGACAGGATC
AAAGTCTTTTCTTGCCTCGCTATCAAAGCCCTCGACATCGATTCTATTCGGGTTGACAAGGCCACTCAAGTTACC
GTTGATGCCCTTGCTACATGGGCTTCCAGTACGAGAGCATGTGCCGCAGGCCTCGGCAAAAACAATTTCTACATC
GCAGGCGAGATTACAGGTGGTGACACTTTTGGTTCTCTATACCTGTAAGCCGGTTGTTCGCCCTTTCGTATTCCC
TTCCTGATTCCATACAAGTGGCCGTGGCCGCACCCCGACCCAGCTTCCTCCAGGATTCTTGGCAGCAGCAAACCT
CACTTCGGATCAGGATGAATTTTTCCTCAGGGATGCCCCCCTCAATGGTTTGGATGGCGCAGCGTTCCATTATTC
AATCTACCGTTCGCTTTCGCGTTTCCTTGGAATGGACGGCAATCTTCAAGTTGCCTATGACCTTGATGTCAACTT
TGTCACAGCCTGGAATCAGATGTTCGTAAACAATGATTTTCTCAATGCGCAAAACGGCAAGCTCGACCCCCGTCA
TATGTTCGGGACCAGCAACTTTGATGTTTTCCGTTGGCCTAGTCTAGAGAATGGGACACAGAGAAGCGTCTTAGC
TACTTTCATCACTAACTTGGTCATGCCTGGAATCCCTTTGGTGAGCGTTTTGGTTTATATGCTGATACCATTTAT
TCAATCAACCAAGTTTTATTATGGTGAAGAGCAAAACTTCTATTTGTATGACAATGGCGCTTCCAATTATCTATA
TGGGTAAGTATCTGTTTGATCAGTGCCGAATGCATCATTTGACACTTTTGCAAGCCGGCAAGCGATGATCAGTAC
CCCTACCTGGAAACGCCATGGTTGCTACACCTTGGGCTCTGAGCAGTACTTTAACATGCCATTAGAGAAGGCTTT
ATTCGGTTGTTACGATGATTGGAATGCACTCGATCATTTTGATCCGACTACTGACAGTCGCCGGCTCATGGCCCA
TTTCCTCCATTTACGACAGGTGTATGGCTCCCTTCAAGACGGTTTCAACCTCGTACAACGTGGAAATTGGACGTA
TCGGATTGAGCGACCCGGATCTAATGGGACTCAGACTGAAATGGGCCTATGGTCTGTTTCACGTGCTGGACTTCC
AGGTATTCAGAATTTGACTGGGACGTTCAATGATCAAGTTTGGTTGCTGTACACGAATGAAAATTCGACCAAGAC
GTGGAGTTACGACTGCAAACAGGATTTGTGGATTTCGTCGCCCTATACCTCCGATACTATTGTGCGGAATCTCTT
CCCTCCCTACGAAACTTACTCCCTCAAGGAGTCGTTGTCCGCTTTCAATAATGACAGCAAGGCACCATGGTTTGG
CTGTCTTGGACAGGTAACTATGGAACCTTACGGATTCAAGGTCCTCGTACCTCAGGAACAATGGGTTGCACATCC
TCCTACCATCACCAAATTCAATCCCGGTCATGATCACCGCCTTCTCGTTGATCCCAATGACGTGAATGCGACCAC
CGTCGATGTCTCGATAGAGTTCAATATCCCCATGGACTGCCAAGGTGTCACAGACAGTATTACTCTGAACGCAAC
TACATCCGGAAAAGGCGGACAACCGAGCATCACAAATGTAAAATGTGGAACTGTGTCGAATCCAGATCCTGCTAA
AATTGTCGGTGTCGATGTATCTTCCTGGTCCTGGTCTGCGACTTTGACAGATCTCGCGGATGGAGTTTTGACACT
CACTGTCAACAATCCGCCAGCACGAAGTGGTAATGCTACGACGGGGGTGCGTTTGTATATTCGTCGACCTCTTAG
CAACGCTAATACTCTTTCATCGCAGACGAAAGATCATCTGCTGCTACGCAAGGGCGCCGCCAATAATGTGGTAGT
TTTCCCCGAGAACGATTATGATACCAAGGACTCGTTCAAGTTCTCCGACGGAAAATACACCTTTGAACATAAGGC
CTTCGGCGCTGACAAATTAAGGTTCTCGTGGAACTTTGGAAAAAATTGGACAGAGTGGAGAAACTGGGAAGATAC
CACTACCATCGAGGCTTCGGTCTTCCAGCAGTCTGAAAATTTCTGGGACGGTGATCACATTATGGTACAATGTAG
GTGGCATGTTAACATTTCATCATGAGTATTGAACTCATGTGTCAATCAGACTGGAGCGAAGCCACACTTTCTGTT
GCCGCGGTTGTGCATGCTGACACGCAGTATTCCGGTCCTCAGCGCCGCATGCCCCAACTTCTTGTTCGTGGTCCC
TACAATCATTGGGGCTTTGATCAAGGTTTACCAACCAAGATGGAGTTGAACCAAGACGGCAAATGGGAGCTTGAG
CTTATGGCTTCCTGGCCGACTTATGTTCAGATCAACGTCTGGGGCTACGACGATTATTATTATGGTGATGCCGAC
GGTGATGGTGTCTTGGATCGTCTTCCACCGAATAGTGTCGCGCCGAATTACCTTAATATGTCTGCTCCCCCAAAA
CCACATCTCGCTTGGTCACTGCTCATCGATGATGCCACCATGACATGGTCACTAGAGCCCCGCGGTCAAGCTGCC
GTCGGAGTCGTCATGTATTCCCTCCTCCTCTCGATACCCCTTATTACCGGTGTTCTTGCCGTTGTCATCTTCATG
TGGACTTTCTATGGAATCAAACATAATCAGTATGGCGTTAAAGCGAAGAATCATTCAACCTATTTCCCCATTCTA
GCAGCTCTTGGAAACAAATCTACTACGGACTTCAAGGATACCTCGGCGATGTCAGAGAAAATATTTGGACATAAA
CAACCTACAGAAATAATTGGATGGCCAGAAGCCAAAAACAAACGGAGAAAAGTGCTGATCGCGACTTTGGAATAC
GAAATCATCGACTGGAAGATGAAGGTCAAGATTGGTGGTCTCGGTGTCATGTCAAGTCTGATGGGCAAAGCTATG
ACAGACGTTGATCTTGTGTGGGTAGTTCCTAAGGTCAAAGACCTAGATTACCCTGCTGGGGATCCCGCGGAACCC
ATCGAGGTCATCATCTTTGGCGAACCTTACCTCATTGAAGTCGAGACTCATCAACTGGACAACATCACCTACGTT
ATCGTCGACAGCCCTGTCTTCCGTGCTCAGACAAAGTCAGATCCTTACCCGTCCCGTATGGACGATCTTAGCTCT
GCGATCTTTTATTCGACTTGGAATCAAGCCATAGCGGCCACTATTCGGCGATTCCCTGACATTGACATCTATCAC
ATCAATGACTACCATGGAGCGCTCGCGCCCATCTACCTCCTTCCGAAAGTTATGCCCACCTGTTTGTCGTTGCAT
AATGCCGAGTTCCAGGGTTTATGGCCGTTGCGAACGAAAGAAGAGATGAAGGAAGTTTGTTCAGCATTCAACATC
AGCAAAGAACACTGCACGAAATATGTTCAATTCGGGAACACGTTCAATCTGTTACACGCCGGCGCGTCGTTCATT
AGTACACACCAAAAGAGTGTTGGTGTAGCTGGTGTGTCTGACAAGTATGGTAAACGGAGTTGGGCGAGGTATCCT
GCACTGTGGACGTTGAAGCATGTTGATTCACTTCCTAATCCTGATCCGTCTGATATTGCGGCGTTGGACGAAACA
CCCATGAAAGCTAAAGATGTACAAATTGATGAAGAGGCTGAAGCTGCGAGGCCGGAGTTAAAGAGGCAGGCACAG
GAATGGGCTGGCATCAAACAGGATCCTGATTCTGATTTGTTTGTGTTCGTTGGTCGTTGGTCGAAACAGAAAGGT
GTTGATGTGATTGCTGATGTTATGCCTTCATTGTGAGTCTTCTTGCCTTTTTTTAAACTTGTGTTGAAACCTCCA
TCTGATAAATTAATCCATAGACTTGAGAAAAGACCTTCGATTCAACTGATTGCGGTTGGTCCTGTCATCGATCTG
TATGGAAGATTTGCAGCGGAAAAGTTGGCCAGGTTGATGGAGATGTACCCTGATCGCGTTTACTCCAAGCCAGAA
TTTACTGCTCTACCTCCTTATCTATTCAGTGGAGCTGACTTCGCTTTGATTCCCTCTCGTGATGAACCGTTCGGT
CTTGTGGCCGTTGAATTCGGAAGGAAAGGTGCTCTTGGTGTGGGCTCGCGTTTGGGTGGTCTTGGTCTCATGCCT
GGTTGGGTAAGTGAAATCTAGTTGTGGTCGTTTATAATGAGGTTTAAACTATCTTTCTAGTGGTTCCCTGTCGAA
TCAAGCTCCACTGCTCATCTAATCTCACAATTGACGAAAACCATCAAGATGGCTTTGAGGTCTACAGAAGAAGAG
CGTGCAATACTTCGCGCCCGTTCAGCAGTCCAGAGATTCCCTGTCGTCGAGTGGCGCCAAAGGATGGAAGATCTA
CATAAACGGAGTATCACACTAAGTCGACATTTATCTGGCACGAATGCCTGGAGGCCTGGCGATGGTGGAGGTGCT
GGTATGCGTACTATGGCCGACACGGATGATTGGGACCCGGTTACACAAGCTTATCCTAATCAACCTGACTGGGAT
ACTGGCAGTGTGAATAGTTACATGAATTCACCTGCGCATAGGAGTCAAGAGTCGGTGGCACAGGTACCTCGGATT
GGCGGCGACGAAGACTACTTTAGTCAAAAGGGCGGCACCCATTCGAATCAGGGATATACCGATTTTCTGGAGAGG
GCAAATAGAGTAATTGCAAAAGACAACAAAGGCGCACCGGACCCATTTTCGGACGGCGGCCTATCGCCTTCAAGG
CCTTTCGGTGATCATTCACGGGTATCTTCTGTGGAGTCTATTTCTTCAATCGTTGAAGAGAAGTCAAATTCGCCG
CTGAATAAAGCGATTGCTTCGGTAGGTCATACATGTCTCGCTAATGTCATGCGACTCATCTACTTTGTTGTGTAG
TTCACGGACGCTGACGGTGGTGTTGCTTCTGAATTCGTTCAAAAACTCCAAATGCTCGACGCCAAGAATTCTGCA
CGGGAGCTATCGATTGAAAAATACCTCACGAAAAGTGAAGAAGCATTCTTTGGCAAAGTGCGAAAGGACAAACTC
TCTAGTGCTGCTAGTATCATATCGTCTCAACGTGAATCCGTCTGGGGTACTCCGTCACCCTCTATCTATTCTCGT
CCTGATTGTAAGTTCATATTTGGCTGTTTTTACGATTCTTGTATTCACCACCTCGATTAGCACCCAGCACGCATG
TATTCTCGCACACAGAATATGATGGCAATCTTCAAAATGATTCTCCTCAGCCTAACGTGGTTCCCATGACTCGCT
TGCAAATTGCCATGTCACGAGAAATTGCGGGGTGGCCATTGTATACCATTGTCATAGCTCTGGGCCAAATGCTGA
GTGCAACGAGCTTCCAGATTACCTTGCTTACAGGTCGCAACAGCCAAGACGATTTACAGCTCTATGTCCTTGGCG
CTGTTTTCCTTGTAGCGTCCGCAATTTGGTACCCTATGTTCCGCTTGAAACCTTCTATCTACGTGCTGTCCTTGC
CTTGGATATTCTTTGGTCTAGCCTTCTTCCTTATTGGTCTTCCCTCGGTCGGTTCTGTCTTCGTTCCCGCCCATC
AAGGTTTAGCAAGTGCTGCAACGTGGGCATATGCCGTGGCATCCTCAGCTGGATTCTTGTTCTTTGGTCTTAATT
TCGGTGAAGAAGCCGTGCGTAGACATCTTTTGTTTGCATTCAAGCATACTTACGAAACGTCATACAGGGAGCTGC
TACGGAGGTTTGGACAATGCGGGCCTGCATCGTTCAAGGTTCTCAACAGATTTGGGTCGCTGCATTGTGGTATTG
GGGCAACTCACTCAATGGCCAGTCAGCTGATAACATTCCACCTTGGTGGATCTGTGTGATTGTCTGGCCACTGGC
CTGTTTGAGCCTCCTCTTCGCCTACGTCATGCTCTATGGCTTACCGGAATACTATCGTCAAACACCACCAAAAGT
ACCTCATTTCCTCAAAACACTCTTCCGTCGCAAGCTGGTTCTTTGGTTCCTCGCTTCAGAAATTCTACGGGACTA
CTGGCTAAGTGGAGTAAGTCACCTCAATCCTCTCTATACCATCTGATAGATCTGATGCTTATGAATGTTATCTCT
AGCCGTATGGACGCAACTGGGCCTTCCTTTGGAGTGTGAATGTGCCGAAATGGCAGATTCTGTTGCTCGTAATCA
CATTTTTCATATTCGTTTGGGCTCTTATGCTACTCGTCCTCACACACTTCAGTAAAACACATACCTGGTTGCTTC
CCGTCTTCGCTGTTGGCCTTGGCGCTCCTCGGTGGTGCCAAATGTTATGGGGAACATCATCACTCGCACTCTACA
TACCTTGGGCTGGCTCAGGAGGTCCTTATCTCGGCATCTCACTGTGGTTATGGTTGGGGGTCCTAGATGCTATCC
AAGGTGTTGGCTTGGGAATGATTCTGCTGCAGACATTGTCCCGCCTTCATGTTTGTGCCACGCTTGCATTTGCCC
AGATTATCGGTTCCGTTTGTGTCATGATCGCACGTGCAACTGCTCCCAATCGTCTTGGACCCGGATCCGTATTCC
CAGATGCCTCAAAATGGGACTTTAGCGATGGTCTTGAAGGTGATTAGTTATTTCTTGAAGGTGACGCAGAATACT
AAGCACATACGCAACTTTAGGGAGTCCAATGGCATCTGCACCCTTCTGGGTCGCTCTTATCTGCCAATTAATTAT
TGTTCTCGGCTATTTCTGGTTTTACCGCAAAGAGCAACTTGGTGAGTATCAAAATGCCTCACTGATTATTATCTC
TGACACGTACCTGAAAAGCACGGCCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail