Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|056980
Gene name
Locationscaffold_03a:1087313..1089312
Strand+
Gene length (bp)1999
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00781 DAGK_cat Diacylglycerol kinase catalytic domain 5.1E-25 105 234
PF19279 YegS_C YegS C-terminal NAD kinase beta sandwich-like domain 9.8E-07 252 436

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14159|LCB4_SCHPO Sphingoid long chain base kinase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcb4 PE=3 SV=1 84 454 5.0E-60
sp|Q12246|LCB4_YEAST Sphingoid long chain base kinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB4 PE=1 SV=1 87 459 2.0E-51
sp|Q06147|LCB5_YEAST Sphingoid long chain base kinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB5 PE=1 SV=1 87 463 1.0E-49
sp|Q8L7L1|SPHK1_ARATH Sphingosine kinase 1 OS=Arabidopsis thaliana GN=SPHK1 PE=1 SV=1 101 454 9.0E-39
sp|F2Y4A3|SPHK2_ARATH Sphingosine kinase 2 OS=Arabidopsis thaliana GN=SPHK2 PE=1 SV=1 101 454 7.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14159|LCB4_SCHPO Sphingoid long chain base kinase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lcb4 PE=3 SV=1 84 454 5.0E-60
sp|Q12246|LCB4_YEAST Sphingoid long chain base kinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB4 PE=1 SV=1 87 459 2.0E-51
sp|Q06147|LCB5_YEAST Sphingoid long chain base kinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCB5 PE=1 SV=1 87 463 1.0E-49
sp|Q8L7L1|SPHK1_ARATH Sphingosine kinase 1 OS=Arabidopsis thaliana GN=SPHK1 PE=1 SV=1 101 454 9.0E-39
sp|F2Y4A3|SPHK2_ARATH Sphingosine kinase 2 OS=Arabidopsis thaliana GN=SPHK2 PE=1 SV=1 101 454 7.0E-36
sp|Q9NYA1|SPHK1_HUMAN Sphingosine kinase 1 OS=Homo sapiens GN=SPHK1 PE=1 SV=1 99 446 4.0E-28
sp|Q91V26|SPHK1_RAT Sphingosine kinase 1 OS=Rattus norvegicus GN=Sphk1 PE=2 SV=1 99 471 1.0E-27
sp|Q8CI15|SPHK1_MOUSE Sphingosine kinase 1 OS=Mus musculus GN=Sphk1 PE=1 SV=1 99 446 3.0E-25
sp|Q9LRB0|LCBK1_ARATH Sphingoid long-chain bases kinase 1 OS=Arabidopsis thaliana GN=LCBK1 PE=1 SV=1 104 298 7.0E-25
sp|Q86KF9|SPHKA_DICDI Sphingosine kinase A OS=Dictyostelium discoideum GN=sgkA PE=2 SV=2 49 304 4.0E-24
sp|Q9NRA0|SPHK2_HUMAN Sphingosine kinase 2 OS=Homo sapiens GN=SPHK2 PE=1 SV=2 109 315 8.0E-22
sp|Q9JIA7|SPHK2_MOUSE Sphingosine kinase 2 OS=Mus musculus GN=Sphk2 PE=1 SV=2 99 298 9.0E-22
sp|Q18425|SPHK1_CAEEL Sphingosine kinase 1 OS=Caenorhabditis elegans GN=sphk-1 PE=1 SV=1 104 443 5.0E-19
sp|Q6B516|SPHKB_DICDI Sphingosine kinase B OS=Dictyostelium discoideum GN=sgkB PE=2 SV=1 98 231 4.0E-17
sp|Q7ZW00|AGK_DANRE Acylglycerol kinase, mitochondrial OS=Danio rerio GN=agk PE=2 SV=2 103 244 5.0E-12
sp|Q8K4Q7|CERK1_MOUSE Ceramide kinase OS=Mus musculus GN=Cerk PE=2 SV=2 101 296 8.0E-12
sp|Q53H12|AGK_HUMAN Acylglycerol kinase, mitochondrial OS=Homo sapiens GN=AGK PE=1 SV=2 103 248 3.0E-11
sp|Q5RED7|AGK_PONAB Acylglycerol kinase, mitochondrial OS=Pongo abelii GN=AGK PE=2 SV=1 103 248 3.0E-11
sp|Q7ZYJ3|AGK_XENLA Acylglycerol kinase, mitochondrial OS=Xenopus laevis GN=agk PE=2 SV=1 103 244 5.0E-11
sp|Q9ESW4|AGK_MOUSE Acylglycerol kinase, mitochondrial OS=Mus musculus GN=Agk PE=1 SV=1 103 248 2.0E-10
sp|Q8TCT0|CERK1_HUMAN Ceramide kinase OS=Homo sapiens GN=CERK PE=1 SV=1 101 296 4.0E-10
sp|Q49MI3|CERKL_HUMAN Ceramide kinase-like protein OS=Homo sapiens GN=CERKL PE=1 SV=1 100 292 1.0E-08
sp|Q9NRA0|SPHK2_HUMAN Sphingosine kinase 2 OS=Homo sapiens GN=SPHK2 PE=1 SV=2 344 458 8.0E-08
sp|Q6USK2|CERK_ARATH Ceramide kinase OS=Arabidopsis thaliana GN=CERK PE=1 SV=1 99 203 7.0E-07
sp|Q9JIA7|SPHK2_MOUSE Sphingosine kinase 2 OS=Mus musculus GN=Sphk2 PE=1 SV=2 344 454 2.0E-06
sp|Q9TZI1|CERK_CAEEL Ceramide kinase 1 OS=Caenorhabditis elegans GN=T10B11.2 PE=3 SV=1 100 282 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016301 kinase activity Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|056980
MNIHVDTPQFKYSFTLSDTSLIVNDGESPQLAVPHHWVLASRYDEEEQLMHVSYLIEKIDRRKGTSLMLVNVKGS
VEDRTRAFEWSEELMGTVYDGYGIQRSRRLRVLVNPHGGVKKAVAVFSNIVEPIFRAAGCQLHITHTTHHGHAHD
IAKDLATNYDAVVAVSGDGLVHEVLNGFAEHADPIKAFSIPVAPIPTGSGNGLSLNLLGEKDGFDVTKAALNVVK
GQPMKVDLFSFTQDDERSISFMSQSLGLMADLDVGTEHLRWMGDTRFIVGMLRGLIQFKACPVQISYKAAEKDKR
KMAESASAHRNAVAKDTSASAAEGDTAETLPPLRFQPGSSGEGWTTIDEPLLYVYAGKGPFVGRDYMAFPVSLPD
DGLIDVVTVPLSSRKDVVVGMVGASKGDSYWSPKLHYVKAHAYRVKPLKKKGSLAVDGELYPFKEFQVEVHQRLG
TVLSCYGRYAVDFSPHPPAEEKFSCRDCGITAIWSARSSQ*
Coding >Agabi119p4|056980
ATGAACATTCATGTTGATACACCACAGTTCAAGTATTCTTTCACACTCTCTGACACCTCACTTATTGTGAACGAC
GGAGAATCCCCTCAACTCGCTGTGCCACACCATTGGGTCCTCGCGAGTCGTTATGACGAGGAGGAACAACTCATG
CATGTCTCGTACCTCATCGAGAAGATTGATAGGAGGAAAGGGACCTCGCTAATGCTTGTAAATGTCAAAGGAAGC
GTGGAGGACAGAACCAGGGCATTTGAGTGGTCAGAGGAACTGATGGGCACAGTATATGACGGTTATGGTATCCAG
CGGTCTCGCCGCCTCAGAGTCCTCGTCAACCCACATGGAGGAGTGAAAAAAGCGGTTGCCGTGTTTTCCAACATC
GTCGAACCTATATTTCGTGCCGCGGGGTGTCAGCTCCATATCACCCATACCACACATCACGGTCATGCTCATGAC
ATAGCCAAGGATCTCGCGACCAACTACGATGCTGTTGTAGCAGTCTCAGGAGACGGGCTAGTGCACGAAGTGCTC
AACGGCTTTGCTGAGCATGCAGATCCCATCAAAGCATTTAGCATACCAGTGGCACCCATTCCCACCGGTTCGGGA
AACGGTCTCTCATTAAACCTCCTTGGAGAAAAGGATGGTTTTGATGTAACTAAAGCTGCCCTCAACGTCGTTAAA
GGTCAGCCAATGAAAGTAGATCTATTCTCGTTCACACAAGACGACGAGAGATCAATTTCATTCATGTCGCAATCT
CTCGGGCTCATGGCTGATCTCGATGTTGGAACTGAACACTTACGCTGGATGGGTGATACACGATTCATCGTAGGC
ATGCTTCGAGGACTCATTCAATTTAAAGCATGCCCTGTTCAGATTTCTTATAAAGCTGCGGAAAAAGATAAACGC
AAGATGGCTGAAAGTGCTTCTGCGCATCGAAATGCTGTTGCCAAAGATACTTCAGCTTCAGCGGCCGAGGGTGAC
ACGGCAGAAACATTACCGCCACTCAGATTCCAACCGGGCAGTAGCGGCGAAGGTTGGACAACAATAGATGAACCC
CTGCTGTATGTTTATGCAGGCAAGGGTCCATTTGTAGGACGAGATTACATGGCTTTCCCAGTTTCACTACCTGAC
GATGGTCTCATTGATGTCGTGACCGTGCCACTGTCCTCAAGAAAGGACGTCGTTGTGGGGATGGTTGGAGCGAGC
AAGGGCGACAGTTACTGGTCGCCAAAACTACACTACGTGAAGGCCCATGCATACCGGGTGAAACCTCTCAAGAAA
AAAGGTTCTCTCGCCGTTGACGGCGAATTATACCCCTTCAAGGAATTTCAAGTGGAAGTACACCAACGCCTAGGC
ACCGTGCTTAGTTGTTACGGACGTTACGCTGTTGATTTTTCCCCTCACCCTCCGGCCGAGGAAAAGTTTTCTTGT
CGCGATTGCGGGATTACCGCCATCTGGTCCGCTCGAAGCAGTCAATAA
Transcript >Agabi119p4|056980
ATGAACATTCATGTTGATACACCACAGTTCAAGTATTCTTTCACACTCTCTGACACCTCACTTATTGTGAACGAC
GGAGAATCCCCTCAACTCGCTGTGCCACACCATTGGGTCCTCGCGAGTCGTTATGACGAGGAGGAACAACTCATG
CATGTCTCGTACCTCATCGAGAAGATTGATAGGAGGAAAGGGACCTCGCTAATGCTTGTAAATGTCAAAGGAAGC
GTGGAGGACAGAACCAGGGCATTTGAGTGGTCAGAGGAACTGATGGGCACAGTATATGACGGTTATGGTATCCAG
CGGTCTCGCCGCCTCAGAGTCCTCGTCAACCCACATGGAGGAGTGAAAAAAGCGGTTGCCGTGTTTTCCAACATC
GTCGAACCTATATTTCGTGCCGCGGGGTGTCAGCTCCATATCACCCATACCACACATCACGGTCATGCTCATGAC
ATAGCCAAGGATCTCGCGACCAACTACGATGCTGTTGTAGCAGTCTCAGGAGACGGGCTAGTGCACGAAGTGCTC
AACGGCTTTGCTGAGCATGCAGATCCCATCAAAGCATTTAGCATACCAGTGGCACCCATTCCCACCGGTTCGGGA
AACGGTCTCTCATTAAACCTCCTTGGAGAAAAGGATGGTTTTGATGTAACTAAAGCTGCCCTCAACGTCGTTAAA
GGTCAGCCAATGAAAGTAGATCTATTCTCGTTCACACAAGACGACGAGAGATCAATTTCATTCATGTCGCAATCT
CTCGGGCTCATGGCTGATCTCGATGTTGGAACTGAACACTTACGCTGGATGGGTGATACACGATTCATCGTAGGC
ATGCTTCGAGGACTCATTCAATTTAAAGCATGCCCTGTTCAGATTTCTTATAAAGCTGCGGAAAAAGATAAACGC
AAGATGGCTGAAAGTGCTTCTGCGCATCGAAATGCTGTTGCCAAAGATACTTCAGCTTCAGCGGCCGAGGGTGAC
ACGGCAGAAACATTACCGCCACTCAGATTCCAACCGGGCAGTAGCGGCGAAGGTTGGACAACAATAGATGAACCC
CTGCTGTATGTTTATGCAGGCAAGGGTCCATTTGTAGGACGAGATTACATGGCTTTCCCAGTTTCACTACCTGAC
GATGGTCTCATTGATGTCGTGACCGTGCCACTGTCCTCAAGAAAGGACGTCGTTGTGGGGATGGTTGGAGCGAGC
AAGGGCGACAGTTACTGGTCGCCAAAACTACACTACGTGAAGGCCCATGCATACCGGGTGAAACCTCTCAAGAAA
AAAGGTTCTCTCGCCGTTGACGGCGAATTATACCCCTTCAAGGAATTTCAAGTGGAAGTACACCAACGCCTAGGC
ACCGTGCTTAGTTGTTACGGACGTTACGCTGTTGATTTTTCCCCTCACCCTCCGGCCGAGGAAAAGTTTTCTTGT
CGCGATTGCGGGATTACCGCCATCTGGTCCGCTCGAAGCAGTCAATAA
Gene >Agabi119p4|056980
ATGAACATTCATGTTGATACACCACAGTTCAAGTATTCTTTCACACTCTCTGACACCTCACTTATTGTGAACGAC
GGAGGCATGTTTGCTTCATTTCAGTCCCATTTGCAGATGCTCATATTGCACTATTACACCAGAATCCCCTCAACT
CGCTGTGCCACACCATTGGGTCCTCGCGAGTCGTTATGACGAGGAGGAACAACTCATGCATGTCTCGTACCTCAT
CGAGAAGATTGATAGGAGGAAAGGGACCTCGCTAATGCTTGTAAATGTCAAAGGAAGCGTGGAGGACAGAACCAG
GGCATTTGAGTGGTCAGAGGAACTGATGGGCACAGTATATGACGGTGAGGTGCATTTAGTGTCCTTGATTGGTTT
ACTGATGACGTCCAGGTTATGGTATCCAGCGGTCTCGCCGCCTCAGAGTCCTCGTCAACCCACATGGAGGAGTGG
TACGCCGCCCTTTCATATCCTCTTTGCCCCTGCTCACATAAGTCTCACTAGAAAAAAGCGGTTGCCGTGTTTTCC
AACATCGTCGAACCTATATTTCGTGCCGCGGGGTGTCAGCTCCATATCACCCGTAGGCAGGACATCCTTCGCCCT
GTCCTTCACTTGTCCTCATCTCTTTTTGTAGATACCACACATCACGGTCATGCTCATGACATAGCCAAGGATCTC
GCGACCAACTACGATGCTGTTGTAGCAGTCTCAGGAGACGGGCTAGTGCACGAAGTGCTCAACGGCTTTGCTGAG
CATGCAGATCCCATCAAAGCATTTAGCATACCAGTGGCACCCATTCCCACCGGTTCGGGAAACGGTCTCTCATTA
AACCTCCTTGGAGAAAAGGTGAGTAGATACGAGTATTATCAGAAAAAGCTGTCTCATGCTTCCCAGGATGGTTTT
GATGTAACTAAAGCTGCCCTCAACGTCGTTAAAGGTGCGTAGCTTTTGTATTTCCCTTTAACAGTTTTCAATACT
GTCGCAGGTCAGCCAATGAAAGTAGATCTATTCTCGTTCACACAAGACGACGAGAGATCAATTTCATTCATGTCG
CAATCTCTCGGGCTCATGGCTGATCTCGATGTTGGAACTGAACACTTACGCTGGATGGGTGATACACGATTCATC
GTAGGCATGCTTCGAGGACGTACGTGCCAAATGTCGCTAAACCGCCCAGCCTATCTATTTACTGACACGCCCATT
CTAGTCATTCAATTTAAAGCATGCCCTGTTCAGATTTCTTATAAAGCTGCGGAAAAAGATAAACGCAAGATGGCT
GAAAGTGCTTCTGCGCATCGAAATGCTGTTGCCAAAGATACTTCAGCTTCAGCGGCCGAGGGTGACACGGCAGAA
ACATTACCGCCACTCAGATTCCAACCGGGCAGTAGCGGCGAAGGTTGGACAACAATAGATGAACCCCTGCTGTAT
GTTTATGCAGGCAAGGGTCCATTTGTAGGACGGTACGGGGAATGTATTTTATCGGCGCAACATCGACTGATCTAA
GCAAACACTACCAGAGATTACATGGCTTTCCCAGTTTCACTACCTGACGATGGTCTCATTGATGTCGTGACCGTG
CCACTGGTAAGGGAAATTTGTATCTTTGAGGGCTCCTTTCTTAACATAATACATAGTCCTCAAGAAAGGACGTCG
TTGTGGGGATGGTTGGAGCGAGCAAGGGCGACAGTTACTGGTCGCCAAAAGTGAGTCCAAAATCTGGGTTTCCGC
GCTCGACCGCTTACCTACCGTATTACAGCTACACTACGTGAAGGCCCATGCATACCGGGTGAAACCTCTCAAGAA
AAAAGGTTCTCTCGCCGTTGACGGCGAATTATACCCCTTCAAGGAATTTCAAGTGGAAGTACACCAACGCCTAGG
CACCGTGCTTAGTTGTTACGGACGTTACGCTGTTGATTTTTCCCCTCACCCTCCGGCCGAGGAAAAGTTTTCTTG
TCGCGATTGCGGGATTACCGCCATCTGGTCCGCTCGAAGCAGTCAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail