Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|056670
Gene name
Locationscaffold_03a:1013278..1017679
Strand-
Gene length (bp)4401
Transcript length (bp)3219
Coding sequence length (bp)3219
Protein length (aa) 1073

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02233 PNTB NAD(P) transhydrogenase beta subunit 1.1E-169 616 1065
PF01262 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domain 3.2E-74 211 434
PF05222 AlaDh_PNT_N Alanine dehydrogenase/PNT, N-terminal domain 1.2E-41 71 207
PF12769 PNTB_4TM 4TM region of pyridine nucleotide transhydrogenase, mitoch 1.4E-30 496 581

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P11024|NNTM_BOVIN NAD(P) transhydrogenase, mitochondrial OS=Bos taurus GN=NNT PE=1 SV=3 39 1065 0.0E+00
sp|Q13423|NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens GN=NNT PE=1 SV=3 30 1065 0.0E+00
sp|Q61941|NNTM_MOUSE NAD(P) transhydrogenase, mitochondrial OS=Mus musculus GN=Nnt PE=1 SV=2 39 1065 0.0E+00
sp|P07001|PNTA_ECOLI NAD(P) transhydrogenase subunit alpha OS=Escherichia coli (strain K12) GN=pntA PE=1 SV=2 68 581 3.0E-162
sp|Q9ALA2|PNTA_RHOSH NAD(P) transhydrogenase subunit alpha OS=Rhodobacter sphaeroides GN=pntA PE=1 SV=1 68 581 1.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P11024|NNTM_BOVIN NAD(P) transhydrogenase, mitochondrial OS=Bos taurus GN=NNT PE=1 SV=3 39 1065 0.0E+00
sp|Q13423|NNTM_HUMAN NAD(P) transhydrogenase, mitochondrial OS=Homo sapiens GN=NNT PE=1 SV=3 30 1065 0.0E+00
sp|Q61941|NNTM_MOUSE NAD(P) transhydrogenase, mitochondrial OS=Mus musculus GN=Nnt PE=1 SV=2 39 1065 0.0E+00
sp|P07001|PNTA_ECOLI NAD(P) transhydrogenase subunit alpha OS=Escherichia coli (strain K12) GN=pntA PE=1 SV=2 68 581 3.0E-162
sp|Q9ALA2|PNTA_RHOSH NAD(P) transhydrogenase subunit alpha OS=Rhodobacter sphaeroides GN=pntA PE=1 SV=1 68 581 1.0E-156
sp|P43842|PNTA_HAEIN NAD(P) transhydrogenase subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pntA PE=3 SV=1 68 581 2.0E-154
sp|P0AB70|PNTB_SHIFL NAD(P) transhydrogenase subunit beta OS=Shigella flexneri GN=pntB PE=3 SV=1 613 1068 3.0E-134
sp|P0AB67|PNTB_ECOLI NAD(P) transhydrogenase subunit beta OS=Escherichia coli (strain K12) GN=pntB PE=1 SV=1 613 1068 3.0E-134
sp|P0AB68|PNTB_ECOL6 NAD(P) transhydrogenase subunit beta OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pntB PE=3 SV=1 613 1068 3.0E-134
sp|P0AB69|PNTB_ECO57 NAD(P) transhydrogenase subunit beta OS=Escherichia coli O157:H7 GN=pntB PE=3 SV=1 613 1068 3.0E-134
sp|P43010|PNTB_HAEIN NAD(P) transhydrogenase subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pntB PE=3 SV=1 613 1068 9.0E-130
sp|P0C188|PNTB_RHORU NAD(P) transhydrogenase subunit beta OS=Rhodospirillum rubrum GN=pntB PE=1 SV=1 614 1069 7.0E-104
sp|Q2RSB4|PNTB_RHORT NAD(P) transhydrogenase subunit beta OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pntB PE=1 SV=1 614 1069 7.0E-104
sp|P0C186|PNTAA_RHORU NAD(P) transhydrogenase subunit alpha part 1 OS=Rhodospirillum rubrum GN=pntAA PE=3 SV=1 68 437 3.0E-93
sp|Q2RSB2|PNTAA_RHORT NAD(P) transhydrogenase subunit alpha part 1 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pntAA PE=1 SV=1 68 437 3.0E-93
sp|P41077|PNTAA_RICPR NAD(P) transhydrogenase subunit alpha part 1 OS=Rickettsia prowazekii (strain Madrid E) GN=pntAA PE=3 SV=2 74 446 7.0E-84
sp|Q8KY18|DHA_MYCSM Alanine dehydrogenase OS=Mycobacterium smegmatis GN=ald PE=1 SV=1 68 437 2.0E-33
sp|A0QVQ8|DHA_MYCS2 Alanine dehydrogenase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ald PE=1 SV=1 68 437 2.0E-33
sp|P9WQB1|DHA_MYCTU Alanine dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ald PE=1 SV=1 68 434 9.0E-33
sp|P9WQB0|DHA_MYCTO Alanine dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ald PE=3 SV=1 68 434 1.0E-32
sp|Q2YTD1|DHA2_STAAB Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ald2 PE=3 SV=1 68 401 4.0E-31
sp|Q931P7|DHA2_STAAM Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ald2 PE=3 SV=1 68 401 6.0E-31
sp|Q6GFZ8|DHA2_STAAR Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain MRSA252) GN=ald2 PE=3 SV=1 68 401 6.0E-31
sp|Q2FG29|DHA2_STAA3 Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain USA300) GN=ald2 PE=3 SV=1 68 401 6.0E-31
sp|Q5HF65|DHA2_STAAC Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain COL) GN=ald2 PE=3 SV=1 68 401 6.0E-31
sp|Q6G8L8|DHA2_STAAS Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain MSSA476) GN=ald2 PE=3 SV=1 68 401 6.0E-31
sp|Q8NW54|DHA2_STAAW Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain MW2) GN=ald2 PE=3 SV=1 68 401 6.0E-31
sp|Q2FXL7|DHA2_STAA8 Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=ald2 PE=3 SV=1 68 401 6.0E-31
sp|Q99TF4|DHA2_STAAN Alanine dehydrogenase 2 OS=Staphylococcus aureus (strain N315) GN=ald2 PE=1 SV=1 68 401 7.0E-31
sp|Q49YD9|DHA_STAS1 Alanine dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ald PE=3 SV=1 68 419 4.0E-30
sp|Q4L750|DHA_STAHJ Alanine dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ald PE=3 SV=1 68 401 4.0E-30
sp|Q8CNW8|DHA_STAES Alanine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ald PE=3 SV=1 68 401 2.0E-28
sp|Q5HNJ6|DHA_STAEQ Alanine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ald PE=3 SV=1 68 401 2.0E-28
sp|P17556|DHA_LYSSH Alanine dehydrogenase OS=Lysinibacillus sphaericus GN=ald PE=1 SV=1 68 433 1.0E-27
sp|Q08352|DHA_BACSU Alanine dehydrogenase OS=Bacillus subtilis (strain 168) GN=ald PE=1 SV=1 68 460 8.0E-27
sp|Q8NWQ3|DHA1_STAAW Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain MW2) GN=ald1 PE=3 SV=1 68 433 2.0E-23
sp|Q6G9C3|DHA1_STAAS Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain MSSA476) GN=ald1 PE=3 SV=1 68 433 2.0E-23
sp|Q6GGW9|DHA1_STAAR Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain MRSA252) GN=ald1 PE=3 SV=1 68 433 3.0E-23
sp|Q2FH00|DHA1_STAA3 Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain USA300) GN=ald1 PE=3 SV=1 68 433 3.0E-23
sp|Q5HFY4|DHA1_STAAC Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain COL) GN=ald1 PE=3 SV=1 68 433 3.0E-23
sp|P63478|DHA1_STAAM Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ald1 PE=3 SV=1 68 433 3.0E-23
sp|P99151|DHA1_STAAN Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain N315) GN=ald1 PE=1 SV=1 68 433 3.0E-23
sp|P17557|DHA_GEOSE Alanine dehydrogenase OS=Geobacillus stearothermophilus GN=ald PE=1 SV=1 68 411 1.0E-22
sp|Q2YY66|DHA1_STAAB Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ald1 PE=3 SV=1 68 432 2.0E-22
sp|Q2FYJ2|DHA1_STAA8 Alanine dehydrogenase 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=ald1 PE=3 SV=1 68 433 3.0E-22
sp|Q8CX61|DHA_OCEIH Alanine dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ald PE=3 SV=1 68 411 3.0E-21
sp|Q6LX40|DHA_METMP Alanine dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=ald PE=1 SV=1 68 411 1.0E-20
sp|P51995|PNTAB_RICPR NAD(P) transhydrogenase subunit alpha part 2 OS=Rickettsia prowazekii (strain Madrid E) GN=pntAB PE=3 SV=2 499 581 4.0E-20
sp|P0C187|PNTAB_RHORU NAD(P) transhydrogenase subunit alpha part 2 OS=Rhodospirillum rubrum GN=pntAB PE=3 SV=1 499 581 2.0E-17
sp|Q2RSB3|PNTAB_RHORT NAD(P) transhydrogenase subunit alpha part 2 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pntAB PE=3 SV=1 499 581 2.0E-17
sp|A5HZ59|CEO_CLOBH N(5)-(carboxyethyl)ornithine synthase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=ceo PE=1 SV=1 78 406 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 488 510 22
2 517 539 22
3 549 571 22
4 588 607 19
5 612 634 22
6 641 663 22
7 667 686 19
8 698 717 19
9 732 754 22
10 774 796 22
11 816 838 22
12 850 872 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|056670
MAQGPVCVLEMATRGRLLASNISARLPKFELQRCRWTKRRNFQTTAYFRNDNANKTTPEPQGIPYSSLTVGIPRE
IFPNERRVSLTPQNAALLRKKGFAHVLVEYQAGVGAEFLDEHYAAAGATLVSRDELFKRSDIMLKVRPPLIGQEA
EKINEGSTLISFLYPAQNKSIVDTLASRKANAFAMDMIPRISRAQVFDALSSMANIAGYKAVLEASNHFGRFLTG
QVTAAGKIPPGKVLVIGAGVAGLSAIATARRLGAIVRGFDTRSAAREQVQSLGAEFLEVNIKEDGSGAGGYAKVM
SKEFIEAEMALFKEQCREVDIVITTALIPGKPAPKLITKEMLAVMKQGSVVVDMAAETGGNCEATVPGEIAVHNG
VTIIGYTDLPSRLPTQSSTLYSNNITKFLLSIGGDGRYLVDLEDEVVRGAIVVHKGEVLPPAPRPLPPPVTPPAP
SAAEKEASVAITPWQKVTRDVALVTGGMGTVVALGKSTGTAFMDSFFTFGLAGLVGYRVVWGVAPALHSPLMSVT
NAISGLVGVAGMFVMGGGYLPGTIPQALGAMAVLLATINVSGGFIVTKRMLDMFKRPTDPPEYPWLYAIPATVFT
GGFLAAASTGMAGLVQAGYLTSSILCISSLSGLASQVTARQGNILGILGVGSGILASLAAVGFPPEVIGQFAGVA
AIGGLIGALVGRRVTPTELPQTVALLHSIVGLSAVLTSIASVLQDVSHLSTLHMVTAYLGVVIGGITFTGSVVAF
LKLAAKMSSRPLALPGKHLINSTLLGANVATMAGFLTTVPSTPMVAASFLGASTILSFIKGYTTTAAIGGADMPV
VITVLNAYSGFALVAEGFMLDNPLLVSVGSLIGVSGSILSYIMCVAMNRSLTNVLFGGISAPTATETKIEGTITK
TTVDETVEYLANADNVILVVGYGMAVARAQYAISEITASLRSKGINVRFAIHPVAGRMPGQCNVLLAEASVPYDI
VFEMDEINDDFKETDVTLVIGANDTVNPIALEAGSAIAGMPVLHAWKSKQVIVMKRGLASGYADVPNPMFYMPGT
KMLFGDAKDTCEAIKRGLESRN*
Coding >Agabi119p4|056670
ATGGCTCAAGGGCCGGTCTGTGTGTTAGAAATGGCGACCAGAGGTCGACTCCTTGCGTCGAACATCTCAGCAAGA
CTGCCCAAGTTCGAGCTTCAACGCTGTCGTTGGACTAAACGCCGGAATTTCCAAACCACCGCCTATTTTCGAAAC
GACAATGCCAACAAGACTACTCCTGAGCCGCAAGGCATCCCCTATTCCTCACTTACCGTCGGTATACCGCGTGAA
ATATTCCCGAATGAACGCCGGGTTTCTCTCACCCCGCAAAACGCAGCTCTTCTGCGCAAAAAAGGGTTCGCTCAT
GTCCTCGTTGAATATCAAGCTGGTGTAGGAGCAGAGTTCCTGGACGAGCACTACGCAGCGGCCGGCGCCACCCTA
GTGTCCCGCGATGAGTTATTCAAACGTTCAGACATCATGTTGAAGGTTAGGCCACCATTGATTGGTCAAGAGGCC
GAGAAGATAAACGAGGGCAGCACTCTGATCTCATTTCTCTATCCGGCTCAAAACAAGTCGATCGTCGACACCCTT
GCTAGTCGTAAAGCCAATGCATTTGCGATGGACATGATACCCAGGATCTCCCGTGCACAAGTCTTCGACGCACTC
AGTTCAATGGCTAATATTGCAGGATATAAAGCTGTTTTGGAAGCTTCCAACCATTTTGGTAGATTTTTGACTGGT
CAGGTCACAGCAGCGGGCAAGATTCCTCCTGGGAAAGTTCTGGTTATCGGCGCAGGTGTAGCTGGCCTCAGCGCC
ATCGCCACGGCCAGACGACTCGGTGCTATTGTTCGAGGATTTGATACACGATCTGCAGCTCGTGAACAAGTGCAA
TCTCTTGGTGCAGAGTTTTTAGAGGTCAATATCAAAGAGGATGGTAGCGGCGCTGGTGGCTACGCCAAGGTCATG
TCCAAAGAATTCATCGAAGCAGAAATGGCTCTATTTAAAGAGCAGTGTCGAGAGGTAGATATAGTGATAACGACA
GCCCTAATTCCAGGCAAACCAGCCCCGAAATTAATCACCAAGGAAATGCTTGCGGTGATGAAACAAGGCTCTGTG
GTGGTCGATATGGCGGCAGAAACTGGCGGCAACTGTGAGGCAACTGTTCCTGGTGAAATAGCTGTCCACAATGGT
GTCACCATAATCGGTTATACGGATCTACCATCCAGGCTCCCTACTCAATCTTCGACTTTGTACTCAAATAATATT
ACCAAATTCCTCTTATCTATAGGGGGTGACGGTCGCTACTTGGTAGATCTCGAAGATGAGGTCGTCCGCGGTGCT
ATTGTCGTTCACAAAGGCGAAGTTCTTCCTCCAGCACCCCGTCCTCTTCCTCCACCGGTGACTCCTCCGGCACCA
AGCGCAGCTGAGAAAGAGGCTTCTGTAGCTATTACTCCCTGGCAGAAAGTAACAAGAGACGTTGCGCTTGTCACT
GGTGGCATGGGTACCGTCGTTGCCCTTGGGAAAAGTACTGGAACTGCGTTCATGGATAGCTTCTTTACTTTCGGT
CTTGCAGGTCTTGTTGGCTATCGGGTTGTATGGGGTGTTGCACCGGCTTTGCATTCCCCTCTCATGTCAGTAACC
AATGCCATTTCTGGCTTGGTTGGTGTTGCTGGTATGTTTGTCATGGGTGGAGGCTATCTCCCTGGTACCATTCCT
CAGGCCCTCGGAGCAATGGCAGTCTTACTTGCGACCATCAATGTTTCTGGTGGTTTTATCGTCACGAAGCGTATG
CTCGACATGTTCAAACGTCCAACTGATCCGCCGGAGTACCCTTGGCTATATGCCATCCCTGCTACAGTTTTCACC
GGTGGTTTCCTTGCCGCTGCAAGCACAGGTATGGCGGGCCTTGTCCAGGCGGGCTACTTGACAAGTAGCATTCTT
TGCATTAGTTCTCTGTCTGGCCTCGCTTCTCAGGTTACTGCACGACAAGGGAATATCCTCGGCATCCTCGGTGTT
GGTTCTGGCATTTTAGCGTCTTTGGCTGCCGTCGGTTTTCCTCCAGAGGTCATTGGGCAATTTGCTGGTGTTGCC
GCCATTGGAGGACTCATCGGCGCATTGGTCGGAAGGCGTGTGACTCCAACGGAATTGCCTCAAACTGTTGCTCTA
CTTCACTCAATTGTTGGTCTATCCGCTGTCTTGACTAGTATCGCCAGTGTCCTTCAGGATGTCTCCCATCTCTCG
ACGTTGCATATGGTTACTGCCTACCTCGGTGTTGTCATTGGTGGTATTACATTCACCGGCTCTGTTGTGGCGTTC
CTTAAGCTTGCCGCAAAGATGTCCAGCAGGCCTCTGGCATTACCTGGGAAGCATTTAATTAACAGCACACTTCTG
GGCGCCAATGTCGCGACTATGGCTGGCTTCCTGACGACAGTCCCTTCGACGCCGATGGTTGCTGCTTCCTTTTTG
GGAGCGAGTACTATCCTCAGTTTTATCAAGGGCTACACGACCACGGCAGCCATCGGGGGTGCAGACATGCCCGTT
GTTATAACCGTTCTGAATGCCTACTCTGGCTTTGCTCTTGTGGCCGAAGGCTTCATGTTGGATAATCCACTTCTC
GTAAGTGTTGGATCACTTATTGGTGTTAGTGGCTCAATCCTGTCATATATAATGTGTGTTGCCATGAATCGTTCT
CTCACGAATGTCCTTTTCGGTGGCATTAGTGCGCCGACTGCCACTGAAACCAAGATCGAGGGTACAATCACCAAA
ACGACTGTAGATGAGACCGTCGAGTACCTAGCGAATGCTGACAACGTCATTCTTGTGGTTGGATATGGTATGGCC
GTTGCTAGAGCTCAGTATGCTATTTCAGAGATTACTGCTTCGTTACGGTCGAAGGGAATCAACGTCCGGTTCGCA
ATTCACCCTGTCGCTGGTCGTATGCCAGGACAGTGCAACGTACTCCTGGCTGAGGCTTCAGTCCCTTACGACATT
GTCTTTGAGATGGATGAGATCAATGACGATTTCAAGGAAACAGATGTGACATTAGTAATTGGCGCTAACGATACT
GTTAATCCTATCGCTCTCGAGGCTGGATCTGCAATCGCTGGGATGCCTGTTCTCCATGCATGGAAGAGTAAGCAA
GTCATCGTCATGAAGCGTGGTTTGGCTAGTGGATATGCCGACGTTCCCAATCCCATGTTCTATATGCCTGGTACG
AAGATGCTCTTCGGGGATGCTAAGGATACATGTGAAGCGATCAAACGTGGTTTGGAGTCGCGTAACTAA
Transcript >Agabi119p4|056670
ATGGCTCAAGGGCCGGTCTGTGTGTTAGAAATGGCGACCAGAGGTCGACTCCTTGCGTCGAACATCTCAGCAAGA
CTGCCCAAGTTCGAGCTTCAACGCTGTCGTTGGACTAAACGCCGGAATTTCCAAACCACCGCCTATTTTCGAAAC
GACAATGCCAACAAGACTACTCCTGAGCCGCAAGGCATCCCCTATTCCTCACTTACCGTCGGTATACCGCGTGAA
ATATTCCCGAATGAACGCCGGGTTTCTCTCACCCCGCAAAACGCAGCTCTTCTGCGCAAAAAAGGGTTCGCTCAT
GTCCTCGTTGAATATCAAGCTGGTGTAGGAGCAGAGTTCCTGGACGAGCACTACGCAGCGGCCGGCGCCACCCTA
GTGTCCCGCGATGAGTTATTCAAACGTTCAGACATCATGTTGAAGGTTAGGCCACCATTGATTGGTCAAGAGGCC
GAGAAGATAAACGAGGGCAGCACTCTGATCTCATTTCTCTATCCGGCTCAAAACAAGTCGATCGTCGACACCCTT
GCTAGTCGTAAAGCCAATGCATTTGCGATGGACATGATACCCAGGATCTCCCGTGCACAAGTCTTCGACGCACTC
AGTTCAATGGCTAATATTGCAGGATATAAAGCTGTTTTGGAAGCTTCCAACCATTTTGGTAGATTTTTGACTGGT
CAGGTCACAGCAGCGGGCAAGATTCCTCCTGGGAAAGTTCTGGTTATCGGCGCAGGTGTAGCTGGCCTCAGCGCC
ATCGCCACGGCCAGACGACTCGGTGCTATTGTTCGAGGATTTGATACACGATCTGCAGCTCGTGAACAAGTGCAA
TCTCTTGGTGCAGAGTTTTTAGAGGTCAATATCAAAGAGGATGGTAGCGGCGCTGGTGGCTACGCCAAGGTCATG
TCCAAAGAATTCATCGAAGCAGAAATGGCTCTATTTAAAGAGCAGTGTCGAGAGGTAGATATAGTGATAACGACA
GCCCTAATTCCAGGCAAACCAGCCCCGAAATTAATCACCAAGGAAATGCTTGCGGTGATGAAACAAGGCTCTGTG
GTGGTCGATATGGCGGCAGAAACTGGCGGCAACTGTGAGGCAACTGTTCCTGGTGAAATAGCTGTCCACAATGGT
GTCACCATAATCGGTTATACGGATCTACCATCCAGGCTCCCTACTCAATCTTCGACTTTGTACTCAAATAATATT
ACCAAATTCCTCTTATCTATAGGGGGTGACGGTCGCTACTTGGTAGATCTCGAAGATGAGGTCGTCCGCGGTGCT
ATTGTCGTTCACAAAGGCGAAGTTCTTCCTCCAGCACCCCGTCCTCTTCCTCCACCGGTGACTCCTCCGGCACCA
AGCGCAGCTGAGAAAGAGGCTTCTGTAGCTATTACTCCCTGGCAGAAAGTAACAAGAGACGTTGCGCTTGTCACT
GGTGGCATGGGTACCGTCGTTGCCCTTGGGAAAAGTACTGGAACTGCGTTCATGGATAGCTTCTTTACTTTCGGT
CTTGCAGGTCTTGTTGGCTATCGGGTTGTATGGGGTGTTGCACCGGCTTTGCATTCCCCTCTCATGTCAGTAACC
AATGCCATTTCTGGCTTGGTTGGTGTTGCTGGTATGTTTGTCATGGGTGGAGGCTATCTCCCTGGTACCATTCCT
CAGGCCCTCGGAGCAATGGCAGTCTTACTTGCGACCATCAATGTTTCTGGTGGTTTTATCGTCACGAAGCGTATG
CTCGACATGTTCAAACGTCCAACTGATCCGCCGGAGTACCCTTGGCTATATGCCATCCCTGCTACAGTTTTCACC
GGTGGTTTCCTTGCCGCTGCAAGCACAGGTATGGCGGGCCTTGTCCAGGCGGGCTACTTGACAAGTAGCATTCTT
TGCATTAGTTCTCTGTCTGGCCTCGCTTCTCAGGTTACTGCACGACAAGGGAATATCCTCGGCATCCTCGGTGTT
GGTTCTGGCATTTTAGCGTCTTTGGCTGCCGTCGGTTTTCCTCCAGAGGTCATTGGGCAATTTGCTGGTGTTGCC
GCCATTGGAGGACTCATCGGCGCATTGGTCGGAAGGCGTGTGACTCCAACGGAATTGCCTCAAACTGTTGCTCTA
CTTCACTCAATTGTTGGTCTATCCGCTGTCTTGACTAGTATCGCCAGTGTCCTTCAGGATGTCTCCCATCTCTCG
ACGTTGCATATGGTTACTGCCTACCTCGGTGTTGTCATTGGTGGTATTACATTCACCGGCTCTGTTGTGGCGTTC
CTTAAGCTTGCCGCAAAGATGTCCAGCAGGCCTCTGGCATTACCTGGGAAGCATTTAATTAACAGCACACTTCTG
GGCGCCAATGTCGCGACTATGGCTGGCTTCCTGACGACAGTCCCTTCGACGCCGATGGTTGCTGCTTCCTTTTTG
GGAGCGAGTACTATCCTCAGTTTTATCAAGGGCTACACGACCACGGCAGCCATCGGGGGTGCAGACATGCCCGTT
GTTATAACCGTTCTGAATGCCTACTCTGGCTTTGCTCTTGTGGCCGAAGGCTTCATGTTGGATAATCCACTTCTC
GTAAGTGTTGGATCACTTATTGGTGTTAGTGGCTCAATCCTGTCATATATAATGTGTGTTGCCATGAATCGTTCT
CTCACGAATGTCCTTTTCGGTGGCATTAGTGCGCCGACTGCCACTGAAACCAAGATCGAGGGTACAATCACCAAA
ACGACTGTAGATGAGACCGTCGAGTACCTAGCGAATGCTGACAACGTCATTCTTGTGGTTGGATATGGTATGGCC
GTTGCTAGAGCTCAGTATGCTATTTCAGAGATTACTGCTTCGTTACGGTCGAAGGGAATCAACGTCCGGTTCGCA
ATTCACCCTGTCGCTGGTCGTATGCCAGGACAGTGCAACGTACTCCTGGCTGAGGCTTCAGTCCCTTACGACATT
GTCTTTGAGATGGATGAGATCAATGACGATTTCAAGGAAACAGATGTGACATTAGTAATTGGCGCTAACGATACT
GTTAATCCTATCGCTCTCGAGGCTGGATCTGCAATCGCTGGGATGCCTGTTCTCCATGCATGGAAGAGTAAGCAA
GTCATCGTCATGAAGCGTGGTTTGGCTAGTGGATATGCCGACGTTCCCAATCCCATGTTCTATATGCCTGGTACG
AAGATGCTCTTCGGGGATGCTAAGGATACATGTGAAGCGATCAAACGTGGTTTGGAGTCGCGTAACTAA
Gene >Agabi119p4|056670
ATGGCTCAAGGGCCGGTCTGTGTGTTAGAAATGGCGACCAGAGGTCGACTCCTTGCGTCGAACATCTCAGCAAGA
CTGCCCAAGTTCGGTGCGTCGTGTTCTTTATTTATCTGAGATACATTGTACAATGAAGCTGAACAGAGCTTCAAC
GCTGTCGTTGGACTAAACGCCGGAATTTCCAAACCACCGCCTATTTTCGAAACGACAATGCCAACAAGACTACTC
CTGAGCCGCAAGGCATCCCCTATTCCTCACTTACCGTCGGTATACCGCGTGAAATATTCCCGAATGAACGCCGGG
TTTCTCTCACCCCGCAAAACGCAGCTCTTCTGCGCAAAAAAGGGTTCGCTCATGTCCTCGTTGAATATCAAGCTG
GTGTAGGAGCAGAGTTCCTGGACGAGCACTACGCAGCGGCCGGCGCCACCCTAGTGTCCCGCGATGAGTTATTCA
AACGTTCAGACATCATGTTGAAGGTTAGGCCACCATTGATTGGTCAAGAGGCCGAGAAGATAAACGAGGGCAGCA
CTCTGATCTCATTTCTCTATCCGGCTCAAAACAAGTCGATCGTCGACACCCTTGCTAGTCGTAAAGCCAATGCAT
TTGCGGTTCGTTGCTTTTCTCTAGGCTTTGTTGCGCAGCAAGCTGAATACTATTCTAGATGGACATGATACCCAG
GATCTCCCGTGCACAAGTCTTCGACGCACTCAGGTAATTAGATCACTGAATAACGGAGATAAATGGTATACTACT
CATGTTTAATCCAGTTCAATGGCTAATATTGCAGGATATAAAGCTGTTTTGGAAGCTTCCAACCATTTTGGTAGA
TTTTTGACTGGTCAGGTCACAGCAGCGGGGTAAGTTTCTTCTTAACTGTCTCTTTGTTCTTCGAGCCTGAAAATT
TCTACTTTCGCAGCAAGGTAAATGTTCTCATCTATGAAATGTAGTAACTATCCTTGACTCAAAAAATGCAGATTC
CTCCTGGGAAAGTTCTGGTTATCGGCGCAGGTGTAGCTGGCCTCAGCGCCATCGCCACGGTACGCTATGGGCTCT
TGTGTCTTGTGAGCTCACCCGTTTATCGTTAATCAGGCCAGACGACTCGGTGCTATTGTTCGAGGATTTGATACA
CGATCTGCAGCTCGTGAACAAGTGCAATCTCTTGGTGCAGAGTTTTTAGAGGTCAATATCAAAGAGGATGGTAGC
GGCGCTGGTGGCTACGCCAAGGTCATGTCCAAAGAATTCATCGAAGCAGAAATGGCTCTATTTAAAGAGCAGTGT
CGAGAGGTAGATATAGTGATAACGACAGTAAGTCATGCCTGCCTCACCTTCAACGTCTATGAAACTCGTTCCCTA
GGCCCTAATTCCAGGCAAACCAGCCCCGAAATTAATCACCAAGGAAATGCTTGCGGTGATGAAACAAGGCTCTGT
GGTGGTCGATATGGCGGCAGAAACTGGCGGCAACTGTGAGGCAACTGTTCCTGGTGAAATAGCTGTCCACAATGG
TGTCACCATAATCGGTGAATCTCCCCTTACCCTTTACACGACTAGATACTGATTTACGAACAGGTTATACGGATC
TACCATCCAGGCTCCCTACTCAATCTTCGACTTTGTACTCAAATAATATTACCAAATTCCTCTTATCTATAGGGG
GTGACGGTCGCTACTTGGTAGATCTCGAAGATGAGGTCGTCCGCGGTGCTATTGTCGTTCACAAAGGCGAAGTTC
TTCCTCCAGCACCCCGTCCTCTTCCTCCACCGGTGACTCCTCCGGCACCAAGCGCAGCTGAGAAAGAGGCTTCTG
TAGCTATTACTCCCTGGCAGAAAGTAACAAGAGACGTTGCGCTTGTCACTGGTGGCATGGGTACCGTCGTTGCCC
TTGGGAAAAGTACTGGAACTGCGTTCATGGATAGCTTCTTTACTTTCGGTCTTGCAGGTCTTGTTGGCTATCGGT
AAGTGACCAAGTGAGATACCCACTGAAGACGCTCAAGTGGTCTTTAGGGTTGTATGGGGTGTTGCACCGGCTTTG
CATTCCCCTCTCATGTCAGTAACCAATGCCATTTCTGGCTTGGTAAGTTTTGGACTCTATTTTCTTATACTACAT
TCTTGACTCACATCCACTAGGTTGGTGTTGCTGGTATGTTTGTCATGGGTGGAGGCTATCTCCCTGGTACCATTC
CTCAGGCCCTCGGAGCAATGGCAGTCTTACTTGCGACCATCAATGTTTCTGGTGGTTTTATCGTCACGAAGCGTA
TGCTCGACATGTTCAAACGTAAGTCCTCGAACACAGCTATCGTACCTTTCCTTATACCAAGTACAGGTCCAACTG
ATCCGCCGGAGTACCCTTGGCTATATGCCATCCCTGCTACAGTTTTCACCGGTGGTTTCCTTGCCGCTGCAAGCA
CAGGTATGGCGGGCCTTGTCCAGGCGGGCTACTTGACAAGTAGCATTCTTTGCATTAGTGAGTTTCTAAGTCTTG
ACCGGAAGTTTCTTAATTGATTAACTGCTGGAATCTAGGTTCTCTGTCTGGCCTCGCTTCTCAGGTTACTGCACG
ACAAGGGAATATCCTCGGCATCCTCGGTGTTGGTTCTGGCATTTTAGCGTCTTTGGCTGCCGTCGGTTTTCCTCC
AGAGGTCATTGGGCAATTTGCTGGTGTTGCCGCCATTGGAGGACTCATCGGCGCATTGGTCGGAAGGCGTGTGAC
TCCAACGGAATTGCCTCAAACTGTTGCTCTACTTCACTCAATTGTTGGTCTATCCGCTGTCTTGACTAGTATCGC
CAGTGTCCTTCAGGATGTCTCCCATCTCTCGACGTTGCATATGGTTACTGCCTACCTCGGTGTTGTCATTGGTGC
GTGAACCCCACAAGAAGACGACTAGCCTTCATGTATGCTCATGGATGGATGTTAGGTGGTATTACATTCACCGGC
TCTGTTGTGGCGTTCCTTAAGCTTGCCGCAAAGATGTCCAGCAGGCCTCTGGCATTACCTGGGAAGCATTTAATT
AACAGCACACTTCTGGGCGCCAATGTCGCGACTATGGCTGGCTTCCTGACGACAGTCCCTTCGACGCCGATGGTT
GCTGCTTCCTTTTTGGGAGCGAGTACTATCCTCAGTTTTATCAAGGGCTACACGACCACGGCAGCCATCGGGGGT
GCAGACATGCGTGCGTACTCCGTGTGTTAGATGGATCACACTGTTGACAGTATTCCCTAGCCGTTGTTATAACCG
TTCTGAATGCCTACTCGTAAGTGAAAATCGCTTTTGACGAATTACCATCGCCTGAACCAACTCAGTGGCTTTGCT
CTTGTGGCCGAAGGCTTCATGTTGGATAATCCACTTCTCGTAAGTGTTGGATCACTTATTGGTGTTAGTGGCTCA
ATCCTGTCATATATAATGGTAAGAGTGGTTCACTCATTTCTTGAGAAGTCTTACATATTAATTCATGCCGTAGTG
TGTTGCCATGAATCGTTCTCTCACGAATGTCCTTTTCGGTGGCATTAGTGCGCCGACTGCCACTGAAACCAAGAT
CGAGGGTACAATCACCAAAACGACTGTAGATGAGACCGTCGAGTACCTAGCGAATGCTGACAACGTCATTCTTGT
ATGTCGTCATTATGTTGATTTGTGCTTCCGTTTTTATCCTCGCATGCAGGTGGTTGGATATGGTATGGCCGTTGC
TAGAGCTCAGTATGCTATTTCAGAGATTACTGCTTCGTTACGGTCGAAGGGAATCAACGTCCGGGTATGTTCTGT
GATTCAAAGCGTCTTCTATCTATCTATTACTAAGCCTCCGACGATATCTATTAGTTCGCAATTCACCCTGTCGCT
GGTCGTATGCCAGGACAGTGCAACGTACTCCTGGCTGAGGCTTCAGTCCCTTACGACAGTACGTTGTCATTCTTC
ACTACACTGAATCTCTGCCTTACCAGAGGGTCGTAACAGTTGTCTTTGAGATGGATGAGATCAATGACGATTTCA
AGGAAACAGATGTGACATTAGTAATTGGCGCTAACGATACTGTTAATCCTATCGCTCTCGAGGCTGGATCTGCAA
TCGCTGTATGTTAACTTTTTTCTCTCACTCTTTGTTTGACTGACAAGTGCGTGCAGGGGATGCCTGTTCTCCATG
CATGGAAGAGTAAGCAAGTCATCGTCATGAAGCGTGGTTTGGCTAGTGGATATGGTCCGTGATACAATTCCATTC
CATGGAGCAGCGGACCGCTACTGATGCTTCTGACCATTATCATAGCCGACGTTCCCAATCCCATGTTCTATATGC
CTGGTACGAAGATGCTCTTCGGGGATGCTAAGGATACATGTGAAGGTATGTGGAGTTCTCCTGCAGAACTATTTA
TCCTGATAAATCGATTCAGCGATCAAACGTGGTTTGGAGTCGCGTAACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail