Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|056640
Gene name
Locationscaffold_03a:1004801..1008643
Strand-
Gene length (bp)3842
Transcript length (bp)3570
Coding sequence length (bp)3570
Protein length (aa) 1190

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18115 Tudor_3 DNA repair protein Crb2 Tudor domain 1.5E-10 770 815
PF09038 53-BP1_Tudor Tumour suppressor p53-binding protein-1 Tudor 1.6E-05 770 815

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87074|RHP9_SCHPO DNA repair protein crb2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=crb2 PE=1 SV=1 772 1167 2.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|056640
MNASDGNSSDVDAMESQASQLIHAALEQSPTSIADSKRAKSNKNLSVHSLTSSKNSAASSVHQYHFHGLASTQTQ
SYSDNEEDKGLIPNEGSQKENFESAKRNNGKDRQWTLPSPDWGPSPPQKSSSKDNTAKAEQSGTSRRPTKAKSHM
PSVTHSKLVVPQQVRDSKSTDLPPPRPQERFWPQSSRRHNNRSSSPDFSQDSFAQGDSQLSEERLLVTSKKFTMP
LADLARIDHEDIPTKTAGRVGVSQANYLLRNTHKPDDRSPVILVPSTPSQSGSSDYASSVGKYQSRSKEDDSYEQ
GQSAERTMLDNSSSRGSQYSQGFDGQDEVAEVQNLYSTKSSTNLGPARPQLPLNTNVFEETQMATQEATQIATQE
AVVLTPSSVAAQTHTTINVGPRSLLNTMDQNKRNRYQRLLQYTPNSPISPAQQYLVDVRRLDVDDAKAQPIATPD
QQKRTALLPEYKSPQIPSFKSPPKKIISKLPQQTSAPDAMDIVPDSEPMRETVQTSISEEKLMSVGRVNEVEQAS
DSEGTEDSDNMPPRKPLQCEEEEDQAIANKQEEEEEEEEEGTDDDDDEPLSARLRKARSKALVAPSKGDKPSGVT
RTYGSKSVTKKKATSTAKRGELPRQQKANRKSGSTSERMNEKLVPSSIPNQDHPRTRKFRAATAKAKGKQPLRMS
SRPTSVKSRRGRRSTTAEAEKDSDIEMEEVSDSEGDTQPADEPNEYMEPEIPSQSLKRKRGRPPKSKDNIVAAVT
PITRLTKRLKSGSTTSTANATRVFALWSGNKLYYPGIVSESVGDGRYNIKFDDDAEGTVSTDDMRVYNLRTGDLV
RVNSKKKDCRVHKVNLRTNMVTLEIDGETEDVSMKAIGISVKNITSTWNDRHIDKRSIAPAIRFSDNKPSPSPSR
SAASFLSAKGSRLPPKFLPGVGLIVSLSGNGTNDRTKDGRLRTEILNAVRDSGGVLVDDLFKYLRMDLSHSSNRW
VGDSTNVQWVGEPRELQRLFLLADDCNHKPKYLMALALGIPCLSVEWLYSCLRAGKELEWRSHLLPQGRPNAIDV
QPSQQIDLNWGNRTEHLSELMTNPVAPRILKDQSILCVGPDMTPKSKDTDKGEAASYIIRIILAMGATRVEAVRD
TSFAEHPLSHYDLLVIRDREQYHSAYSQTHTVDWNWIKDSLIMSRFLPMPDWPVEEESQCSQNL*
Coding >Agabi119p4|056640
ATGAATGCATCTGATGGTAATTCAAGTGATGTCGACGCAATGGAGTCTCAGGCCTCCCAGTTGATTCATGCGGCT
CTTGAGCAATCCCCGACGTCCATTGCGGACTCGAAAAGGGCGAAGTCGAACAAGAATCTATCGGTGCATTCTTTG
ACTTCTTCCAAAAATTCGGCCGCATCTTCTGTTCACCAATATCACTTCCATGGTCTGGCTTCAACACAAACTCAA
TCTTACTCGGACAATGAAGAAGATAAAGGACTAATTCCAAACGAAGGCTCACAAAAAGAGAATTTTGAATCGGCA
AAGAGGAATAACGGGAAGGATAGGCAATGGACGCTGCCATCTCCTGATTGGGGTCCGTCTCCACCCCAAAAATCC
TCATCAAAAGACAATACGGCTAAGGCCGAGCAGTCAGGAACATCCAGACGCCCAACAAAGGCCAAGTCTCATATG
CCCAGCGTAACTCATTCAAAACTTGTGGTGCCTCAGCAAGTACGGGACTCCAAGAGCACAGACCTTCCACCCCCA
AGACCACAAGAGAGATTTTGGCCTCAATCATCACGTCGTCATAACAATCGGTCCAGTTCTCCTGACTTTTCCCAA
GATTCTTTTGCGCAAGGGGACTCACAGCTTTCCGAAGAAAGACTTTTAGTCACCTCAAAAAAGTTTACTATGCCT
CTAGCGGACCTTGCTCGGATTGACCACGAAGATATCCCAACAAAGACCGCTGGTCGAGTGGGAGTATCGCAGGCA
AACTATCTCCTTCGAAATACCCATAAACCGGATGATCGTTCGCCTGTCATTCTAGTCCCATCAACACCTTCTCAA
TCTGGGAGCTCTGACTATGCAAGTTCTGTGGGCAAATATCAATCACGCTCTAAAGAGGACGATAGCTATGAACAA
GGTCAAAGCGCTGAACGTACAATGCTTGATAACTCTTCCAGCAGAGGTTCTCAGTACTCCCAAGGCTTCGACGGT
CAGGATGAAGTTGCCGAAGTCCAAAATTTGTATTCGACTAAAAGCTCCACCAACCTCGGCCCTGCTCGTCCCCAA
CTTCCTTTGAACACAAACGTCTTCGAGGAAACTCAGATGGCAACCCAAGAGGCAACCCAAATTGCGACTCAAGAA
GCCGTGGTGCTTACGCCTTCCAGTGTTGCAGCTCAGACTCATACTACTATCAATGTTGGACCTCGAAGTTTACTT
AACACTATGGATCAAAATAAACGGAATCGATACCAACGCCTCCTCCAGTACACTCCCAACAGTCCGATTTCTCCA
GCACAACAATATCTTGTAGATGTTCGGAGATTAGACGTAGACGATGCCAAAGCTCAGCCCATCGCGACTCCTGAT
CAACAAAAAAGAACAGCATTATTGCCAGAATACAAGTCCCCGCAAATCCCATCTTTTAAATCGCCACCTAAAAAA
ATCATATCTAAGCTGCCTCAGCAAACATCTGCCCCGGACGCTATGGACATTGTGCCTGATTCAGAACCTATGCGG
GAGACTGTACAGACTTCTATCTCAGAGGAAAAGCTTATGAGTGTCGGTAGAGTGAACGAAGTGGAGCAGGCCTCT
GACAGTGAAGGAACGGAAGACAGCGATAATATGCCGCCGAGAAAGCCTCTACAATGCGAGGAAGAAGAGGACCAA
GCGATTGCAAATAAACAGGAAGAGGAGGAGGAAGAGGAAGAGGAGGGGACAGATGATGACGACGACGAGCCACTT
TCCGCCCGTCTCCGTAAAGCCAGATCGAAGGCGCTGGTTGCTCCTTCAAAAGGTGATAAGCCCTCTGGGGTTACA
CGTACCTACGGCTCTAAGAGTGTCACAAAGAAGAAGGCTACCTCTACGGCAAAACGAGGTGAACTTCCACGCCAG
CAGAAAGCCAATCGAAAAAGTGGCTCAACCTCTGAGAGGATGAACGAGAAGCTCGTTCCGTCCTCTATTCCAAAT
CAAGATCACCCTCGTACTCGAAAATTCAGGGCTGCCACTGCCAAAGCAAAGGGAAAGCAGCCCTTGCGTATGTCA
TCTAGACCAACGTCTGTCAAGTCCCGCCGCGGTCGTCGTTCAACCACGGCTGAAGCTGAAAAAGATTCCGATATT
GAAATGGAAGAGGTTTCCGACAGTGAGGGAGATACGCAACCAGCTGATGAACCAAACGAGTACATGGAACCAGAA
ATCCCTTCGCAATCTCTTAAACGCAAACGAGGTAGACCCCCCAAAAGCAAGGACAATATTGTGGCTGCGGTAACA
CCGATCACACGTTTGACAAAGCGTCTCAAATCCGGGTCCACGACTTCTACAGCAAACGCGACCCGGGTATTTGCT
CTATGGAGTGGAAACAAACTATATTATCCCGGAATCGTTTCTGAATCGGTGGGAGATGGTAGATATAACATCAAA
TTCGATGATGATGCCGAAGGCACTGTCAGTACCGACGACATGCGAGTATATAACCTGCGCACTGGTGACCTCGTT
CGGGTCAATTCAAAAAAGAAAGACTGCAGAGTCCATAAAGTGAATCTGAGGACCAATATGGTTACACTCGAGATT
GACGGGGAGACTGAGGATGTTTCTATGAAGGCTATCGGTATTTCAGTGAAAAACATAACTTCCACATGGAACGAT
CGACATATCGACAAGCGATCAATAGCTCCCGCCATCCGTTTCTCGGACAATAAGCCATCGCCATCGCCATCTCGA
TCTGCCGCGAGTTTCCTCTCTGCCAAAGGTTCTCGACTGCCTCCGAAGTTCTTGCCAGGAGTTGGTTTGATTGTC
AGCCTGAGCGGAAACGGTACGAACGACAGGACCAAAGATGGGCGGTTACGCACAGAAATTCTCAACGCTGTTCGC
GATAGTGGGGGCGTGCTCGTTGACGATCTATTCAAATACTTGAGGATGGATCTATCGCACTCTTCTAATCGTTGG
GTTGGTGACTCGACAAATGTGCAGTGGGTTGGAGAACCGAGGGAGCTTCAGCGCTTGTTCTTGTTAGCAGATGAT
TGTAACCACAAGCCGAAATATCTGATGGCACTGGCGTTGGGAATACCGTGCCTTTCGGTTGAATGGCTGTATTCT
TGTCTCAGGGCGGGCAAGGAACTTGAATGGCGGTCTCATTTGTTACCTCAAGGAAGGCCTAATGCGATTGACGTG
CAACCCTCCCAGCAAATCGACTTGAACTGGGGCAACCGAACGGAGCATCTTTCAGAACTAATGACGAACCCCGTT
GCTCCTAGAATTCTTAAAGATCAATCAATTCTTTGCGTTGGGCCTGACATGACGCCAAAAAGCAAAGACACCGAT
AAAGGGGAAGCTGCGAGTTACATCATCCGCATCATTCTTGCCATGGGTGCTACAAGAGTTGAGGCCGTCCGCGAT
ACTTCTTTCGCTGAACATCCCCTTTCACATTATGACCTCTTGGTCATACGTGACAGGGAACAATATCACAGCGCT
TACTCGCAAACACATACCGTTGATTGGAATTGGATCAAGGATAGTTTGATCATGTCTCGTTTCCTACCCATGCCT
GATTGGCCTGTTGAAGAGGAGTCACAATGTTCCCAGAACCTTTGA
Transcript >Agabi119p4|056640
ATGAATGCATCTGATGGTAATTCAAGTGATGTCGACGCAATGGAGTCTCAGGCCTCCCAGTTGATTCATGCGGCT
CTTGAGCAATCCCCGACGTCCATTGCGGACTCGAAAAGGGCGAAGTCGAACAAGAATCTATCGGTGCATTCTTTG
ACTTCTTCCAAAAATTCGGCCGCATCTTCTGTTCACCAATATCACTTCCATGGTCTGGCTTCAACACAAACTCAA
TCTTACTCGGACAATGAAGAAGATAAAGGACTAATTCCAAACGAAGGCTCACAAAAAGAGAATTTTGAATCGGCA
AAGAGGAATAACGGGAAGGATAGGCAATGGACGCTGCCATCTCCTGATTGGGGTCCGTCTCCACCCCAAAAATCC
TCATCAAAAGACAATACGGCTAAGGCCGAGCAGTCAGGAACATCCAGACGCCCAACAAAGGCCAAGTCTCATATG
CCCAGCGTAACTCATTCAAAACTTGTGGTGCCTCAGCAAGTACGGGACTCCAAGAGCACAGACCTTCCACCCCCA
AGACCACAAGAGAGATTTTGGCCTCAATCATCACGTCGTCATAACAATCGGTCCAGTTCTCCTGACTTTTCCCAA
GATTCTTTTGCGCAAGGGGACTCACAGCTTTCCGAAGAAAGACTTTTAGTCACCTCAAAAAAGTTTACTATGCCT
CTAGCGGACCTTGCTCGGATTGACCACGAAGATATCCCAACAAAGACCGCTGGTCGAGTGGGAGTATCGCAGGCA
AACTATCTCCTTCGAAATACCCATAAACCGGATGATCGTTCGCCTGTCATTCTAGTCCCATCAACACCTTCTCAA
TCTGGGAGCTCTGACTATGCAAGTTCTGTGGGCAAATATCAATCACGCTCTAAAGAGGACGATAGCTATGAACAA
GGTCAAAGCGCTGAACGTACAATGCTTGATAACTCTTCCAGCAGAGGTTCTCAGTACTCCCAAGGCTTCGACGGT
CAGGATGAAGTTGCCGAAGTCCAAAATTTGTATTCGACTAAAAGCTCCACCAACCTCGGCCCTGCTCGTCCCCAA
CTTCCTTTGAACACAAACGTCTTCGAGGAAACTCAGATGGCAACCCAAGAGGCAACCCAAATTGCGACTCAAGAA
GCCGTGGTGCTTACGCCTTCCAGTGTTGCAGCTCAGACTCATACTACTATCAATGTTGGACCTCGAAGTTTACTT
AACACTATGGATCAAAATAAACGGAATCGATACCAACGCCTCCTCCAGTACACTCCCAACAGTCCGATTTCTCCA
GCACAACAATATCTTGTAGATGTTCGGAGATTAGACGTAGACGATGCCAAAGCTCAGCCCATCGCGACTCCTGAT
CAACAAAAAAGAACAGCATTATTGCCAGAATACAAGTCCCCGCAAATCCCATCTTTTAAATCGCCACCTAAAAAA
ATCATATCTAAGCTGCCTCAGCAAACATCTGCCCCGGACGCTATGGACATTGTGCCTGATTCAGAACCTATGCGG
GAGACTGTACAGACTTCTATCTCAGAGGAAAAGCTTATGAGTGTCGGTAGAGTGAACGAAGTGGAGCAGGCCTCT
GACAGTGAAGGAACGGAAGACAGCGATAATATGCCGCCGAGAAAGCCTCTACAATGCGAGGAAGAAGAGGACCAA
GCGATTGCAAATAAACAGGAAGAGGAGGAGGAAGAGGAAGAGGAGGGGACAGATGATGACGACGACGAGCCACTT
TCCGCCCGTCTCCGTAAAGCCAGATCGAAGGCGCTGGTTGCTCCTTCAAAAGGTGATAAGCCCTCTGGGGTTACA
CGTACCTACGGCTCTAAGAGTGTCACAAAGAAGAAGGCTACCTCTACGGCAAAACGAGGTGAACTTCCACGCCAG
CAGAAAGCCAATCGAAAAAGTGGCTCAACCTCTGAGAGGATGAACGAGAAGCTCGTTCCGTCCTCTATTCCAAAT
CAAGATCACCCTCGTACTCGAAAATTCAGGGCTGCCACTGCCAAAGCAAAGGGAAAGCAGCCCTTGCGTATGTCA
TCTAGACCAACGTCTGTCAAGTCCCGCCGCGGTCGTCGTTCAACCACGGCTGAAGCTGAAAAAGATTCCGATATT
GAAATGGAAGAGGTTTCCGACAGTGAGGGAGATACGCAACCAGCTGATGAACCAAACGAGTACATGGAACCAGAA
ATCCCTTCGCAATCTCTTAAACGCAAACGAGGTAGACCCCCCAAAAGCAAGGACAATATTGTGGCTGCGGTAACA
CCGATCACACGTTTGACAAAGCGTCTCAAATCCGGGTCCACGACTTCTACAGCAAACGCGACCCGGGTATTTGCT
CTATGGAGTGGAAACAAACTATATTATCCCGGAATCGTTTCTGAATCGGTGGGAGATGGTAGATATAACATCAAA
TTCGATGATGATGCCGAAGGCACTGTCAGTACCGACGACATGCGAGTATATAACCTGCGCACTGGTGACCTCGTT
CGGGTCAATTCAAAAAAGAAAGACTGCAGAGTCCATAAAGTGAATCTGAGGACCAATATGGTTACACTCGAGATT
GACGGGGAGACTGAGGATGTTTCTATGAAGGCTATCGGTATTTCAGTGAAAAACATAACTTCCACATGGAACGAT
CGACATATCGACAAGCGATCAATAGCTCCCGCCATCCGTTTCTCGGACAATAAGCCATCGCCATCGCCATCTCGA
TCTGCCGCGAGTTTCCTCTCTGCCAAAGGTTCTCGACTGCCTCCGAAGTTCTTGCCAGGAGTTGGTTTGATTGTC
AGCCTGAGCGGAAACGGTACGAACGACAGGACCAAAGATGGGCGGTTACGCACAGAAATTCTCAACGCTGTTCGC
GATAGTGGGGGCGTGCTCGTTGACGATCTATTCAAATACTTGAGGATGGATCTATCGCACTCTTCTAATCGTTGG
GTTGGTGACTCGACAAATGTGCAGTGGGTTGGAGAACCGAGGGAGCTTCAGCGCTTGTTCTTGTTAGCAGATGAT
TGTAACCACAAGCCGAAATATCTGATGGCACTGGCGTTGGGAATACCGTGCCTTTCGGTTGAATGGCTGTATTCT
TGTCTCAGGGCGGGCAAGGAACTTGAATGGCGGTCTCATTTGTTACCTCAAGGAAGGCCTAATGCGATTGACGTG
CAACCCTCCCAGCAAATCGACTTGAACTGGGGCAACCGAACGGAGCATCTTTCAGAACTAATGACGAACCCCGTT
GCTCCTAGAATTCTTAAAGATCAATCAATTCTTTGCGTTGGGCCTGACATGACGCCAAAAAGCAAAGACACCGAT
AAAGGGGAAGCTGCGAGTTACATCATCCGCATCATTCTTGCCATGGGTGCTACAAGAGTTGAGGCCGTCCGCGAT
ACTTCTTTCGCTGAACATCCCCTTTCACATTATGACCTCTTGGTCATACGTGACAGGGAACAATATCACAGCGCT
TACTCGCAAACACATACCGTTGATTGGAATTGGATCAAGGATAGTTTGATCATGTCTCGTTTCCTACCCATGCCT
GATTGGCCTGTTGAAGAGGAGTCACAATGTTCCCAGAACCTTTGA
Gene >Agabi119p4|056640
ATGAATGCATCTGATGGTAATTCAAGGTGTGAGCGTATCTTTCTTTGATGGGGTCATTGTTAAGCTTCAAGACGT
TCTTCACAGTGATGTCGACGCAATGGAGTCTCAGGCCTCCCAGTTGATTCATGCGGCTCTTGAGCAATCCCCGAC
GTCCATTGCGGACTCGAAAAGGGCGAAGTCGAACAAGAATCTATCGGTGCATTCTTTGACTTCTTCCAAAAATTC
GGCCGCATCTTCTGTTCACCAATATCACTTCCATGGTCTGGCTTCAACACAAACTCAATCTTACTCGGACAATGA
AGAAGATAAAGGACTAATTCCAAACGAAGGCTCACAAAAAGAGAATTTTGAATCGGCAAAGAGGAATAACGGGAA
GGATAGGCAATGGACGCTGCCATCTCCTGATTGGGGTCCGTCTCCACCCCAAAAATCCTCATCAAAAGACAATAC
GGCTAAGGCCGAGCAGTCAGGAACATCCAGACGCCCAACAAAGGTATATATGGAGTGTTTTGTTCATCCTTGTCA
TTTTTTGAATCTTTCTTGAAAGGCCAAGTCTCATATGCCCAGCGTAACTCATTCAAAACTTGTGGTGCCTCAGCA
AGTACGGGACTCCAAGAGCACAGACCTTCCACCCCCAAGACCACAAGAGAGATTTTGGCCTCAATCATCACGTCG
TCATAACAATCGGTCCAGTTCTCCTGACTTTTCCCAAGATTCTTTTGCGCAAGGGGACTCACAGCTTTCCGAAGA
AAGACTTTTAGTCACCTCAAAAAAGTTTACTATGCCTCTAGCGGACCTTGCTCGGATTGACCACGAAGATATCCC
AACAAAGACCGCTGGTCGAGTGGGAGTATCGCAGGCAAACTATCTCCTTCGAAATACCCATAAACCGGATGATCG
TTCGCCTGTCATTCTAGTCCCATCAACACCTTCTCAATCTGGGAGCTCTGACTATGCAAGTTCTGTGGGCAAATA
TCAATCACGCTCTAAAGAGGACGATAGCTATGAACAAGGTCAAAGCGCTGAACGTACAATGCTTGATAACTCTTC
CAGCAGAGGTTCTCAGTACTCCCAAGGCTTCGACGGTCAGGATGAAGTTGCCGAAGTCCAAAATTTGTATTCGAC
TAAAAGCTCCACCAACCTCGGCCCTGCTCGTCCCCAACTTCCTTTGAACACAAACGTCTTCGAGGAAACTCAGAT
GGCAACCCAAGAGGCAACCCAAATTGCGACTCAAGAAGCCGTGGTGCTTACGCCTTCCAGTGTTGCAGCTCAGAC
TCATACTACTATCAATGTTGGACCTCGAAGTTTACTTAACACTATGGATCAAAATAAACGGAATCGATACCAACG
CCTCCTCCAGTACACTCCCAACAGTCCGATTTCTCCAGCACAACAATATCTTGTAGATGTTCGGAGATTAGACGT
AGACGATGCCAAAGCTCAGCCCATCGCGACTCCTGATCAACAAAAAAGAACAGCATTATTGCCAGAATACAAGTC
CCCGCAAATCCCATCTTTTAAATCGCCACCTAAAAAAATCATATCTAAGCTGCCTCAGCAAACATCTGCCCCGGA
CGCTATGGACATTGTGCCTGATTCAGAACCTATGCGGGAGACTGTACAGACTTCTATCTCAGAGGAAAAGCTTAT
GAGTGTCGGTAGAGTGAACGAAGTGGAGCAGGCCTCTGACAGTGAAGGAACGGAAGACAGCGATAATATGCCGCC
GAGAAAGCCTCTACAATGCGAGGAAGAAGAGGACCAAGCGATTGCAAATAAACAGGAAGAGGAGGAGGAAGAGGA
AGAGGAGGGGACAGATGATGACGACGACGAGCCACTTTCCGCCCGTCTCCGTAAAGCCAGATCGAAGGCGCTGGT
TGCTCCTTCAAAAGGTGATAAGCCCTCTGGGGTTACACGTACCTACGGCTCTAAGGTAGGAAAATGTTGTCCATC
CTCATCAGATACACCGTCGCTGACGAACGTCAAGAGTGTCACAAAGAAGAAGGCTACCTCTACGGCAAAACGAGG
TGAACTTCCACGCCAGCAGAAAGCCAATCGAAAAAGTGGCTCAACCTCTGAGAGGATGAACGAGAAGCTCGTTCC
GTCCTCTATTCCAAATCAAGATCACCCTCGTACTCGAAAATTCAGGGCTGCCACTGCCAAAGCAAAGGGAAAGCA
GCCCTTGCGTATGTCATCTAGACCAACGTCTGTCAAGTCCCGCCGCGGTCGTCGTTCAACCACGGCTGAAGCTGA
AAAAGATTCCGATATTGAAATGGAAGAGGTTTCCGACAGTGAGGGAGATACGCAACCAGCTGATGAACCAAACGA
GTACATGGAACCAGAAATCCCTTCGCAATCTCTTAAACGCAAACGAGGTAGACCCCCCAAAAGCAAGGACAATAT
TGTGGCTGCGGTAACACCGATCACACGTTTGACAAAGCGTCTCAAATCCGGGTCCACGACTTCTACAGCAAACGC
GACCCGGGTATTTGCTCTATGGAGTGGAAACAAACTATATTATCCCGGAATCGTTTCTGAATCGGTGGGAGATGG
TAGATATAACATCAAATTCGATGATGATGCCGAAGGCACTGTCAGTACCGACGACATGCGAGTATATAACCTGCG
CACTGGTGACCTCGTTCGGGTCAATTCAAAAAAGAAAGACTGCAGAGTCCATAAAGTGAATCTGAGGACCAATAT
GGTTACACTCGAGATTGACGGGGAGACTGAGGATGTTTCTATGAAGGCTATCGGTATTTCAGTGAAAAACATAAC
TTCCACATGGAACGATCGACATATCGACAAGCGATCAATAGCTCCCGCCATCCGTTTCTCGGACAATAAGCCATC
GCCATCGCCATCTCGATCTGCCGCGAGTTTCCTCTCTGCCAAAGGTTCTCGACTGCCTCCGAAGTTCTTGCCAGG
AGTTGGTTTGATTGTCAGCCTGAGCGGAAACGGTACGAACGACAGGACCAAAGATGGGCGGTTACGCACAGAAAT
TCTCAACGCTGTTCGCGATAGTGGGGGCGTGCTCGTTGACGATCTATTCAAATACTTGAGGATGGATCTATCGCA
CTCTTCTAATCGTTGGGTTGGTGACTCGACAAATGTGCAGTGGGTTGGAGAACCGAGGGAGCTTCAGCGCTTGTT
CTTGTTAGCAGATGATTGTAACCACAAGCCGAAATATCTGATGGCACTGGCGTTGGGAATACCGTGCCTTTCGGT
TGAATGGCTGTATTCTTGTCTCAGGGCGGTAAGGCCTTTTTGACTCCTCACGCAACGGCGCTGATGGTATATATT
ATCATCATCAGGGCAAGGAACTTGAATGGCGGTCTCATTTGTTACCTCAAGGAAGGCCTAATGCGATTGACGTGC
AACCCTCCCAGCAAATCGACTTGAACTGGGGCAACCGAACGGAGCATCTTTCAGAACTAATGACGAACCCCGTTG
CTCCTAGAATTCTTAAAGATCAATCAATTCTTTGCGTTGGGCCTGACATGACGCCAAAAAGCAAAGTATGTTACC
TCTATAAAATCATGTCTTAGTATTGACATCAGTCGAAGGACACCGATAAAGGGGAAGCTGCGAGTTACATCATCC
GCATCATTCTTGCCATGGGTGCTACAAGAGTTGAGGCCGTCCGCGATACTTCTTTCGCTGAACATCCCCTTTCAC
ATTATGACCTCTTGGTCATACGTGACAGGGAACAATATCACAGCGCTTACTCGCAAACACATACCGTTGATTGGA
ATTGGATCAAGGATAGTTTGATCATGTCTCGTTTCCTACCCATGCCTGATTGGCCTGTTGAAGAGGAGTCACAAT
GTTCCCAGAACCTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail