Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|056470
Gene name
Locationscaffold_03a:968625..971500
Strand-
Gene length (bp)2875
Transcript length (bp)2670
Coding sequence length (bp)2670
Protein length (aa) 890

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00082 Peptidase_S8 Subtilase family 1.1E-34 189 453
PF01483 P_proprotein Proprotein convertase P-domain 1.7E-26 538 625

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13359|KEX2_CANAW Kexin OS=Candida albicans (strain WO-1) GN=KEX2 PE=3 SV=2 1 640 8.0E-163
sp|P09231|KEX1A_KLULA Protease KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=2 127 672 1.0E-160
sp|Q09175|KRP1_SCHPO Dibasic-processing endoprotease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krp1 PE=1 SV=1 3 705 3.0E-153
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 56 648 7.0E-153
sp|P42781|XPR6_YARLI Dibasic-processing endoprotease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR6 PE=3 SV=1 154 627 3.0E-138
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13359|KEX2_CANAW Kexin OS=Candida albicans (strain WO-1) GN=KEX2 PE=3 SV=2 1 640 8.0E-163
sp|P09231|KEX1A_KLULA Protease KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=2 127 672 1.0E-160
sp|Q09175|KRP1_SCHPO Dibasic-processing endoprotease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=krp1 PE=1 SV=1 3 705 3.0E-153
sp|P13134|KEX2_YEAST Kexin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX2 PE=1 SV=1 56 648 7.0E-153
sp|P42781|XPR6_YARLI Dibasic-processing endoprotease OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=XPR6 PE=3 SV=1 154 627 3.0E-138
sp|P29120|NEC1_HUMAN Neuroendocrine convertase 1 OS=Homo sapiens GN=PCSK1 PE=1 SV=2 11 629 9.0E-116
sp|P28840|NEC1_RAT Neuroendocrine convertase 1 OS=Rattus norvegicus GN=Pcsk1 PE=2 SV=1 11 629 1.0E-115
sp|P63240|NEC1_MUSCO Neuroendocrine convertase 1 OS=Mus cookii GN=Pcsk1 PE=2 SV=1 8 629 7.0E-115
sp|P63239|NEC1_MOUSE Neuroendocrine convertase 1 OS=Mus musculus GN=Pcsk1 PE=1 SV=1 8 629 2.0E-114
sp|P23377|FURIN_RAT Furin OS=Rattus norvegicus GN=Furin PE=1 SV=1 109 629 3.0E-114
sp|Q9GLR1|NEC1_BOVIN Neuroendocrine convertase 1 OS=Bos taurus GN=PCSK1 PE=2 SV=1 8 629 1.0E-113
sp|P09958|FURIN_HUMAN Furin OS=Homo sapiens GN=FURIN PE=1 SV=2 140 629 4.0E-113
sp|P23188|FURIN_MOUSE Furin OS=Mus musculus GN=Furin PE=1 SV=2 109 629 8.0E-113
sp|Q28193|FURIN_BOVIN Furin OS=Bos taurus GN=FURIN PE=1 SV=1 109 629 2.0E-112
sp|Q78EH2|PCSK4_RAT Proprotein convertase subtilisin/kexin type 4 OS=Rattus norvegicus GN=Pcsk4 PE=2 SV=1 129 629 1.0E-111
sp|P29121|PCSK4_MOUSE Proprotein convertase subtilisin/kexin type 4 OS=Mus musculus GN=Pcsk4 PE=2 SV=1 129 608 7.0E-109
sp|P29122|PCSK6_HUMAN Proprotein convertase subtilisin/kexin type 6 OS=Homo sapiens GN=PCSK6 PE=1 SV=1 100 656 2.0E-108
sp|Q6UW60|PCSK4_HUMAN Proprotein convertase subtilisin/kexin type 4 OS=Homo sapiens GN=PCSK4 PE=2 SV=2 123 629 2.0E-108
sp|Q63415|PCSK6_RAT Proprotein convertase subtilisin/kexin type 6 OS=Rattus norvegicus GN=Pcsk6 PE=2 SV=1 100 629 7.0E-108
sp|P29119|FURI1_XENLA Furin-1 OS=Xenopus laevis GN=furin PE=2 SV=1 109 629 3.0E-107
sp|P21661|NEC2_MOUSE Neuroendocrine convertase 2 OS=Mus musculus GN=Pcsk2 PE=1 SV=1 125 605 7.0E-107
sp|P28841|NEC2_RAT Neuroendocrine convertase 2 OS=Rattus norvegicus GN=Pcsk2 PE=1 SV=1 125 605 1.0E-106
sp|Q03333|NEC2_PIG Neuroendocrine convertase 2 OS=Sus scrofa GN=PCSK2 PE=2 SV=1 125 628 1.0E-106
sp|Q5REC2|NEC2_PONAB Neuroendocrine convertase 2 OS=Pongo abelii GN=PCSK2 PE=2 SV=1 125 605 2.0E-106
sp|P16519|NEC2_HUMAN Neuroendocrine convertase 2 OS=Homo sapiens GN=PCSK2 PE=2 SV=2 125 605 2.0E-106
sp|Q9GLR0|NEC2_BOVIN Neuroendocrine convertase 2 OS=Bos taurus GN=PCSK2 PE=2 SV=1 125 628 6.0E-106
sp|P51559|BLI4_CAEEL Endoprotease bli-4 OS=Caenorhabditis elegans GN=bli-4 PE=2 SV=2 130 629 3.0E-105
sp|Q16549|PCSK7_HUMAN Proprotein convertase subtilisin/kexin type 7 OS=Homo sapiens GN=PCSK7 PE=1 SV=2 124 639 2.0E-104
sp|Q61139|PCSK7_MOUSE Proprotein convertase subtilisin/kexin type 7 OS=Mus musculus GN=Pcsk7 PE=2 SV=2 59 628 1.0E-103
sp|Q62849|PCSK7_RAT Proprotein convertase subtilisin/kexin type 7 OS=Rattus norvegicus GN=Pcsk7 PE=1 SV=1 124 628 1.0E-103
sp|P30432|FUR2_DROME Furin-like protease 2 OS=Drosophila melanogaster GN=Fur2 PE=2 SV=2 148 666 3.0E-102
sp|P29145|NECB_HYDVU PC3-like endoprotease variant B OS=Hydra vulgaris PE=2 SV=1 112 607 1.0E-101
sp|P41413|PCSK5_RAT Proprotein convertase subtilisin/kexin type 5 OS=Rattus norvegicus GN=Pcsk5 PE=2 SV=3 64 645 1.0E-101
sp|Q04592|PCSK5_MOUSE Proprotein convertase subtilisin/kexin type 5 OS=Mus musculus GN=Pcsk5 PE=1 SV=3 100 645 2.0E-101
sp|P29146|NECA_HYDVU PC3-like endoprotease variant A OS=Hydra vulgaris PE=2 SV=1 112 607 5.0E-101
sp|Q92824|PCSK5_HUMAN Proprotein convertase subtilisin/kexin type 5 OS=Homo sapiens GN=PCSK5 PE=1 SV=4 100 645 1.0E-100
sp|P30430|FUR1C_DROME Furin-like protease 1, isoform 1-CRR OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 99 628 4.0E-97
sp|P26016|FUR11_DROME Furin-like protease 1, isoforms 1/1-X/2 OS=Drosophila melanogaster GN=Fur1 PE=2 SV=2 99 628 3.0E-96
sp|Q9NJ15|PCSK5_BRACL Proprotein convertase subtilisin/kexin type 5 OS=Branchiostoma californiense GN=PC6 PE=2 SV=1 138 629 1.0E-91
sp|O17798|FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans GN=kpc-1 PE=1 SV=2 90 487 2.0E-88
sp|P23916|PRCA_ANAVT Calcium-dependent protease OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=prcA PE=1 SV=3 157 612 9.0E-31
sp|Q59149|PRCA_NOSS1 Calcium-dependent protease OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=prcA PE=3 SV=2 157 612 1.0E-30
sp|P31339|ASPA_AERSA Microbial serine proteinase OS=Aeromonas salmonicida GN=aspA PE=1 SV=1 189 607 1.0E-14
sp|O17798|FKPC1_CAEEL Furin-like protease kpc-1 OS=Caenorhabditis elegans GN=kpc-1 PE=1 SV=2 531 628 2.0E-10
sp|Q00139|VG47_ICHVA Subtilisin-like protease OS=Ictalurid herpesvirus 1 (strain Auburn) GN=ORF47 PE=3 SV=2 270 606 3.0E-10
sp|P42779|BPRV_DICNO Extracellular basic protease OS=Dichelobacter nodosus GN=bprV PE=1 SV=1 142 625 3.0E-10
sp|P29143|HLY_NATA1 Halolysin OS=Natrialba asiatica (strain ATCC 700177 / DSM 12278 / JCM 9576 / FERM P-10747 / NBRC 102637 / 172P1) GN=hly PE=1 SV=1 124 436 1.0E-08
sp|P23314|EXPR_XANCP Extracellular protease OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC0851 PE=3 SV=1 157 442 2.0E-08
sp|P29139|ISP_PAEPO Intracellular serine protease OS=Paenibacillus polymyxa GN=isp PE=1 SV=1 163 423 1.0E-07
sp|P29141|SUBV_BACSU Minor extracellular protease vpr OS=Bacillus subtilis (strain 168) GN=vpr PE=1 SV=1 177 271 1.0E-06
sp|Q9RYM8|SUB2_DEIRA Probable subtilase-type serine protease DR_A0283 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_A0283 PE=1 SV=1 157 503 2.0E-06
sp|P07518|SUBT_BACPU Subtilisin OS=Bacillus pumilus GN=apr PE=1 SV=1 177 473 2.0E-06
sp|P35835|SUBN_BACNA Subtilisin NAT OS=Bacillus subtilis subsp. natto GN=aprN PE=1 SV=1 167 473 4.0E-06
sp|P11018|ISP1_BACSU Major intracellular serine protease OS=Bacillus subtilis (strain 168) GN=isp PE=1 SV=2 159 462 4.0E-06
sp|I3R794|HLY_HALMT Halolysin OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=hly PE=1 SV=1 149 471 5.0E-06
sp|Q99405|PRTM_BACSK M-protease OS=Bacillus clausii (strain KSM-K16) GN=aprE PE=1 SV=2 186 476 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004252 serine-type endopeptidase activity Yes
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0003824 catalytic activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0004175 endopeptidase activity No
GO:0044238 primary metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008233 peptidase activity No
GO:0019538 protein metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0017171 serine hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 721 743 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|056470
MRLLHPLLAAFLLHSSLAARPAKRSYDTHDYYVIEHIPHASAASLDDVLHALGVEFVEQAGELVNHWLVRTPRNL
YDLSFREEPRDRVVDAFQALRVRAHSSSSKRSTYTDHAHRIVSSIGHLSKQQLRRRVKRAPPPIKPEVSESSRAV
AKRLGIQDPFFEKQWHHVNDEFPEHMMNATPVWEMGYTGKGVISSLVDDGLDYTSDDLAANFDADDSHDFNDHEA
LPTPKNSDDHHGTRCAGQIAAVKNTVCGLGLAYESKVAGVRILSGPITDVDEATALNYGFQNVSIFSCSWGPPDN
GMSMEGPGYLIKKAVVNGINQGRGGKGSIFVFASGNGAASDDQCNFDGYTNSIYSLTVAAIDYKGLHPYYSEACA
ANMVVAYSSGSGQHIVTTDKGKDSCATTHGGTSAAAPNAAGVFVLALQARPDLSWRDIQHLSVETARIVNPDDKD
WEKTATGRLYSYKYGYGAIDAYAFVKAAESWTPVKSQSWIFTETVQLNGGKMPTPSNYTGGQFIGPGGVENKITV
TQQMLEDNNFEKLEHVNVKVWIQHTRRGHVEVEIVSPNGIKSVLASKRQFDNDESGFPGWTFMSVKHWGEDPVGD
WTIRVSDQNEVEKNNGSFLGWNMIFWGSAINTDKTRLFEVEDVEDVLPPTKAPMRPILPSASMTTQYTKPTSHLP
PVDGGMEDEISQAGSSSASPDATATDVPTAPGWFDEMSRLLSNSKWFFGALSLVILFGVGVGVFFCLRRRKRREQ
SSYGRLANDDVSMAGLGNRGGNGRTRELYDAFGEVSEDEEDADENTKLRGTYPPGRSTDGLGFHSGFLDDEEPST
AGGVTPRREHYKDDSSEDGDDTSDSGKEKSKEEIELINTAGPNSPNTRTSGDAGSWEHASSATP*
Coding >Agabi119p4|056470
ATGCGTCTCCTCCATCCCCTCCTCGCCGCTTTTCTCCTACATTCCTCCCTCGCCGCTCGTCCCGCAAAGCGTTCT
TACGACACACACGACTACTATGTCATCGAACATATCCCTCATGCCTCTGCCGCTTCTCTAGACGATGTCCTGCAT
GCCCTGGGGGTAGAATTCGTCGAACAGGCTGGAGAACTAGTAAATCATTGGCTGGTTCGCACCCCTAGAAATCTC
TACGATCTATCATTCCGAGAAGAACCTCGAGACCGGGTAGTCGATGCGTTTCAGGCTCTTCGAGTGCGAGCACAT
TCATCATCCTCAAAACGTTCCACGTATACAGACCATGCGCACAGGATAGTTTCCTCCATCGGGCATCTATCCAAA
CAACAACTTCGCCGGCGAGTTAAGCGTGCCCCTCCTCCAATAAAACCGGAGGTTTCTGAATCCTCCCGTGCTGTT
GCAAAACGTCTTGGCATCCAAGATCCCTTCTTCGAAAAACAGTGGCACCACGTCAATGACGAGTTTCCCGAGCAC
ATGATGAATGCGACCCCTGTATGGGAGATGGGATACACCGGAAAAGGCGTCATTTCTTCCCTCGTGGATGACGGC
CTTGACTATACAAGTGATGATCTCGCAGCCAATTTTGATGCCGATGATTCGCATGACTTTAATGACCATGAGGCA
CTTCCAACCCCAAAAAATTCCGATGACCACCACGGCACAAGATGCGCAGGTCAGATAGCCGCAGTCAAGAACACC
GTATGTGGTCTTGGTCTCGCTTACGAATCCAAGGTCGCTGGTGTTCGCATATTGTCTGGTCCCATAACGGACGTC
GATGAAGCGACTGCGCTCAATTATGGTTTCCAAAACGTATCTATCTTTAGCTGTAGTTGGGGCCCACCTGACAAT
GGTATGTCCATGGAAGGCCCAGGATACCTCATCAAAAAAGCTGTCGTCAACGGCATTAACCAGGGACGTGGCGGG
AAGGGCTCCATTTTCGTCTTCGCCAGTGGCAACGGCGCTGCTTCGGATGACCAATGCAATTTCGATGGATACACT
AACAGCATATATTCCCTCACGGTTGCTGCGATAGATTACAAGGGTTTACATCCATATTACTCGGAGGCTTGTGCC
GCTAATATGGTTGTGGCATACAGTTCTGGCAGTGGACAGCACATTGTCACTACTGACAAAGGGAAAGACTCCTGT
GCAACCACCCATGGTGGTACGTCCGCAGCCGCTCCAAACGCTGCAGGCGTTTTTGTTCTAGCCTTACAGGCTCGA
CCGGACCTTTCGTGGCGTGACATCCAACACCTTAGTGTAGAGACGGCAAGAATAGTCAATCCGGACGACAAAGAT
TGGGAAAAGACTGCAACTGGGAGGTTATACAGCTACAAATACGGGTACGGAGCAATTGACGCCTATGCCTTCGTC
AAAGCCGCCGAATCATGGACGCCAGTCAAATCACAATCCTGGATTTTTACCGAGACGGTCCAGCTCAATGGTGGA
AAGATGCCCACTCCAAGCAACTACACCGGCGGGCAGTTCATTGGACCCGGAGGCGTCGAAAACAAAATCACGGTC
ACGCAGCAAATGCTAGAGGACAATAACTTCGAGAAACTTGAGCATGTCAATGTCAAAGTTTGGATACAACATACC
CGACGAGGCCATGTGGAGGTGGAGATTGTTAGCCCGAATGGAATAAAAAGCGTGTTAGCCAGTAAACGTCAGTTC
GACAATGATGAGTCGGGCTTCCCAGGGTGGACCTTTATGAGCGTGAAACACTGGGGTGAAGATCCTGTTGGTGAT
TGGACTATTCGTGTTTCCGACCAAAATGAAGTCGAAAAAAATAATGGTTCCTTCCTTGGATGGAACATGATTTTC
TGGGGTTCAGCTATCAACACTGACAAAACACGTCTATTTGAAGTCGAAGATGTCGAAGATGTCCTTCCACCGACC
AAGGCGCCTATGCGTCCTATTTTACCTTCTGCCTCCATGACTACGCAGTACACCAAACCTACTTCACACCTCCCA
CCTGTTGATGGTGGTATGGAAGATGAAATCTCGCAAGCCGGATCTTCATCAGCCAGTCCAGATGCAACTGCCACG
GATGTTCCTACAGCGCCGGGCTGGTTTGACGAAATGTCGAGATTGCTTTCAAACAGCAAATGGTTCTTTGGCGCT
TTGTCACTAGTTATCCTCTTTGGAGTAGGCGTCGGCGTATTCTTCTGCCTGCGTAGACGAAAACGAAGAGAACAA
AGCTCCTATGGACGGCTCGCGAATGACGATGTGTCGATGGCCGGATTGGGCAATCGCGGGGGTAACGGGCGTACG
AGGGAATTATATGATGCATTTGGCGAAGTTTCTGAAGATGAGGAAGATGCGGATGAGAATACAAAACTACGTGGA
ACTTACCCTCCTGGACGATCCACCGATGGGCTTGGATTCCATTCTGGGTTCTTGGATGATGAGGAACCCTCGACC
GCGGGAGGTGTGACGCCACGTCGCGAGCATTATAAGGATGACAGTTCTGAGGATGGTGATGATACCAGTGACTCT
GGAAAGGAGAAGAGTAAAGAGGAAATCGAACTCATTAATACAGCTGGGCCTAATAGTCCAAATACTAGGACGAGT
GGAGACGCCGGTAGCTGGGAACATGCCAGCAGCGCAACACCATAG
Transcript >Agabi119p4|056470
ATGCGTCTCCTCCATCCCCTCCTCGCCGCTTTTCTCCTACATTCCTCCCTCGCCGCTCGTCCCGCAAAGCGTTCT
TACGACACACACGACTACTATGTCATCGAACATATCCCTCATGCCTCTGCCGCTTCTCTAGACGATGTCCTGCAT
GCCCTGGGGGTAGAATTCGTCGAACAGGCTGGAGAACTAGTAAATCATTGGCTGGTTCGCACCCCTAGAAATCTC
TACGATCTATCATTCCGAGAAGAACCTCGAGACCGGGTAGTCGATGCGTTTCAGGCTCTTCGAGTGCGAGCACAT
TCATCATCCTCAAAACGTTCCACGTATACAGACCATGCGCACAGGATAGTTTCCTCCATCGGGCATCTATCCAAA
CAACAACTTCGCCGGCGAGTTAAGCGTGCCCCTCCTCCAATAAAACCGGAGGTTTCTGAATCCTCCCGTGCTGTT
GCAAAACGTCTTGGCATCCAAGATCCCTTCTTCGAAAAACAGTGGCACCACGTCAATGACGAGTTTCCCGAGCAC
ATGATGAATGCGACCCCTGTATGGGAGATGGGATACACCGGAAAAGGCGTCATTTCTTCCCTCGTGGATGACGGC
CTTGACTATACAAGTGATGATCTCGCAGCCAATTTTGATGCCGATGATTCGCATGACTTTAATGACCATGAGGCA
CTTCCAACCCCAAAAAATTCCGATGACCACCACGGCACAAGATGCGCAGGTCAGATAGCCGCAGTCAAGAACACC
GTATGTGGTCTTGGTCTCGCTTACGAATCCAAGGTCGCTGGTGTTCGCATATTGTCTGGTCCCATAACGGACGTC
GATGAAGCGACTGCGCTCAATTATGGTTTCCAAAACGTATCTATCTTTAGCTGTAGTTGGGGCCCACCTGACAAT
GGTATGTCCATGGAAGGCCCAGGATACCTCATCAAAAAAGCTGTCGTCAACGGCATTAACCAGGGACGTGGCGGG
AAGGGCTCCATTTTCGTCTTCGCCAGTGGCAACGGCGCTGCTTCGGATGACCAATGCAATTTCGATGGATACACT
AACAGCATATATTCCCTCACGGTTGCTGCGATAGATTACAAGGGTTTACATCCATATTACTCGGAGGCTTGTGCC
GCTAATATGGTTGTGGCATACAGTTCTGGCAGTGGACAGCACATTGTCACTACTGACAAAGGGAAAGACTCCTGT
GCAACCACCCATGGTGGTACGTCCGCAGCCGCTCCAAACGCTGCAGGCGTTTTTGTTCTAGCCTTACAGGCTCGA
CCGGACCTTTCGTGGCGTGACATCCAACACCTTAGTGTAGAGACGGCAAGAATAGTCAATCCGGACGACAAAGAT
TGGGAAAAGACTGCAACTGGGAGGTTATACAGCTACAAATACGGGTACGGAGCAATTGACGCCTATGCCTTCGTC
AAAGCCGCCGAATCATGGACGCCAGTCAAATCACAATCCTGGATTTTTACCGAGACGGTCCAGCTCAATGGTGGA
AAGATGCCCACTCCAAGCAACTACACCGGCGGGCAGTTCATTGGACCCGGAGGCGTCGAAAACAAAATCACGGTC
ACGCAGCAAATGCTAGAGGACAATAACTTCGAGAAACTTGAGCATGTCAATGTCAAAGTTTGGATACAACATACC
CGACGAGGCCATGTGGAGGTGGAGATTGTTAGCCCGAATGGAATAAAAAGCGTGTTAGCCAGTAAACGTCAGTTC
GACAATGATGAGTCGGGCTTCCCAGGGTGGACCTTTATGAGCGTGAAACACTGGGGTGAAGATCCTGTTGGTGAT
TGGACTATTCGTGTTTCCGACCAAAATGAAGTCGAAAAAAATAATGGTTCCTTCCTTGGATGGAACATGATTTTC
TGGGGTTCAGCTATCAACACTGACAAAACACGTCTATTTGAAGTCGAAGATGTCGAAGATGTCCTTCCACCGACC
AAGGCGCCTATGCGTCCTATTTTACCTTCTGCCTCCATGACTACGCAGTACACCAAACCTACTTCACACCTCCCA
CCTGTTGATGGTGGTATGGAAGATGAAATCTCGCAAGCCGGATCTTCATCAGCCAGTCCAGATGCAACTGCCACG
GATGTTCCTACAGCGCCGGGCTGGTTTGACGAAATGTCGAGATTGCTTTCAAACAGCAAATGGTTCTTTGGCGCT
TTGTCACTAGTTATCCTCTTTGGAGTAGGCGTCGGCGTATTCTTCTGCCTGCGTAGACGAAAACGAAGAGAACAA
AGCTCCTATGGACGGCTCGCGAATGACGATGTGTCGATGGCCGGATTGGGCAATCGCGGGGGTAACGGGCGTACG
AGGGAATTATATGATGCATTTGGCGAAGTTTCTGAAGATGAGGAAGATGCGGATGAGAATACAAAACTACGTGGA
ACTTACCCTCCTGGACGATCCACCGATGGGCTTGGATTCCATTCTGGGTTCTTGGATGATGAGGAACCCTCGACC
GCGGGAGGTGTGACGCCACGTCGCGAGCATTATAAGGATGACAGTTCTGAGGATGGTGATGATACCAGTGACTCT
GGAAAGGAGAAGAGTAAAGAGGAAATCGAACTCATTAATACAGCTGGGCCTAATAGTCCAAATACTAGGACGAGT
GGAGACGCCGGTAGCTGGGAACATGCCAGCAGCGCAACACCATAG
Gene >Agabi119p4|056470
ATGCGTCTCCTCCATCCCCTCCTCGCCGCTTTTCTCCTACATTCCTCCCTCGCCGCTCGTCCCGCAAAGCGTTCT
TACGACACACACGACTACTATGTCATCGAACATATCCCTCATGCCTCTGCCGCTTCTCTAGACGATGTCCTGCAT
GCCCTGGGGGTAGAATTCGTCGAACAGGCTGGAGAACTAGTAAATCATTGGCTGGTTCGCACCCCTAGAAATCTC
TACGATCTATCATTCCGAGAAGAACCTCGAGACCGGGTAGTCGATGCGTTTCAGGCTCTTCGAGTGCGAGCACAT
TCATCATCCTCAAAACGTTCCACGTATACAGACCATGCGCACAGGATAGTTTCCTCCATCGGGCATCTATCCAAA
CAACAACTTCGCCGGCGAGTTAAGCGTGCCCCTCCTCCAATAAAACCGGAGGTTTCTGAATCCTCCCGTGCTGTT
GCAAAACGTCTTGGCATCCAAGATCCCTTCTTCGAAAAACAGTGGCACCACGTCAATGACGAGTTTCCCGAGCAC
ATGATGAATGCGACCCCTGTATGGGAGATGGGATACACCGGAAAAGGCGTCATTTCTTCCCTCGTGGATGACGGC
CTTGACTATACAAGTGATGATCTCGCAGCCAATTTTGTGCGCTTTCCCGTTTCTCTTCCGTCCTTGACACTCACC
CACCATCAAGGATGCCGATGATTCGCATGACTTTAATGACCATGAGGCACTTCCAACCCCAAAAAATTCCGATGA
CCACCACGGCACAAGATGCGCAGGTCAGATAGCCGCAGTCAAGAACACCGTATGTGGTCTTGGTCTCGCTTACGA
ATCCAAGGTCGCTGGTGTTCGCATATTGTCTGGTCCCATAACGGACGTCGATGAAGCGACTGCGCTCAATTATGG
TTTCCAAAACGTATCTATCTTTAGCTGTAGTTGGGGCCCACCTGACAATGGTATGTCCATGGAAGGCCCAGGATA
CCTCATCAAAAAAGCTGTCGTCAACGGCATTAACCAGGGACGTGGCGGGAAGGGCTCCATTTTCGTCTTCGCCAG
TGGCAACGGCGCTGCTTCGGATGACCAATGCAATTTCGATGGATACACTAACAGCATATATTCCCTCACGGTTGC
TGCGATAGATTACAAGGGTTTACATCCATATTACTCGGAGGCTTGTGCCGCTAATATGGTTGTGGCATACAGTTC
TGGCAGTGGACAGCACATTGTGATTCATTTTTCCCACCTCGTCGATCAAGCTCTTACATCTTCTCTCTCAGGTCA
CTACTGACAAAGGGAAAGACTCCTGTGCAACCACCCATGGTGGTACGTCCGCAGCCGCTCCAAACGCTGCAGGCG
TTTTTGTTCTAGCCTTACAGGCTCGGTATGATCATATTCACTCTCGAGTAATTCAAGATGCTCATTAATAATCCA
GACCGGACCTTTCGTGGCGTGACATCCAACACCTTAGTGTAGAGACGGCAAGAATAGTCAATCCGGACGACAAAG
ATTGGGAAAAGACTGCAACTGGGAGGTTATACAGCTACAAATACGGGTACGGAGCAATTGACGCCTATGCCTTCG
TCAAAGCCGCCGAATCATGGACGCCAGTCAAATCACAATCCTGGATTTTTACCGAGACGGTCCAGCTCAATGGTG
GAAAGATGCCCACTCCAAGCAACTACACCGGCGGGCAGTTCATTGGACCCGGAGGCGTCGAAAACAAAATCACGG
TCACGCAGCAAATGCTAGAGGACAATAACTTCGAGAAACTTGAGCATGTCAATGTCAAAGTTTGGATACAACATA
CCCGACGAGGCCATGTGGAGGTGGAGATTGTTAGCCCGAATGGAATAAAAAGCGTGTTAGCCAGTAAACGTCAGT
TCGACAATGATGAGTCGGGCTTCCCAGGGTGGACCTTTATGAGCGTGAAACACTGGTCAGTCTCGCACCTCATTT
CTTCCGTGGCCTCGGGCTTATCCGTTATTGTAGGGGTGAAGATCCTGTTGGTGATTGGACTATTCGTGTTTCCGA
CCAAAATGAAGTCGAAAAAAATAATGGTTCCTTCCTTGGATGGAACATGATTTTCTGGGGTTCAGCTATCAACAC
TGACAAAACACGTCTATTTGAAGTCGAAGATGTCGAAGATGTCCTTCCACCGACCAAGGCGCCTATGCGTCCTAT
TTTACCTTCTGCCTCCATGACTACGCAGTACACCAAACCTACTTCACACCTCCCACCTGTTGATGGTGGTATGGA
AGATGAAATCTCGCAAGCCGGATCTTCATCAGCCAGTCCAGATGCAACTGCCACGGATGTTCCTACAGCGCCGGG
CTGGTTTGACGAAATGTCGAGATTGCTTTCAAACAGCAAATGGTTCTTTGGCGCTTTGTCACTAGTTATCCTCTT
TGGAGTAGGCGTCGGCGTATTCTTCTGCCTGCGTAGACGAAAACGAAGAGAACAAAGCTCCTATGGACGGCTCGC
GAATGACGATGTGTCGATGGCCGGATTGGGCAATCGCGGGGGTAACGGGCGTACGAGGGAATTATATGATGCATT
TGGCGAAGTTTCTGAAGATGAGGAAGATGCGGATGAGAATACAAAACTACGTGGAACTTACCCTCCTGGACGATC
CACCGATGGGCTTGGATTCCATTCTGGGTTCTTGGATGATGAGGAACCCTCGACCGCGGGAGGTGTGACGCCACG
TCGCGAGCATTATAAGGATGACAGTTCTGAGGATGGTGATGATACCAGTGACTCTGGAAAGGAGAAGAGTAAAGA
GGAAATCGAACTCATTAATACAGCTGGGCCTAATAGTCCAAATACTAGGACGAGTGGAGACGCCGGTAGCTGGGA
ACATGCCAGCAGCGCAACACCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail