Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|056270
Gene name
Locationscaffold_03a:918314..921103
Strand+
Gene length (bp)2789
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 5.7E-48 21 246
PF00106 adh_short short chain dehydrogenase 3.8E-44 15 215
PF00320 GATA GATA zinc finger 2.3E-14 521 555
PF08659 KR KR domain 2.4E-07 17 185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50166|ARDH_CANTR D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida tropicalis GN=ARD PE=1 SV=1 2 255 2.0E-49
sp|P43066|ARDH_CANAW D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida albicans (strain WO-1) GN=ARD1 PE=3 SV=1 2 248 2.0E-49
sp|P50167|ARDH_PICST D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARDH PE=2 SV=1 2 248 3.0E-48
sp|P87219|SOU1_CANAL Sorbose reductase SOU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU1 PE=1 SV=1 10 248 3.0E-41
sp|Q6CEE9|SDR_YARLI Probable NADP-dependent mannitol dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B16192g PE=1 SV=1 10 248 3.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50166|ARDH_CANTR D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida tropicalis GN=ARD PE=1 SV=1 2 255 2.0E-49
sp|P43066|ARDH_CANAW D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Candida albicans (strain WO-1) GN=ARD1 PE=3 SV=1 2 248 2.0E-49
sp|P50167|ARDH_PICST D-arabinitol 2-dehydrogenase [ribulose-forming] OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ARDH PE=2 SV=1 2 248 3.0E-48
sp|P87219|SOU1_CANAL Sorbose reductase SOU1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU1 PE=1 SV=1 10 248 3.0E-41
sp|Q6CEE9|SDR_YARLI Probable NADP-dependent mannitol dehydrogenase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0B16192g PE=1 SV=1 10 248 3.0E-40
sp|P87218|SOU2_CANAL Sorbose reductase homolog SOU2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOU2 PE=3 SV=2 7 255 3.0E-35
sp|Q8NK50|MTDH_HYPJE NADP-dependent mannitol dehydrogenase OS=Hypocrea jecorina GN=lxr1 PE=1 SV=1 1 247 6.0E-35
sp|Q9Y6Z9|SOU1_SCHPO Sorbose reductase sou1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sou1 PE=3 SV=1 10 248 2.0E-34
sp|G0RH19|LXR3_HYPJQ L-xylulose reductase OS=Hypocrea jecorina (strain QM6a) GN=lxr3 PE=1 SV=1 5 248 2.0E-33
sp|P0C0Y5|MTDH_DAVTA Probable NADP-dependent mannitol dehydrogenase OS=Davidiella tassiana PE=1 SV=1 7 248 2.0E-31
sp|O13908|YF3H_SCHPO Uncharacterized oxidoreductase C22A12.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22A12.17c PE=3 SV=1 7 255 9.0E-31
sp|O74470|YQC8_SCHPO Uncharacterized oxidoreductase C1739.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.08c PE=3 SV=1 1 248 1.0E-29
sp|O93868|MTDH_AGABI NADP-dependent mannitol dehydrogenase OS=Agaricus bisporus GN=mtdH PE=1 SV=3 8 242 3.0E-29
sp|P0C0Y4|MTDH_ALTAL Probable NADP-dependent mannitol dehydrogenase OS=Alternaria alternata PE=1 SV=2 10 248 6.0E-27
sp|Q8KWT4|BACC_BACIU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis GN=bacC PE=1 SV=1 10 268 5.0E-26
sp|P50199|GNO_GLUOX Gluconate 5-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=gno PE=1 SV=1 1 248 2.0E-25
sp|O00058|MTDH_UROFA Probable NADP-dependent mannitol dehydrogenase OS=Uromyces fabae GN=PIG8 PE=2 SV=1 9 242 5.0E-25
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 10 241 2.0E-24
sp|Q49117|Y182_METEA Uncharacterized oxidoreductase MexAM1_META1p0182 OS=Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / AM1) GN=MexAM1_META1p0182 PE=3 SV=2 12 251 2.0E-24
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 12 248 4.0E-24
sp|Q6NUE2|CBR4_XENLA Carbonyl reductase family member 4 OS=Xenopus laevis GN=cbr4 PE=2 SV=1 14 247 5.0E-24
sp|Q05528|KDUD_DICD3 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Dickeya dadantii (strain 3937) GN=kduD PE=1 SV=2 7 242 1.0E-23
sp|P37769|KDUD_ECOLI 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=kduD PE=1 SV=2 7 248 2.0E-23
sp|P46331|YXBG_BACSU Uncharacterized oxidoreductase YxbG OS=Bacillus subtilis (strain 168) GN=yxbG PE=3 SV=2 12 253 2.0E-23
sp|Q9WYG0|Y325_THEMA Uncharacterized oxidoreductase TM_0325 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0325 PE=3 SV=1 10 255 2.0E-23
sp|F1SWA0|ZERSY_ZINZE Zerumbone synthase OS=Zingiber zerumbet GN=ZSD1 PE=1 SV=1 12 268 2.0E-23
sp|A4IFA7|CBR4_BOVIN Carbonyl reductase family member 4 OS=Bos taurus GN=CBR4 PE=2 SV=1 14 247 3.0E-23
sp|Q93X67|FABG2_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 2, chloroplastic OS=Brassica napus GN=bkr2 PE=2 SV=1 12 255 5.0E-23
sp|Q93X62|FABG1_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 1, chloroplastic OS=Brassica napus GN=gbkr1 PE=1 SV=1 12 255 6.0E-23
sp|Q949M3|FABG3_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 3, chloroplastic OS=Brassica napus GN=bkr3 PE=2 SV=1 12 255 6.0E-23
sp|Q56840|HCDR_XANP2 2-(R)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecD PE=1 SV=3 14 266 2.0E-22
sp|P0A9P9|IDNO_ECOLI Gluconate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=idnO PE=3 SV=1 10 248 3.0E-22
sp|P0A9Q0|IDNO_ECOL6 Gluconate 5-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=idnO PE=3 SV=1 10 248 3.0E-22
sp|P71534|FABG_MYCS2 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabG PE=3 SV=2 8 251 3.0E-22
sp|P39483|DHG2_BACME Glucose 1-dehydrogenase 2 OS=Bacillus megaterium GN=gdhII PE=3 SV=1 12 274 4.0E-22
sp|P10528|DHGA_BACME Glucose 1-dehydrogenase A OS=Bacillus megaterium GN=gdhA PE=3 SV=1 12 274 5.0E-22
sp|P40288|DHG_BACME Glucose 1-dehydrogenase OS=Bacillus megaterium PE=1 SV=1 12 274 5.0E-22
sp|O67610|FABG_AQUAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aquifex aeolicus (strain VF5) GN=fabG PE=1 SV=1 12 247 6.0E-22
sp|Q8N4T8|CBR4_HUMAN Carbonyl reductase family member 4 OS=Homo sapiens GN=CBR4 PE=1 SV=3 14 247 6.0E-22
sp|P39640|BACC_BACSU Dihydroanticapsin 7-dehydrogenase OS=Bacillus subtilis (strain 168) GN=bacC PE=1 SV=2 10 268 6.0E-22
sp|Q68ER2|CBR4_XENTR Carbonyl reductase family member 4 OS=Xenopus tropicalis GN=cbr4 PE=2 SV=1 15 247 7.0E-22
sp|Q93X68|FABG5_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 5, chloroplastic (Fragment) OS=Brassica napus GN=bkr1 PE=2 SV=1 12 255 9.0E-22
sp|P39484|DHG3_BACME Glucose 1-dehydrogenase 3 OS=Bacillus megaterium GN=gdhIII PE=3 SV=1 12 274 1.0E-21
sp|P39482|DHG1_BACME Glucose 1-dehydrogenase 1 OS=Bacillus megaterium GN=gdhI PE=2 SV=1 12 274 1.0E-21
sp|O31680|YKVO_BACSU Uncharacterized oxidoreductase YkvO OS=Bacillus subtilis (strain 168) GN=ykvO PE=3 SV=1 12 267 2.0E-21
sp|A7DY56|TRN1_COCOF Tropinone reductase OS=Cochlearia officinalis GN=TR PE=1 SV=1 10 249 2.0E-21
sp|P73574|FABG1_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG1 PE=1 SV=1 11 255 2.0E-21
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 12 248 3.0E-21
sp|P07999|DHGB_BACME Glucose 1-dehydrogenase B OS=Bacillus megaterium GN=gdhB PE=1 SV=2 12 274 4.0E-21
sp|Q59787|DHSO_RHOSH Sorbitol dehydrogenase OS=Rhodobacter sphaeroides GN=polS PE=1 SV=1 12 242 5.0E-21
sp|P39485|DHG4_BACME Glucose 1-dehydrogenase 4 OS=Bacillus megaterium GN=gdhIV PE=1 SV=1 12 274 5.0E-21
sp|P73826|FABG2_SYNY3 3-oxoacyl-[acyl-carrier-protein] reductase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabG2 PE=1 SV=1 9 247 8.0E-21
sp|Q92506|DHB8_HUMAN Estradiol 17-beta-dehydrogenase 8 OS=Homo sapiens GN=HSD17B8 PE=1 SV=2 12 253 8.0E-21
sp|Q9URX0|YLX6_SCHPO Uncharacterized oxidoreductase C922.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC922.06 PE=3 SV=1 10 248 9.0E-21
sp|Q00791|STCU_EMENI Versicolorin reductase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcU PE=3 SV=2 9 248 1.0E-20
sp|Q56318|Y019_THEMA Uncharacterized oxidoreductase TM_0019 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0019 PE=3 SV=2 12 255 1.0E-20
sp|P12310|DHG_BACSU Glucose 1-dehydrogenase OS=Bacillus subtilis (strain 168) GN=gdh PE=2 SV=2 12 274 1.0E-20
sp|P94681|TSAC_COMTE 4-formylbenzenesulfonate dehydrogenase TsaC1/TsaC2 OS=Comamonas testosteroni GN=tsaC1 PE=1 SV=1 10 255 1.0E-20
sp|P0A2D1|UCPA_SALTY Oxidoreductase UcpA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ucpA PE=3 SV=1 12 255 2.0E-20
sp|P0A2D2|UCPA_SALTI Oxidoreductase UcpA OS=Salmonella typhi GN=ucpA PE=3 SV=1 12 255 2.0E-20
sp|H9BFQ0|TPRL1_ERYCB Tropinone reductase-like 1 OS=Erythroxylum coca PE=2 SV=1 8 231 2.0E-20
sp|Q5TJF5|DHB8_CANLF Estradiol 17-beta-dehydrogenase 8 OS=Canis lupus familiaris GN=HSD17B8 PE=3 SV=1 10 253 2.0E-20
sp|P19337|BAIA2_CLOSV Bile acid 7-dehydroxylase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA2 PE=1 SV=1 12 248 2.0E-20
sp|Q94KL7|SILD_FORIN Secoisolariciresinol dehydrogenase (Fragment) OS=Forsythia intermedia PE=1 SV=1 2 248 2.0E-20
sp|H9BFQ1|TPRL2_ERYCB Tropinone reductase-like 2 OS=Erythroxylum coca PE=2 SV=1 8 234 3.0E-20
sp|P66776|BUTA_STAAW Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MW2) GN=butA PE=3 SV=1 14 252 3.0E-20
sp|Q6GCZ8|BUTA_STAAS Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MSSA476) GN=butA PE=3 SV=1 14 252 3.0E-20
sp|Q6GKH9|BUTA_STAAR Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain MRSA252) GN=butA PE=3 SV=1 14 252 3.0E-20
sp|P99120|BUTA_STAAN Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain N315) GN=butA PE=1 SV=1 14 252 3.0E-20
sp|P66775|BUTA_STAAM Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=butA PE=3 SV=1 14 252 3.0E-20
sp|Q5HJP2|BUTA_STAAC Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus aureus (strain COL) GN=butA PE=3 SV=1 14 252 3.0E-20
sp|P50842|KDUD_BACSU 2-dehydro-3-deoxy-D-gluconate 5-dehydrogenase OS=Bacillus subtilis (strain 168) GN=kduD PE=2 SV=1 9 248 3.0E-20
sp|F4IKM1|TRNHB_ARATH Tropinone reductase homolog At2g29340 OS=Arabidopsis thaliana GN=At2g29340 PE=2 SV=1 10 249 3.0E-20
sp|Q949M2|FABG4_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase 4 (Fragment) OS=Brassica napus GN=bkr4 PE=2 SV=1 12 255 4.0E-20
sp|G5EGA6|DHRS4_CAEEL Dehydrogenase/reductase SDR family member 4 OS=Caenorhabditis elegans GN=dhrs-4 PE=1 SV=1 12 253 4.0E-20
sp|Q9ZW03|TRNH3_ARATH Tropinone reductase homolog At2g29150 OS=Arabidopsis thaliana GN=At2g29150 PE=1 SV=1 10 247 4.0E-20
sp|Q9ZW15|TRNH9_ARATH Tropinone reductase homolog At2g29320 OS=Arabidopsis thaliana GN=At2g29320 PE=2 SV=1 10 249 5.0E-20
sp|Q9ZW04|TRNH4_ARATH Tropinone reductase homolog At2g29170 OS=Arabidopsis thaliana GN=At2g29170 PE=3 SV=1 10 247 6.0E-20
sp|P80869|DHG2_BACSU Glucose 1-dehydrogenase 2 OS=Bacillus subtilis (strain 168) GN=ycdF PE=1 SV=2 12 269 6.0E-20
sp|P37440|UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) GN=ucpA PE=3 SV=3 12 255 7.0E-20
sp|Q42182|TRNH7_ARATH Tropinone reductase homolog At2g29300 OS=Arabidopsis thaliana GN=At2g29300 PE=2 SV=2 10 249 7.0E-20
sp|Q08632|SDR1_PICAB Short-chain type dehydrogenase/reductase OS=Picea abies PE=2 SV=1 7 248 8.0E-20
sp|Q91VT4|CBR4_MOUSE Carbonyl reductase family member 4 OS=Mus musculus GN=Cbr4 PE=1 SV=2 14 247 8.0E-20
sp|Q5KTS5|GRDH_DAUCA Glucose and ribitol dehydrogenase OS=Daucus carota GN=CAISE5 PE=2 SV=1 2 268 8.0E-20
sp|P55575|Y4MP_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4mP OS=Rhizobium sp. (strain NGR234) GN=NGR_a02430 PE=3 SV=1 12 241 1.0E-19
sp|P0C622|CMTB_PSEPU 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase OS=Pseudomonas putida GN=cmtB PE=3 SV=1 9 268 1.0E-19
sp|A5W4G5|CMTB_PSEP1 2,3-dihydroxy-2,3-dihydro-p-cumate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=cmtB PE=3 SV=1 9 268 1.0E-19
sp|Q8CPI3|FABG_STAES 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fabG PE=3 SV=1 14 248 1.0E-19
sp|Q5HPW0|FABG_STAEQ 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fabG PE=3 SV=1 14 248 1.0E-19
sp|P66782|Y1385_MYCBO Uncharacterized oxidoreductase Mb1385 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG2 PE=3 SV=1 12 241 1.0E-19
sp|P9WGR9|Y1350_MYCTU Uncharacterized oxidoreductase Rv1350 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG2 PE=1 SV=1 12 241 1.0E-19
sp|P9WGR8|Y1350_MYCTO Uncharacterized oxidoreductase MT1393 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG2 PE=3 SV=1 12 241 1.0E-19
sp|Q8XBJ4|UCPA_ECO57 Oxidoreductase UcpA OS=Escherichia coli O157:H7 GN=ucpA PE=3 SV=2 12 255 2.0E-19
sp|P07914|BAIA1_CLOSV Bile acid 7-dehydroxylase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiA1 PE=1 SV=3 12 248 2.0E-19
sp|Q9MA93|GRDH2_ARATH Glucose and ribitol dehydrogenase homolog 2 OS=Arabidopsis thaliana GN=At3g05260 PE=2 SV=1 8 255 2.0E-19
sp|Q6MGB5|DHB8_RAT Estradiol 17-beta-dehydrogenase 8 OS=Rattus norvegicus GN=Hsd17b8 PE=1 SV=1 12 253 3.0E-19
sp|P55336|FABG_VIBHA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio harveyi GN=fabG PE=3 SV=1 10 248 3.0E-19
sp|Q9L9F8|NOVJ_STRNV Short-chain reductase protein NovJ OS=Streptomyces niveus GN=novJ PE=1 SV=1 13 248 4.0E-19
sp|P50198|LINX_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linX PE=3 SV=1 12 248 5.0E-19
sp|Q9KQH7|FABG_VIBCH 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabG PE=1 SV=2 10 248 5.0E-19
sp|Q9ZW12|TRNH5_ARATH Tropinone reductase homolog At2g29260, chloroplastic OS=Arabidopsis thaliana GN=At2g29260 PE=2 SV=1 10 249 5.0E-19
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 11 249 5.0E-19
sp|Q8KWS9|BACC_BACAM Dihydroanticapsin 7-dehydrogenase OS=Bacillus amyloliquefaciens GN=bacC PE=1 SV=1 10 268 6.0E-19
sp|P9WGQ9|Y769_MYCTU Uncharacterized oxidoreductase Rv0769 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0769 PE=1 SV=1 12 255 7.0E-19
sp|P9WGQ8|Y769_MYCTO Uncharacterized oxidoreductase MT0793 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0793 PE=3 SV=1 12 255 7.0E-19
sp|P42317|YXJF_BACSU Uncharacterized oxidoreductase YxjF OS=Bacillus subtilis (strain 168) GN=yxjF PE=3 SV=2 12 215 7.0E-19
sp|Q9ZW16|TRNHA_ARATH Tropinone reductase homolog At2g29330 OS=Arabidopsis thaliana GN=TRI PE=1 SV=1 10 249 8.0E-19
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 12 248 8.0E-19
sp|Q2FVD5|Y2778_STAA8 Uncharacterized oxidoreductase SAOUHSC_02778 OS=Staphylococcus aureus (strain NCTC 8325) GN=SAOUHSC_02778 PE=3 SV=1 12 211 9.0E-19
sp|Q5HD73|Y2488_STAAC Uncharacterized oxidoreductase SACOL2488 OS=Staphylococcus aureus (strain COL) GN=SACOL2488 PE=3 SV=1 12 211 9.0E-19
sp|Q2FE21|Y2422_STAA3 Uncharacterized oxidoreductase SAUSA300_2422 OS=Staphylococcus aureus (strain USA300) GN=SAUSA300_2422 PE=3 SV=1 12 211 9.0E-19
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 15 248 1.0E-18
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 15 248 1.0E-18
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 15 248 1.0E-18
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 15 248 1.0E-18
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 15 248 1.0E-18
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 15 248 1.0E-18
sp|Q99RF5|Y2478_STAAM Uncharacterized oxidoreductase SAV2478 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2478 PE=3 SV=1 12 246 1.0E-18
sp|Q7A3L9|Y2266_STAAN Uncharacterized oxidoreductase SA2266 OS=Staphylococcus aureus (strain N315) GN=SA2266 PE=1 SV=1 12 246 1.0E-18
sp|Q9ZW14|TRNH8_ARATH Tropinone reductase homolog At2g29310 OS=Arabidopsis thaliana GN=At2g29310 PE=2 SV=1 10 249 1.0E-18
sp|Q6GDV6|Y2567_STAAR Uncharacterized oxidoreductase SAR2567 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2567 PE=3 SV=1 12 213 2.0E-18
sp|P33207|FABG_ARATH 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Arabidopsis thaliana GN=At1g24360 PE=1 SV=2 12 255 2.0E-18
sp|Q7TS56|CBR4_RAT Carbonyl reductase family member 4 OS=Rattus norvegicus GN=Cbr4 PE=2 SV=1 14 247 2.0E-18
sp|Q9LHT0|TRNHF_ARATH Tropinone reductase homolog At5g06060 OS=Arabidopsis thaliana GN=At5g06060 PE=2 SV=1 10 249 2.0E-18
sp|Q8NUV9|Y2403_STAAW Uncharacterized oxidoreductase MW2403 OS=Staphylococcus aureus (strain MW2) GN=MW2403 PE=3 SV=1 12 246 2.0E-18
sp|Q6G6J1|Y2370_STAAS Uncharacterized oxidoreductase SAS2370 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2370 PE=3 SV=1 12 246 2.0E-18
sp|Q9ZW18|SAG13_ARATH Senescence-associated protein 13 OS=Arabidopsis thaliana GN=SAG13 PE=1 SV=1 10 249 3.0E-18
sp|O70351|HCD2_RAT 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Rattus norvegicus GN=Hsd17b10 PE=1 SV=3 11 247 3.0E-18
sp|P9WGQ3|Y1714_MYCTU Uncharacterized oxidoreductase Rv1714 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1714 PE=3 SV=1 7 255 3.0E-18
sp|P9WGQ2|Y1714_MYCTO Uncharacterized oxidoreductase MT1753.1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1753.1 PE=3 SV=1 7 255 3.0E-18
sp|Q9ZW20|TRNHD_ARATH Tropinone reductase homolog At2g29370 OS=Arabidopsis thaliana GN=At2g29370 PE=3 SV=1 5 249 4.0E-18
sp|Q5FPE5|GMDH_GLUOX Glucose 1-dehydrogenase OS=Gluconobacter oxydans (strain 621H) GN=GOX2015 PE=1 SV=1 14 269 4.0E-18
sp|P9WGT3|FABG_MYCTU 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG1 PE=1 SV=1 14 251 4.0E-18
sp|P9WGT2|FABG_MYCTO 3-oxoacyl-[acyl-carrier-protein] reductase FabG1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG1 PE=3 SV=1 14 251 4.0E-18
sp|P0A5Y5|FABG_MYCBO 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG PE=3 SV=1 14 251 4.0E-18
sp|Q5HLD8|Y2049_STAEQ Uncharacterized oxidoreductase SERP2049 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=SERP2049 PE=3 SV=1 12 211 5.0E-18
sp|Q8CN40|Y2036_STAES Uncharacterized oxidoreductase SE_2036 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=SE_2036 PE=3 SV=1 12 211 5.0E-18
sp|Q4A054|Y0419_STAS1 Uncharacterized oxidoreductase SSP0419 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP0419 PE=3 SV=1 12 246 6.0E-18
sp|O08756|HCD2_MOUSE 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Mus musculus GN=Hsd17b10 PE=1 SV=4 11 247 7.0E-18
sp|Q53217|Y4VI_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 14 248 7.0E-18
sp|Q9ZW13|TRNH6_ARATH Tropinone reductase homolog At2g29290 OS=Arabidopsis thaliana GN=At2g29290 PE=2 SV=1 10 249 8.0E-18
sp|Q9BTZ2|DHRS4_HUMAN Dehydrogenase/reductase SDR family member 4 OS=Homo sapiens GN=DHRS4 PE=1 SV=3 12 247 9.0E-18
sp|Q9C826|ABA2_ARATH Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1 12 210 1.0E-17
sp|Q68VY7|FABG_RICTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=fabG PE=3 SV=1 15 248 1.0E-17
sp|O49332|TRNHE_ARATH Tropinone reductase homolog At2g30670 OS=Arabidopsis thaliana GN=At2g30670 PE=3 SV=1 10 249 2.0E-17
sp|O80714|SDR3C_ARATH Short-chain dehydrogenase reductase 3c OS=Arabidopsis thaliana GN=SDR3c PE=3 SV=1 7 227 2.0E-17
sp|Q8P3K4|FUCDH_XANCP 2-keto-3-deoxy-L-fuconate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=XCC4067 PE=1 SV=1 6 248 2.0E-17
sp|P50162|TRN1_DATST Tropinone reductase 1 OS=Datura stramonium GN=TR1 PE=1 SV=1 10 247 2.0E-17
sp|Q5RCF8|DHRS4_PONAB Dehydrogenase/reductase SDR family member 4 OS=Pongo abelii GN=DHRS4 PE=2 SV=3 12 253 2.0E-17
sp|Q9SCU0|SDR2A_ARATH Short-chain dehydrogenase reductase 2a OS=Arabidopsis thaliana GN=SDR2a PE=3 SV=1 6 212 2.0E-17
sp|P50941|FABG_RICPR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia prowazekii (strain Madrid E) GN=fabG PE=1 SV=2 10 265 3.0E-17
sp|F4J300|SDR5_ARATH Short-chain dehydrogenase reductase 5 OS=Arabidopsis thaliana GN=SDR5 PE=3 SV=1 12 227 3.0E-17
sp|P0AET8|HDHA_ECOLI 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli (strain K12) GN=hdhA PE=1 SV=1 9 247 3.0E-17
sp|P0AET9|HDHA_ECO57 7-alpha-hydroxysteroid dehydrogenase OS=Escherichia coli O157:H7 GN=hdhA PE=3 SV=1 9 247 3.0E-17
sp|Q9ZW19|TRNHC_ARATH Tropinone reductase homolog At2g29360 OS=Arabidopsis thaliana GN=SDR PE=1 SV=1 5 249 3.0E-17
sp|Q9BY49|PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens GN=PECR PE=1 SV=2 12 247 3.0E-17
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 12 248 3.0E-17
sp|Q6P0H7|CBR4_DANRE Carbonyl reductase family member 4 OS=Danio rerio GN=cbr4 PE=2 SV=1 14 247 4.0E-17
sp|Q89AG9|FABG_BUCBP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabG PE=3 SV=1 15 265 4.0E-17
sp|P87025|THR1_COLOR Trihydroxynaphthalene reductase OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=THR1 PE=3 SV=4 4 251 4.0E-17
sp|P0A169|NAHB_PSEPU 1,2-dihydroxy-1,2-dihydronaphthalene dehydrogenase OS=Pseudomonas putida GN=nahB PE=3 SV=1 15 240 4.0E-17
sp|P50161|AFLM_ASPPA Versicolorin reductase 1 OS=Aspergillus parasiticus GN=ver1 PE=3 SV=2 12 253 5.0E-17
sp|O02691|HCD2_BOVIN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Bos taurus GN=HSD17B10 PE=1 SV=3 11 241 5.0E-17
sp|Q8WNV7|DHRS4_PIG Dehydrogenase/reductase SDR family member 4 OS=Sus scrofa GN=DHRS4 PE=1 SV=2 12 267 5.0E-17
sp|Q8SPU8|DHRS4_BOVIN Dehydrogenase/reductase SDR family member 4 OS=Bos taurus GN=DHRS4 PE=2 SV=2 12 253 6.0E-17
sp|Q9LBG2|LVR_LEIAQ Levodione reductase OS=Leifsonia aquatica GN=lvr PE=1 SV=1 8 255 7.0E-17
sp|P0DKI3|TRNH1_ARATH Tropinone reductase homolog At1g07440 OS=Arabidopsis thaliana GN=At1g07440 PE=1 SV=1 10 249 7.0E-17
sp|P55541|Y4LA_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4lA OS=Rhizobium sp. (strain NGR234) GN=NGR_a02730 PE=3 SV=1 12 255 7.0E-17
sp|Q12634|T4HR_MAGO7 Tetrahydroxynaphthalene reductase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_02252 PE=1 SV=2 9 251 7.0E-17
sp|O07399|FABG_MYCAV 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Mycobacterium avium GN=fabG PE=3 SV=1 8 251 7.0E-17
sp|P50171|DHB8_MOUSE Estradiol 17-beta-dehydrogenase 8 OS=Mus musculus GN=Hsd17b8 PE=1 SV=2 12 253 9.0E-17
sp|P0A170|NAHB_PSEU8 1,2-dihydroxy-1,2-dihydronaphthalene dehydrogenase OS=Pseudomonas sp. (strain C18) GN=doxE PE=3 SV=1 15 240 1.0E-16
sp|P50200|HDHA_CLOSO NADP-dependent 7-alpha-hydroxysteroid dehydrogenase OS=Clostridium sordellii PE=1 SV=1 12 246 1.0E-16
sp|Q4L8Y1|Y0585_STAHJ Uncharacterized oxidoreductase SH0585 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0585 PE=3 SV=1 12 246 1.0E-16
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 12 248 1.0E-16
sp|Q45219|Y2146_BRADU Probable short-chain type dehydrogenase/reductase blr2146 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=blr2146 PE=3 SV=2 12 255 2.0E-16
sp|P19992|HSD_STREX 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Streptomyces exfoliatus PE=1 SV=1 12 255 2.0E-16
sp|P71079|FABL_BACSU Enoyl-[acyl-carrier-protein] reductase [NADPH] FabL OS=Bacillus subtilis (strain 168) GN=fabL PE=1 SV=1 13 247 2.0E-16
sp|Q75KH3|GRDH_ORYSJ Glucose and ribitol dehydrogenase homolog OS=Oryza sativa subsp. japonica GN=Os05g0140800 PE=2 SV=2 8 265 2.0E-16
sp|Q94KL8|SILD_PODPE Secoisolariciresinol dehydrogenase (Fragment) OS=Podophyllum peltatum PE=1 SV=1 32 255 2.0E-16
sp|P15428|PGDH_HUMAN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Homo sapiens GN=HPGD PE=1 SV=1 12 225 3.0E-16
sp|P43713|FABG_HAEIN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabG PE=3 SV=1 12 265 3.0E-16
sp|Q8MJY8|PGDH_MACFA 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Macaca fascicularis GN=HPGD PE=2 SV=1 12 225 3.0E-16
sp|Q9FZ42|GRDH1_ARATH Glucose and ribitol dehydrogenase homolog 1 OS=Arabidopsis thaliana GN=At1g54870 PE=2 SV=1 8 241 4.0E-16
sp|Q1RKB7|FABG_RICBR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia bellii (strain RML369-C) GN=fabG PE=3 SV=1 99 248 4.0E-16
sp|Q9MYP6|DHB14_BOVIN 17-beta-hydroxysteroid dehydrogenase 14 OS=Bos taurus GN=HSD17B14 PE=2 SV=1 14 248 4.0E-16
sp|P76633|YGCW_ECOLI Uncharacterized oxidoreductase YgcW OS=Escherichia coli (strain K12) GN=ygcW PE=3 SV=2 6 248 4.0E-16
sp|Q99714|HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens GN=HSD17B10 PE=1 SV=3 11 241 5.0E-16
sp|P05707|SRLD_ECOLI Sorbitol-6-phosphate 2-dehydrogenase OS=Escherichia coli (strain K12) GN=srlD PE=1 SV=2 14 207 5.0E-16
sp|P50163|TRN2_DATST Tropinone reductase 2 OS=Datura stramonium GN=TR2 PE=1 SV=1 10 247 5.0E-16
sp|P0A2C9|FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fabG PE=1 SV=1 10 248 6.0E-16
sp|P0A2D0|FABG_SALTI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhi GN=fabG PE=3 SV=1 10 248 6.0E-16
sp|Q5RCH8|PECR_PONAB Peroxisomal trans-2-enoyl-CoA reductase OS=Pongo abelii GN=PECR PE=2 SV=1 12 247 7.0E-16
sp|O34896|UXUB_BACSU Uncharacterized oxidoreductase UxuB OS=Bacillus subtilis (strain 168) GN=uxuB PE=2 SV=1 11 248 7.0E-16
sp|Q4UK62|FABG_RICFE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=fabG PE=3 SV=1 99 255 7.0E-16
sp|P45375|PHBB_ALLVD Acetoacetyl-CoA reductase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbB PE=3 SV=2 15 255 8.0E-16
sp|Q8K9J5|FABG_BUCAP 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabG PE=3 SV=1 12 248 1.0E-15
sp|P27582|FABG6_BRANA 3-oxoacyl-[acyl-carrier-protein] reductase (Fragments) OS=Brassica napus PE=1 SV=3 81 255 1.0E-15
sp|Q3T0C2|PGDH_BOVIN 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Bos taurus GN=HPGD PE=2 SV=1 12 234 1.0E-15
sp|P15047|ENTA_ECOLI 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Escherichia coli (strain K12) GN=entA PE=1 SV=1 12 248 1.0E-15
sp|P16544|ACT3_STRCO Putative ketoacyl reductase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actIII PE=1 SV=1 13 247 2.0E-15
sp|F4J2Z7|SDR4_ARATH Short-chain dehydrogenase reductase 4 OS=Arabidopsis thaliana GN=SDR4 PE=2 SV=1 12 227 2.0E-15
sp|Q9M1K9|ATA1_ARATH Short-chain dehydrogenase reductase ATA1 OS=Arabidopsis thaliana GN=TA1 PE=2 SV=1 12 255 2.0E-15
sp|Q8VCC1|PGDH_MOUSE 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Mus musculus GN=Hpgd PE=1 SV=1 12 225 2.0E-15
sp|Q9WVK3|PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus GN=Pecr PE=2 SV=1 12 241 2.0E-15
sp|Q9GKX2|DHRS4_RABIT Dehydrogenase/reductase SDR family member 4 (Fragment) OS=Oryctolagus cuniculus GN=DHRS4 PE=1 SV=1 12 253 3.0E-15
sp|H9BFQ2|TPRL3_ERYCB Tropinone reductase-like 3 OS=Erythroxylum coca PE=2 SV=1 12 251 3.0E-15
sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 7 203 3.0E-15
sp|P70684|PGDH_CAVPO 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Cavia porcellus GN=HPGD PE=2 SV=1 12 256 4.0E-15
sp|Q937L4|CPNA_COMTE Cyclopentanol dehydrogenase OS=Comamonas testosteroni GN=cpnA PE=3 SV=1 12 257 4.0E-15
sp|Q8GAV9|CPNA_COMS9 Cyclopentanol dehydrogenase OS=Comamonas sp. (strain NCIMB 9872) GN=cpnA PE=1 SV=1 12 257 4.0E-15
sp|Q9NUI1|DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase OS=Homo sapiens GN=DECR2 PE=1 SV=1 12 248 4.0E-15
sp|Q9BPX1|DHB14_HUMAN 17-beta-hydroxysteroid dehydrogenase 14 OS=Homo sapiens GN=HSD17B14 PE=1 SV=1 32 248 6.0E-15
sp|P78714|WC2_NEUCR White collar 2 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-2 PE=1 SV=1 303 430 6.0E-15
sp|P9WGT1|HSD_MYCTU 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fabG3 PE=1 SV=1 9 248 9.0E-15
sp|P69166|HSD_MYCBO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fabG3 PE=3 SV=1 9 248 9.0E-15
sp|P0AEK3|FABG_SHIFL 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Shigella flexneri GN=fabG PE=3 SV=1 10 255 9.0E-15
sp|P0AEK2|FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) GN=fabG PE=1 SV=1 10 255 9.0E-15
sp|Q5RBV3|DECR2_PONAB Peroxisomal 2,4-dienoyl-CoA reductase OS=Pongo abelii GN=DECR2 PE=2 SV=1 12 248 9.0E-15
sp|Q92GE0|FABG_RICCN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=fabG PE=3 SV=2 99 255 1.0E-14
sp|P33368|YOHF_ECOLI Uncharacterized oxidoreductase YohF OS=Escherichia coli (strain K12) GN=yohF PE=3 SV=2 15 247 1.0E-14
sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein OS=Fusarium solani subsp. pisi PE=2 SV=1 500 556 2.0E-14
sp|P9WGT0|HSD_MYCTO 3-alpha-(or 20-beta)-hydroxysteroid dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fabG3 PE=3 SV=1 9 248 2.0E-14
sp|Q9HK58|RHAD_THEAC L-rhamnose 1-dehydrogenase (NADP(+)) OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rhaD PE=1 SV=2 10 241 2.0E-14
sp|Q8RX32|TRNH2_ARATH Tropinone reductase homolog At1g07450 OS=Arabidopsis thaliana GN=At1g07450 PE=2 SV=1 10 249 3.0E-14
sp|Q48436|BUDC_KLEPN Diacetyl reductase [(S)-acetoin forming] OS=Klebsiella pneumoniae GN=budC PE=1 SV=2 15 252 3.0E-14
sp|P50164|TRN2_HYONI Tropinone reductase 2 OS=Hyoscyamus niger GN=TR2 PE=2 SV=1 10 247 3.0E-14
sp|P41177|DHKR_STRCM Monensin polyketide synthase putative ketoacyl reductase OS=Streptomyces cinnamonensis PE=3 SV=1 14 254 4.0E-14
sp|Q5P5I4|PED_AROAE (S)-1-Phenylethanol dehydrogenase OS=Aromatoleum aromaticum (strain EbN1) GN=ped PE=1 SV=1 12 255 4.0E-14
sp|P50197|LINC_SPHPI 2,5-dichloro-2,5-cyclohexadiene-1,4-diol dehydrogenase OS=Sphingomonas paucimobilis GN=linC PE=2 SV=1 12 255 5.0E-14
sp|P9WGQ5|Y927C_MYCTU Uncharacterized oxidoreductase Rv0927c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0927c PE=1 SV=1 7 248 6.0E-14
sp|P9WGQ4|Y927C_MYCTO Uncharacterized oxidoreductase MT0954 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0954 PE=3 SV=1 7 248 6.0E-14
sp|Q9CQ62|DECR_MOUSE 2,4-dienoyl-CoA reductase, mitochondrial OS=Mus musculus GN=Decr1 PE=1 SV=1 7 241 7.0E-14
sp|Q94K41|SDR3B_ARATH Short-chain dehydrogenase reductase 3b OS=Arabidopsis thaliana GN=SDR3b PE=2 SV=1 12 211 9.0E-14
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 10 255 9.0E-14
sp|P78714|WC2_NEUCR White collar 2 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-2 PE=1 SV=1 503 551 1.0E-13
sp|P39333|BDCA_ECOLI Cyclic-di-GMP-binding biofilm dispersal mediator protein OS=Escherichia coli (strain K12) GN=bdcA PE=1 SV=2 11 255 1.0E-13
sp|Q99LB2|DHRS4_MOUSE Dehydrogenase/reductase SDR family member 4 OS=Mus musculus GN=Dhrs4 PE=1 SV=3 12 263 1.0E-13
sp|P50165|TRNH_DATST Tropinone reductase homolog OS=Datura stramonium PE=2 SV=1 10 249 1.0E-13
sp|Q64591|DECR_RAT 2,4-dienoyl-CoA reductase, mitochondrial OS=Rattus norvegicus GN=Decr1 PE=1 SV=2 7 241 2.0E-13
sp|A3LZU7|RM1DH_PICST L-rhamnose-1-dehydrogenase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DHG2 PE=1 SV=2 12 248 2.0E-13
sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 12 215 2.0E-13
sp|Q56632|VIBA_VIBCH Vibriobactin-specific 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibA PE=3 SV=1 7 247 2.0E-13
sp|P00335|RIDH_ENTAE Ribitol 2-dehydrogenase OS=Enterobacter aerogenes GN=rbtD PE=1 SV=1 11 212 2.0E-13
sp|Q9Y140|DHRS7_DROME Dehydrogenase/reductase SDR family protein 7-like OS=Drosophila melanogaster GN=CG7601 PE=2 SV=1 12 244 2.0E-13
sp|Q8VID1|DHRS4_RAT Dehydrogenase/reductase SDR family member 4 OS=Rattus norvegicus GN=Dhrs4 PE=2 SV=2 12 263 2.0E-13
sp|Q00858|CGPB_FUSSO Cutinase gene palindrome-binding protein OS=Fusarium solani subsp. pisi PE=2 SV=1 294 427 3.0E-13
sp|Q9X6U2|BDHA_CUPNH D-beta-hydroxybutyrate dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=hbdH1 PE=3 SV=2 12 248 3.0E-13
sp|O07575|YHDF_BACSU Uncharacterized oxidoreductase YhdF OS=Bacillus subtilis (strain 168) GN=yhdF PE=3 SV=1 9 268 3.0E-13
sp|P44481|Y048_HAEIN Uncharacterized oxidoreductase HI_0048 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0048 PE=1 SV=1 11 255 3.0E-13
sp|O86034|BDHA_RHIME D-beta-hydroxybutyrate dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=bdhA PE=1 SV=1 14 210 4.0E-13
sp|P40747|YUXG_BACSU Uncharacterized oxidoreductase YuxG OS=Bacillus subtilis (strain 168) GN=yuxG PE=3 SV=2 8 227 4.0E-13
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 8 231 5.0E-13
sp|P50205|PHBB_RHIME Acetoacetyl-CoA reductase OS=Rhizobium meliloti (strain 1021) GN=phbB PE=3 SV=1 14 255 8.0E-13
sp|Q9VXJ0|DHB4_DROME Peroxisomal multifunctional enzyme type 2 OS=Drosophila melanogaster GN=Mfe2 PE=1 SV=1 13 203 8.0E-13
sp|Q53217|Y4VI_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4vI OS=Rhizobium sp. (strain NGR234) GN=NGR_a01150 PE=3 SV=2 8 269 9.0E-13
sp|Q23116|YWC4_CAEEL Uncharacterized oxidoreductase W01C9.4 OS=Caenorhabditis elegans GN=W01C9.4 PE=3 SV=1 11 288 9.0E-13
sp|Q9ZNN8|BUDC_CORGT L-2,3-butanediol dehydrogenase OS=Corynebacterium glutamicum GN=budC PE=1 SV=1 14 248 1.0E-12
sp|P9WGS5|Y2750_MYCTU Uncharacterized oxidoreductase Rv2750 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2750 PE=1 SV=1 12 248 1.0E-12
sp|P9WGS4|Y2750_MYCTO Uncharacterized oxidoreductase MT2820 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2820 PE=3 SV=1 12 248 1.0E-12
sp|Q56841|HCDS_XANP2 2-(S)-hydroxypropyl-CoM dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecE PE=1 SV=1 12 241 1.0E-12
sp|P50203|PHAB_ACISR Acetoacetyl-CoA reductase OS=Acinetobacter sp. (strain RA3849) GN=phaB PE=3 SV=1 13 234 1.0E-12
sp|Q9XT00|DHB8_PIG Estradiol 17-beta-dehydrogenase 8 OS=Sus scrofa GN=HSD17B8 PE=3 SV=2 12 253 1.0E-12
sp|Q75JZ0|GTAH_DICDI GATA zinc finger domain-containing protein 8 OS=Dictyostelium discoideum GN=gtaH PE=3 SV=1 491 556 1.0E-12
sp|P52037|YGFF_ECOLI Uncharacterized oxidoreductase YgfF OS=Escherichia coli (strain K12) GN=ygfF PE=3 SV=2 16 255 1.0E-12
sp|Q22230|DECR_CAEEL Probable 2,4-dienoyl-CoA reductase 3 OS=Caenorhabditis elegans GN=decr-1.3 PE=3 SV=1 11 288 1.0E-12
sp|O18404|HCD2_DROME 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Drosophila melanogaster GN=scu PE=1 SV=1 12 247 1.0E-12
sp|Q9Z2M4|DECR2_RAT Peroxisomal 2,4-dienoyl-CoA reductase OS=Rattus norvegicus GN=Decr2 PE=2 SV=1 12 248 2.0E-12
sp|O08699|PGDH_RAT 15-hydroxyprostaglandin dehydrogenase [NAD(+)] OS=Rattus norvegicus GN=Hpgd PE=2 SV=2 12 229 2.0E-12
sp|Q13268|DHRS2_HUMAN Dehydrogenase/reductase SDR family member 2, mitochondrial OS=Homo sapiens GN=DHRS2 PE=1 SV=4 12 263 2.0E-12
sp|Q9WV68|DECR2_MOUSE Peroxisomal 2,4-dienoyl-CoA reductase OS=Mus musculus GN=Decr2 PE=1 SV=1 12 248 3.0E-12
sp|P08074|CBR2_MOUSE Carbonyl reductase [NADPH] 2 OS=Mus musculus GN=Cbr2 PE=1 SV=1 17 247 3.0E-12
sp|Q7Q732|DHRS7_ANOGA Dehydrogenase/reductase SDR family protein 7-like OS=Anopheles gambiae GN=AGAP005532 PE=3 SV=3 12 244 4.0E-12
sp|Q21929|DCXR_CAEEL L-xylulose reductase OS=Caenorhabditis elegans GN=dhs-21 PE=1 SV=2 9 255 5.0E-12
sp|Q9RPT1|RHLG_PSEAE Rhamnolipids biosynthesis 3-oxoacyl-[acyl-carrier-protein] reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlG PE=1 SV=1 8 241 5.0E-12
sp|Q8CQD2|BUTA_STAES Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 12228) GN=butA PE=3 SV=1 14 270 5.0E-12
sp|P22414|FOX2_CANTR Peroxisomal hydratase-dehydrogenase-epimerase OS=Candida tropicalis PE=1 SV=2 12 296 6.0E-12
sp|Q5HKG6|BUTA_STAEQ Diacetyl reductase [(S)-acetoin forming] OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=butA PE=3 SV=1 14 270 6.0E-12
sp|P37079|SORD_KLEPN Sorbitol-6-phosphate 2-dehydrogenase OS=Klebsiella pneumoniae GN=sorD PE=3 SV=1 10 206 6.0E-12
sp|P0DKC6|HSD1B_ARATH 11-beta-hydroxysteroid dehydrogenase 1B OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 6 218 9.0E-12
sp|P0DKC5|HSD1A_ARATH 11-beta-hydroxysteroid dehydrogenase 1A OS=Arabidopsis thaliana GN=HSD1 PE=1 SV=1 6 218 9.0E-12
sp|Q29529|CBR2_PIG Carbonyl reductase [NADPH] 2 OS=Sus scrofa GN=CBR2 PE=1 SV=1 17 265 9.0E-12
sp|Q5C9I9|ISPD_MENPI (-)-isopiperitenol/(-)-carveol dehydrogenase, mitochondrial OS=Mentha piperita PE=1 SV=1 12 255 1.0E-11
sp|Q6NV34|DECR2_DANRE Peroxisomal 2,4-dienoyl-CoA reductase OS=Danio rerio GN=decr2 PE=2 SV=1 12 248 1.0E-11
sp|P0AG84|YGHA_ECOLI Uncharacterized oxidoreductase YghA OS=Escherichia coli (strain K12) GN=yghA PE=1 SV=1 9 248 1.0E-11
sp|P0AG85|YGHA_ECO57 Uncharacterized oxidoreductase YghA OS=Escherichia coli O157:H7 GN=yghA PE=3 SV=1 9 248 1.0E-11
sp|P80873|GS39_BACSU General stress protein 39 OS=Bacillus subtilis (strain 168) GN=ydaD PE=1 SV=3 12 268 2.0E-11
sp|P50160|TS2_MAIZE Sex determination protein tasselseed-2 OS=Zea mays GN=TS2 PE=2 SV=1 4 217 2.0E-11
sp|P51660|DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3 12 215 2.0E-11
sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 11 203 3.0E-11
sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 12 215 3.0E-11
sp|P40397|YHXC_BACSU Uncharacterized oxidoreductase YhxC OS=Bacillus subtilis (strain 168) GN=yhxC PE=3 SV=2 12 268 3.0E-11
sp|Q3ZBV9|DHR11_BOVIN Dehydrogenase/reductase SDR family member 11 OS=Bos taurus GN=DHRS11 PE=2 SV=1 14 247 3.0E-11
sp|P13859|TODD_PSEP1 Cis-toluene dihydrodiol dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todD PE=1 SV=1 12 252 3.0E-11
sp|P08088|BNZE_PSEPU Cis-1,2-dihydrobenzene-1,2-diol dehydrogenase OS=Pseudomonas putida GN=bnzE PE=3 SV=2 12 252 3.0E-11
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 18 255 4.0E-11
sp|P14697|PHBB_CUPNH Acetoacetyl-CoA reductase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=phbB PE=1 SV=1 12 248 4.0E-11
sp|Q45983|PTMA_CAMCO Post-translational flagellin modification protein A OS=Campylobacter coli GN=ptmA PE=3 SV=1 12 255 4.0E-11
sp|P32573|SPS19_YEAST Peroxisomal 2,4-dienoyl-CoA reductase SPS19 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS19 PE=1 SV=4 12 247 5.0E-11
sp|P22441|DHMA_FLAS1 N-acylmannosamine 1-dehydrogenase OS=Flavobacterium sp. (strain 141-8) PE=1 SV=3 12 248 5.0E-11
sp|Q9S9W2|SDRA_ARATH Short-chain dehydrogenase/reductase SDRA OS=Arabidopsis thaliana GN=SDRA PE=1 SV=1 12 253 5.0E-11
sp|Q93ZA0|NYC1_ARATH Probable chlorophyll(ide) b reductase NYC1, chloroplastic OS=Arabidopsis thaliana GN=NYC1 PE=1 SV=1 18 224 5.0E-11
sp|Q9JIF5|PECR_CAVPO Peroxisomal trans-2-enoyl-CoA reductase OS=Cavia porcellus GN=PECR PE=1 SV=1 42 247 6.0E-11
sp|Q96LJ7|DHRS1_HUMAN Dehydrogenase/reductase SDR family member 1 OS=Homo sapiens GN=DHRS1 PE=1 SV=1 12 222 6.0E-11
sp|O52384|NAGB_RALSP 1,2-dihydroxy-1,2-dihydronaphthalene dehydrogenase OS=Ralstonia sp. GN=nagB PE=3 SV=2 15 240 6.0E-11
sp|Q04520|BUDC_RAOTE Diacetyl reductase [(S)-acetoin forming] OS=Raoultella terrigena GN=budC PE=3 SV=1 15 210 7.0E-11
sp|Q4WZ66|CHADH_ASPFU Chanoclavine-I dehydrogenase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaDH PE=3 SV=1 11 268 8.0E-11
sp|D3J0Z1|CHADH_ASPFM Chanoclavine-I dehydrogenase OS=Neosartorya fumigata GN=fgaDH PE=1 SV=1 11 268 8.0E-11
sp|Q99L04|DHRS1_MOUSE Dehydrogenase/reductase SDR family member 1 OS=Mus musculus GN=Dhrs1 PE=1 SV=1 12 238 9.0E-11
sp|Q92RN6|GALD_RHIME Probable galactose dehydrogenase GalD OS=Rhizobium meliloti (strain 1021) GN=galD PE=3 SV=1 6 265 1.0E-10
sp|P9WGS7|Y0687_MYCTU Uncharacterized NAD-dependent oxidoreductase Rv0687 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0687 PE=1 SV=1 11 203 1.0E-10
sp|P9WGS6|Y0687_MYCTO Uncharacterized NAD-dependent oxidoreductase MT0715 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0715 PE=3 SV=1 11 203 1.0E-10
sp|P16542|DHK1_STRVN Granaticin polyketide synthase putative ketoacyl reductase 1 OS=Streptomyces violaceoruber GN=gra-orf5 PE=3 SV=1 16 247 1.0E-10
sp|Q02207|FOX2_YEAST Peroxisomal hydratase-dehydrogenase-epimerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FOX2 PE=2 SV=1 9 215 1.0E-10
sp|Q71R50|DHR11_CHICK Dehydrogenase/reductase SDR family member 11 OS=Gallus gallus GN=DHRS11 PE=2 SV=1 15 247 1.0E-10
sp|O34717|FADH_BACSU Probable 2,4-dienoyl-CoA reductase OS=Bacillus subtilis (strain 168) GN=fadH PE=2 SV=1 12 255 1.0E-10
sp|P72220|BPHB_PSEPU Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas putida GN=bphB PE=3 SV=1 12 253 2.0E-10
sp|Q49WS9|Y1627_STAS1 Uncharacterized oxidoreductase SSP1627 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=SSP1627 PE=3 SV=1 11 246 2.0E-10
sp|Q8JZV9|BDH2_MOUSE 3-hydroxybutyrate dehydrogenase type 2 OS=Mus musculus GN=Bdh2 PE=1 SV=1 12 253 2.0E-10
sp|Q9NKW1|MFEA_DICDI Peroxisomal multifunctional enzyme A OS=Dictyostelium discoideum GN=mfeA PE=2 SV=1 9 215 2.0E-10
sp|Q54TM6|GTAI_DICDI GATA zinc finger domain-containing protein 9 OS=Dictyostelium discoideum GN=gtaI PE=3 SV=1 505 556 2.0E-10
sp|D2WKD9|SDR1_AEDAE Farnesol dehydrogenase OS=Aedes aegypti GN=SDR-1 PE=1 SV=2 15 247 2.0E-10
sp|Q0VFE7|DRS7B_XENTR Dehydrogenase/reductase SDR family member 7B OS=Xenopus tropicalis GN=dhrs7b PE=2 SV=1 12 241 2.0E-10
sp|P50204|PHAB_PARDE Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 15 251 3.0E-10
sp|P16543|DHK2_STRVN Granaticin polyketide synthase putative ketoacyl reductase 2 OS=Streptomyces violaceoruber GN=gra-orf6 PE=3 SV=1 13 244 4.0E-10
sp|P55435|Y4EL_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eL OS=Rhizobium sp. (strain NGR234) GN=NGR_a03830 PE=3 SV=1 19 241 4.0E-10
sp|P19871|3BHD_COMTE 3-beta-hydroxysteroid dehydrogenase OS=Comamonas testosteroni PE=1 SV=5 12 215 4.0E-10
sp|B0G188|GTAP_DICDI GATA zinc finger domain-containing protein 16 OS=Dictyostelium discoideum GN=gtaP PE=3 SV=1 505 555 4.0E-10
sp|P06234|NODG_RHIME Nodulation protein G OS=Rhizobium meliloti (strain 1021) GN=nodG PE=3 SV=1 10 268 4.0E-10
sp|Q82IY9|PTLF_STRAW 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ptlF PE=1 SV=1 12 228 5.0E-10
sp|G5DGA8|IDLDH_IPSPI Ipsdienol dehydrogenase OS=Ips pini GN=IDOLDH PE=1 SV=1 12 247 7.0E-10
sp|Q10216|YAY8_SCHPO Uncharacterized oxidoreductase C4H3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4H3.08 PE=3 SV=1 9 268 7.0E-10
sp|Q3KPT7|BDH2_XENLA 3-hydroxybutyrate dehydrogenase type 2 OS=Xenopus laevis GN=bdh2 PE=2 SV=1 12 253 7.0E-10
sp|Q54KX0|GTAN_DICDI GATA zinc finger domain-containing protein 14 OS=Dictyostelium discoideum GN=gtaN PE=3 SV=1 508 577 9.0E-10
sp|Q566S6|DRS7B_DANRE Dehydrogenase/reductase SDR family member 7B OS=Danio rerio GN=dhrs7b PE=2 SV=1 11 241 9.0E-10
sp|Q9RA05|LIMC_RHOER (-)-trans-carveol dehydrogenase OS=Rhodococcus erythropolis GN=limC PE=1 SV=1 12 203 9.0E-10
sp|Q9LTV6|DECR2_ARATH Peroxisomal 2,4-dienoyl-CoA reductase OS=Arabidopsis thaliana GN=At3g12800 PE=2 SV=1 12 248 1.0E-09
sp|P39071|DHBA_BACSU 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase OS=Bacillus subtilis (strain 168) GN=dhbA PE=1 SV=3 12 250 1.0E-09
sp|Q9GME3|DHB8_CALJA Estradiol 17-beta-dehydrogenase 8 (Fragment) OS=Callithrix jacchus GN=HSD17B8 PE=2 SV=1 129 253 1.0E-09
sp|P23238|PHBB_ZOORA Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 14 255 1.0E-09
sp|P55434|Y4EK_RHISN Uncharacterized short-chain type dehydrogenase/reductase y4eK OS=Rhizobium sp. (strain NGR234) GN=NGR_a03840 PE=3 SV=1 15 227 1.0E-09
sp|Q54HA4|GTAO_DICDI GATA zinc finger domain-containing protein 15 (Fragment) OS=Dictyostelium discoideum GN=gtaO PE=3 SV=1 520 559 2.0E-09
sp|P0CG22|DR4L1_HUMAN Putative dehydrogenase/reductase SDR family member 4-like 1 OS=Homo sapiens GN=DHRS4L1 PE=5 SV=1 12 247 2.0E-09
sp|Q55C49|GTAG_DICDI GATA zinc finger domain-containing protein 7 OS=Dictyostelium discoideum GN=gtaG PE=3 SV=1 510 556 2.0E-09
sp|Q6UWP2|DHR11_HUMAN Dehydrogenase/reductase SDR family member 11 OS=Homo sapiens GN=DHRS11 PE=1 SV=1 14 247 2.0E-09
sp|P23102|XYLL_PSEPU 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Pseudomonas putida GN=xylL PE=3 SV=1 12 204 2.0E-09
sp|Q54NM5|GTAL_DICDI GATA zinc finger domain-containing protein 12 OS=Dictyostelium discoideum GN=gtaL PE=3 SV=1 452 559 2.0E-09
sp|P08694|BPHB_PSEPS Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Pseudomonas pseudoalcaligenes GN=bphB PE=3 SV=2 12 253 2.0E-09
sp|Q16698|DECR_HUMAN 2,4-dienoyl-CoA reductase, mitochondrial OS=Homo sapiens GN=DECR1 PE=1 SV=1 53 241 3.0E-09
sp|D4A1J4|BDH2_RAT 3-hydroxybutyrate dehydrogenase type 2 OS=Rattus norvegicus GN=Bdh2 PE=3 SV=2 12 253 3.0E-09
sp|P37959|YUSZ_BACSU Uncharacterized oxidoreductase YusZ OS=Bacillus subtilis (strain 168) GN=yusZ PE=3 SV=2 12 215 4.0E-09
sp|Q99MZ7|PECR_MOUSE Peroxisomal trans-2-enoyl-CoA reductase OS=Mus musculus GN=Pecr PE=1 SV=1 76 241 4.0E-09
sp|P07772|BEND_ACIAD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=benD PE=3 SV=2 12 204 4.0E-09
sp|Q0IH28|DRS7B_XENLA Dehydrogenase/reductase SDR family member 7B OS=Xenopus laevis GN=dhrs7b PE=2 SV=1 12 217 4.0E-09
sp|Q6PKH6|DR4L2_HUMAN Dehydrogenase/reductase SDR family member 4-like 2 OS=Homo sapiens GN=DHRS4L2 PE=2 SV=1 12 201 4.0E-09
sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 12 221 4.0E-09
sp|Q7FAE1|MOMAS_ORYSJ Momilactone A synthase OS=Oryza sativa subsp. japonica GN=Os04g0179200 PE=2 SV=1 12 251 5.0E-09
sp|P40398|YHXD_BACSU Uncharacterized oxidoreductase YhxD OS=Bacillus subtilis (strain 168) GN=yhxD PE=3 SV=2 9 241 5.0E-09
sp|Q55GK0|GTAE_DICDI GATA zinc finger domain-containing protein 5 OS=Dictyostelium discoideum GN=gtaE PE=3 SV=1 521 555 7.0E-09
sp|Q3U0B3|DHR11_MOUSE Dehydrogenase/reductase SDR family member 11 OS=Mus musculus GN=Dhrs11 PE=1 SV=1 14 247 8.0E-09
sp|P47227|BPHB_BURXL Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=bphB PE=1 SV=1 12 253 8.0E-09
sp|P9WGR7|Y945_MYCTU Uncharacterized oxidoreductase Rv0945 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0945 PE=1 SV=1 17 211 9.0E-09
sp|P9WGR6|Y945_MYCTO Uncharacterized oxidoreductase MT0971 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT0971 PE=3 SV=1 17 211 9.0E-09
sp|Q5N800|NYC1_ORYSJ Probable chlorophyll(ide) b reductase NYC1, chloroplastic OS=Oryza sativa subsp. japonica GN=NYC1 PE=1 SV=1 18 228 1.0E-08
sp|Q9Y394|DHRS7_HUMAN Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens GN=DHRS7 PE=1 SV=1 8 218 1.0E-08
sp|Q5RJY4|DRS7B_RAT Dehydrogenase/reductase SDR family member 7B OS=Rattus norvegicus GN=Dhrs7b PE=1 SV=1 5 211 1.0E-08
sp|Q8L4M6|GATA3_ARATH GATA transcription factor 3 OS=Arabidopsis thaliana GN=GATA3 PE=2 SV=2 507 564 1.0E-08
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 10 268 1.0E-08
sp|Q59LY1|BRG1_CANAL Biofilm regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRG1 PE=1 SV=1 521 556 1.0E-08
sp|Q5KSV0|GTAK_DICDI GATA zinc finger domain-containing protein 11 OS=Dictyostelium discoideum GN=gtaK PE=2 SV=1 521 556 2.0E-08
sp|Q5R6U1|DRS7B_PONAB Dehydrogenase/reductase SDR family member 7B OS=Pongo abelii GN=DHRS7B PE=2 SV=2 12 233 2.0E-08
sp|Q54TE3|GTAJ_DICDI GATA zinc finger domain-containing protein 10 OS=Dictyostelium discoideum GN=gtaJ PE=3 SV=1 521 557 2.0E-08
sp|P47230|BPHB_RHOGO Cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase OS=Rhodococcus globerulus GN=bphB PE=3 SV=1 12 248 2.0E-08
sp|Q55EQ0|GTAF_DICDI GATA zinc finger domain-containing protein 6 OS=Dictyostelium discoideum GN=gtaF PE=3 SV=1 499 551 2.0E-08
sp|E3VWK2|PENF_STREX 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces exfoliatus GN=penF PE=3 SV=1 12 244 2.0E-08
sp|Q75JZ1|GTAC_DICDI GATA zinc finger domain-containing protein 3 OS=Dictyostelium discoideum GN=gtaC PE=3 SV=1 521 559 2.0E-08
sp|P9WGS3|EPHD_MYCTU Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ephD PE=1 SV=1 8 213 2.0E-08
sp|P9WGS2|EPHD_MYCTO Probable oxidoreductase EphD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ephD PE=3 SV=1 8 213 2.0E-08
sp|P66778|EPHD_MYCBO Probable oxidoreductase EphD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ephD PE=3 SV=1 8 213 2.0E-08
sp|Q99J47|DRS7B_MOUSE Dehydrogenase/reductase SDR family member 7B OS=Mus musculus GN=Dhrs7b PE=1 SV=1 12 211 2.0E-08
sp|P37694|HETN_NOSS1 Ketoacyl reductase HetN OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetN PE=3 SV=2 11 206 2.0E-08
sp|P57432|FABG_BUCAI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabG PE=3 SV=1 100 248 3.0E-08
sp|Q07530|YD114_YEAST Uncharacterized oxidoreductase YDL114W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL114W PE=3 SV=1 1 210 3.0E-08
sp|P54554|YQJQ_BACSU Uncharacterized oxidoreductase YqjQ OS=Bacillus subtilis (strain 168) GN=yqjQ PE=3 SV=1 93 272 3.0E-08
sp|Q3T0R4|DRS7B_BOVIN Dehydrogenase/reductase SDR family member 7B OS=Bos taurus GN=DHRS7B PE=2 SV=1 12 233 3.0E-08
sp|Q9ZPX0|GAT20_ARATH GATA transcription factor 20 OS=Arabidopsis thaliana GN=GATA20 PE=2 SV=2 504 556 4.0E-08
sp|Q6IAN0|DRS7B_HUMAN Dehydrogenase/reductase SDR family member 7B OS=Homo sapiens GN=DHRS7B PE=1 SV=2 12 233 4.0E-08
sp|P25970|Y5909_MYXXD Uncharacterized oxidoreductase MXAN_5909 OS=Myxococcus xanthus (strain DK 1622) GN=MXAN_5909 PE=3 SV=2 15 213 5.0E-08
sp|P96825|Y0148_MYCTU Putative short-chain type dehydrogenase/reductase Rv0148 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0148 PE=1 SV=3 11 230 5.0E-08
sp|Q03326|OXIR_STRAT Probable oxidoreductase OS=Streptomyces antibioticus PE=3 SV=1 10 214 5.0E-08
sp|C1C4R8|BDH2_LITCT 3-hydroxybutyrate dehydrogenase type 2 OS=Lithobates catesbeiana GN=bdh2 PE=2 SV=1 12 255 7.0E-08
sp|P40209|GAT2_YEAST Protein GAT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT2 PE=3 SV=1 521 557 7.0E-08
sp|Q01371|WC1_NEUCR White collar 1 protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=wc-1 PE=1 SV=2 521 557 8.0E-08
sp|Q01373|FOX2_NEUCR Peroxisomal hydratase-dehydrogenase-epimerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=fox-2 PE=1 SV=1 77 215 1.0E-07
sp|A0R518|Y6031_MYCS2 Putative short-chain type dehydrogenase/reductase MSMEG_6031/MSMEI_5872 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_6031 PE=1 SV=1 12 241 1.0E-07
sp|Q6QPM2|GAT19_ARATH GATA transcription factor 19 OS=Arabidopsis thaliana GN=GATA19 PE=2 SV=2 514 572 1.0E-07
sp|Q8LC59|GAT23_ARATH GATA transcription factor 23 OS=Arabidopsis thaliana GN=GATA23 PE=2 SV=2 521 555 2.0E-07
sp|Q561X9|BDH2_DANRE 3-hydroxybutyrate dehydrogenase type 2 OS=Danio rerio GN=bdh2 PE=2 SV=1 12 248 2.0E-07
sp|Q3T046|BDH2_BOVIN 3-hydroxybutyrate dehydrogenase type 2 OS=Bos taurus GN=BDH2 PE=2 SV=1 12 253 3.0E-07
sp|Q9FJ10|GAT16_ARATH GATA transcription factor 16 OS=Arabidopsis thaliana GN=GATA16 PE=2 SV=1 518 573 3.0E-07
sp|D4AK45|CHADH_ARTBC Chanoclavine-I dehydrogenase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04646 PE=1 SV=1 11 203 3.0E-07
sp|O31767|YMFI_BACSU Uncharacterized oxidoreductase YmfI OS=Bacillus subtilis (strain 168) GN=ymfI PE=3 SV=2 14 247 5.0E-07
sp|Q93UV4|FLNB_TERSD Fluoren-9-ol dehydrogenase OS=Terrabacter sp. (strain DBF63) GN=flnB PE=1 SV=1 12 205 6.0E-07
sp|P56937|DHB7_HUMAN 3-keto-steroid reductase OS=Homo sapiens GN=HSD17B7 PE=1 SV=1 15 215 6.0E-07
sp|E3VWI6|PNTF_STRAE 1-deoxy-11-beta-hydroxypentalenate dehydrogenase OS=Streptomyces arenae GN=pntF PE=3 SV=1 13 244 6.0E-07
sp|Q1RMJ5|DRS7C_BOVIN Dehydrogenase/reductase SDR family member 7C OS=Bos taurus GN=DHRS7C PE=2 SV=2 12 206 6.0E-07
sp|Q8LG10|GAT15_ARATH GATA transcription factor 15 OS=Arabidopsis thaliana GN=GATA15 PE=2 SV=2 517 557 6.0E-07
sp|Q8T197|DHRS7_DICDI Dehydrogenase/reductase SDR family protein 7-like OS=Dictyostelium discoideum GN=DDB_G0274201 PE=3 SV=1 5 219 7.0E-07
sp|Q8LC79|GAT18_ARATH GATA transcription factor 18 OS=Arabidopsis thaliana GN=GATA18 PE=2 SV=2 521 556 7.0E-07
sp|Q8GXL7|GAT24_ARATH GATA transcription factor 24 OS=Arabidopsis thaliana GN=GATA24 PE=2 SV=2 520 553 8.0E-07
sp|O74628|YQ53_SCHPO Uncharacterized oxidoreductase C162.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.03 PE=3 SV=1 17 216 9.0E-07
sp|Q988B7|PLDH_RHILO Pyridoxal 4-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=pldh-t PE=1 SV=1 12 251 1.0E-06
sp|Q91X52|DCXR_MOUSE L-xylulose reductase OS=Mus musculus GN=Dcxr PE=1 SV=2 10 247 1.0E-06
sp|Q8LAU9|GATA1_ARATH GATA transcription factor 1 OS=Arabidopsis thaliana GN=GATA1 PE=2 SV=2 521 550 1.0E-06
sp|O32229|YVAG_BACSU Uncharacterized oxidoreductase YvaG OS=Bacillus subtilis (strain 168) GN=yvaG PE=3 SV=1 10 248 2.0E-06
sp|Q6DBP8|GAT11_ARATH GATA transcription factor 11 OS=Arabidopsis thaliana GN=GATA11 PE=2 SV=1 521 550 2.0E-06
sp|Q9CXR1|DHRS7_MOUSE Dehydrogenase/reductase SDR family member 7 OS=Mus musculus GN=Dhrs7 PE=1 SV=2 8 204 2.0E-06
sp|Q5HZ36|GAT21_ARATH GATA transcription factor 21 OS=Arabidopsis thaliana GN=GATA21 PE=1 SV=2 520 552 2.0E-06
sp|Q83RE8|YDFG_SHIFL NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Shigella flexneri GN=ydfG PE=3 SV=2 16 248 2.0E-06
sp|P35320|OXIR_STRLI Probable oxidoreductase OS=Streptomyces lividans PE=3 SV=1 10 214 2.0E-06
sp|Q8FHD2|YDFG_ECOL6 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ydfG PE=3 SV=2 16 248 3.0E-06
sp|Q93761|YXEK_CAEEL Uncharacterized oxidoreductase F53C11.3 OS=Caenorhabditis elegans GN=F53C11.3 PE=3 SV=1 126 248 3.0E-06
sp|Q9SZI6|GAT22_ARATH Putative GATA transcription factor 22 OS=Arabidopsis thaliana GN=GATA22 PE=3 SV=1 520 549 3.0E-06
sp|Q9LRH6|GAT25_ARATH GATA transcription factor 25 OS=Arabidopsis thaliana GN=GATA25 PE=2 SV=2 521 571 3.0E-06
sp|P14802|YOXD_BACSU Uncharacterized oxidoreductase YoxD OS=Bacillus subtilis (strain 168) GN=yoxD PE=3 SV=2 64 241 3.0E-06
sp|Q8VZP4|GAT10_ARATH GATA transcription factor 10 OS=Arabidopsis thaliana GN=GATA10 PE=2 SV=1 520 550 3.0E-06
sp|Q8CHS7|DRS7C_MOUSE Dehydrogenase/reductase SDR family member 7C OS=Mus musculus GN=Dhrs7c PE=1 SV=3 11 206 3.0E-06
sp|Q9P324|YI78_SCHPO Uncharacterized oxidoreductase C977.08/C1348.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.08 PE=3 SV=1 73 237 3.0E-06
sp|P39831|YDFG_ECOLI NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli (strain K12) GN=ydfG PE=1 SV=2 16 248 3.0E-06
sp|Q7T2D1|RD10B_DANRE Retinol dehydrogenase 10-B OS=Danio rerio GN=rdh10b PE=2 SV=2 11 158 4.0E-06
sp|P40471|AYR1_YEAST NADPH-dependent 1-acyldihydroxyacetone phosphate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AYR1 PE=1 SV=1 15 204 4.0E-06
sp|Q1JP75|DCXR_BOVIN L-xylulose reductase OS=Bos taurus GN=DCXR PE=2 SV=1 10 247 5.0E-06
sp|Q8U8I2|SDH_AGRFC Serine 3-dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=sdh PE=3 SV=1 17 248 5.0E-06
sp|Q8X505|YDFG_ECO57 NADP-dependent 3-hydroxy acid dehydrogenase YdfG OS=Escherichia coli O157:H7 GN=ydfG PE=3 SV=1 16 248 5.0E-06
sp|O34782|YVRD_BACSU Uncharacterized oxidoreductase YvrD OS=Bacillus subtilis (strain 168) GN=yvrD PE=3 SV=1 10 227 6.0E-06
sp|O32291|YXNA_BACSU Uncharacterized oxidoreductase YxnA OS=Bacillus subtilis (strain 168) GN=yxnA PE=3 SV=2 14 208 8.0E-06
sp|Q92EK7|Y452_LISIN Uncharacterized oxidoreductase Lin0452 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lin0452 PE=3 SV=1 10 230 8.0E-06
sp|Q9P7B4|YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC521.03 PE=1 SV=1 12 255 8.0E-06
sp|Q556J2|KDSR_DICDI 3-ketodihydrosphingosine reductase OS=Dictyostelium discoideum GN=ksrA-1 PE=3 SV=1 10 212 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0031323 regulation of cellular metabolic process No
GO:0003676 nucleic acid binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0019222 regulation of metabolic process No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:1901363 heterocyclic compound binding No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0003677 DNA binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0080090 regulation of primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|056270
MSQPRTLPSFSLENKVCLVTGAARGLGLEFCRAFVQSGSTKVAILDLQESEAKAAAEELISFAIENKLPEPTILG
IGCDVASEISVQNAYRVVTEYFGRIDVAVACAGITENIPAIEYPADRLKLLYDINVHGAFFTAREAAKYMMKQGG
GSIILVASMSANIVNIPQPQTPYNASKAAVKHMASSLAVEWARTGIRVNALSPGYMLTKLTNTVLQGKEELKKQW
EDLTPMGKMGDPEDLAGAIRYVSMGDTAAFEHLAAYLNVGSAIYRILQSKSNDHVSHIPDKYHIQHVVYLRVHKA
EAGKVLYCGNAVNELLGWNETDILDLRLDDFIIEQEQTVFQRALQSSIRTNTELLSYVRFKCNPAAQSAQSSTSD
ILFEIKGYPHFVSDQDPECKCFFAMAKPYPSRNTAMLNTFLELQMENERLQQCLAALKLQVDSRITASGHILPSV
NSMYATSLPSGGQYSSSLDGALNTATATYDNNLLKGNYNGDSSQTQNPEDLEDSSRRKKLKKTHILDQHVCRKCG
RTDSPEWRKGPDGPKTLCNACGLRWAKQMRRLDEPSEENTASTSTPGSETVNSNA*
Coding >Agabi119p4|056270
ATGTCCCAGCCACGAACGCTACCCTCTTTCTCTCTCGAAAATAAGGTTTGTCTGGTCACAGGAGCTGCGCGAGGC
TTAGGCTTAGAATTTTGTCGTGCTTTTGTTCAATCTGGAAGCACAAAGGTTGCGATACTAGACCTTCAGGAGTCC
GAAGCCAAGGCAGCGGCTGAGGAGTTAATTTCATTTGCTATCGAGAATAAGCTTCCCGAGCCGACAATTCTGGGC
ATTGGATGTGACGTCGCTTCGGAAATTTCTGTTCAAAATGCGTACAGAGTTGTCACTGAATATTTTGGAAGAATA
GATGTCGCAGTGGCTTGCGCAGGTATTACGGAGAATATCCCTGCGATTGAGTATCCTGCCGATCGCCTCAAGCTG
CTCTATGATATAAACGTCCATGGTGCCTTCTTTACCGCGCGAGAGGCTGCGAAATACATGATGAAGCAAGGCGGG
GGCTCGATCATCCTCGTAGCGAGCATGAGTGCCAACATTGTCAATATTCCCCAGCCCCAGACACCTTATAATGCT
TCTAAGGCTGCTGTCAAGCATATGGCCTCGAGCCTTGCCGTGGAATGGGCTAGAACAGGAATCCGTGTCAATGCA
CTAAGCCCAGGCTACATGCTCACCAAGTTGACCAACACGGTTCTGCAAGGGAAGGAAGAGCTTAAGAAACAATGG
GAAGACCTTACTCCGATGGGAAAGATGGGTGACCCTGAGGATCTGGCGGGCGCGATCAGATACGTGTCGATGGGG
GATACTGCTGCCTTTGAGCACCTTGCAGCGTACTTAAATGTTGGCTCAGCCATATATAGAATCCTGCAGTCAAAG
TCAAACGACCATGTCAGCCACATCCCAGACAAATACCATATCCAACACGTTGTCTACCTTCGAGTTCACAAAGCG
GAAGCGGGGAAAGTTTTGTATTGTGGAAACGCTGTCAACGAACTCCTTGGGTGGAACGAGACAGATATTTTAGAT
CTCCGTTTGGATGATTTTATCATAGAGCAAGAACAGACAGTGTTTCAACGTGCTCTCCAAAGCTCGATCCGAACC
AATACGGAACTTCTTTCTTATGTTCGATTTAAATGTAATCCAGCTGCCCAGTCTGCGCAATCTTCAACGAGCGAT
ATACTATTCGAAATCAAAGGCTACCCACACTTCGTGTCTGATCAGGATCCTGAATGCAAGTGTTTTTTCGCTATG
GCAAAGCCGTATCCCAGTCGCAATACTGCAATGCTTAATACATTTCTGGAATTGCAGATGGAGAACGAGAGATTG
CAGCAATGTCTTGCTGCTCTCAAACTCCAAGTGGACTCGCGAATTACGGCGTCTGGTCATATTTTGCCATCTGTC
AACTCGATGTACGCCACTTCTTTGCCAAGCGGAGGCCAGTATTCCAGTTCATTGGACGGTGCATTGAACACAGCG
ACAGCAACCTATGACAACAACTTGCTGAAAGGAAACTATAATGGGGACAGCTCTCAGACACAAAATCCCGAGGAT
CTCGAAGACAGTTCGAGAAGGAAGAAGCTCAAGAAAACGCACATTTTGGATCAGCATGTTTGCAGAAAATGCGGG
CGAACAGATTCCCCTGAATGGCGGAAAGGTCCAGATGGCCCGAAGACTCTTTGTAACGCCTGTGGTTTACGCTGG
GCAAAGCAGATGAGGCGGTTAGATGAACCTTCAGAGGAAAATACTGCCAGCACCTCGACACCGGGTTCGGAGACC
GTGAACTCCAATGCCTGA
Transcript >Agabi119p4|056270
ATGTCCCAGCCACGAACGCTACCCTCTTTCTCTCTCGAAAATAAGGTTTGTCTGGTCACAGGAGCTGCGCGAGGC
TTAGGCTTAGAATTTTGTCGTGCTTTTGTTCAATCTGGAAGCACAAAGGTTGCGATACTAGACCTTCAGGAGTCC
GAAGCCAAGGCAGCGGCTGAGGAGTTAATTTCATTTGCTATCGAGAATAAGCTTCCCGAGCCGACAATTCTGGGC
ATTGGATGTGACGTCGCTTCGGAAATTTCTGTTCAAAATGCGTACAGAGTTGTCACTGAATATTTTGGAAGAATA
GATGTCGCAGTGGCTTGCGCAGGTATTACGGAGAATATCCCTGCGATTGAGTATCCTGCCGATCGCCTCAAGCTG
CTCTATGATATAAACGTCCATGGTGCCTTCTTTACCGCGCGAGAGGCTGCGAAATACATGATGAAGCAAGGCGGG
GGCTCGATCATCCTCGTAGCGAGCATGAGTGCCAACATTGTCAATATTCCCCAGCCCCAGACACCTTATAATGCT
TCTAAGGCTGCTGTCAAGCATATGGCCTCGAGCCTTGCCGTGGAATGGGCTAGAACAGGAATCCGTGTCAATGCA
CTAAGCCCAGGCTACATGCTCACCAAGTTGACCAACACGGTTCTGCAAGGGAAGGAAGAGCTTAAGAAACAATGG
GAAGACCTTACTCCGATGGGAAAGATGGGTGACCCTGAGGATCTGGCGGGCGCGATCAGATACGTGTCGATGGGG
GATACTGCTGCCTTTGAGCACCTTGCAGCGTACTTAAATGTTGGCTCAGCCATATATAGAATCCTGCAGTCAAAG
TCAAACGACCATGTCAGCCACATCCCAGACAAATACCATATCCAACACGTTGTCTACCTTCGAGTTCACAAAGCG
GAAGCGGGGAAAGTTTTGTATTGTGGAAACGCTGTCAACGAACTCCTTGGGTGGAACGAGACAGATATTTTAGAT
CTCCGTTTGGATGATTTTATCATAGAGCAAGAACAGACAGTGTTTCAACGTGCTCTCCAAAGCTCGATCCGAACC
AATACGGAACTTCTTTCTTATGTTCGATTTAAATGTAATCCAGCTGCCCAGTCTGCGCAATCTTCAACGAGCGAT
ATACTATTCGAAATCAAAGGCTACCCACACTTCGTGTCTGATCAGGATCCTGAATGCAAGTGTTTTTTCGCTATG
GCAAAGCCGTATCCCAGTCGCAATACTGCAATGCTTAATACATTTCTGGAATTGCAGATGGAGAACGAGAGATTG
CAGCAATGTCTTGCTGCTCTCAAACTCCAAGTGGACTCGCGAATTACGGCGTCTGGTCATATTTTGCCATCTGTC
AACTCGATGTACGCCACTTCTTTGCCAAGCGGAGGCCAGTATTCCAGTTCATTGGACGGTGCATTGAACACAGCG
ACAGCAACCTATGACAACAACTTGCTGAAAGGAAACTATAATGGGGACAGCTCTCAGACACAAAATCCCGAGGAT
CTCGAAGACAGTTCGAGAAGGAAGAAGCTCAAGAAAACGCACATTTTGGATCAGCATGTTTGCAGAAAATGCGGG
CGAACAGATTCCCCTGAATGGCGGAAAGGTCCAGATGGCCCGAAGACTCTTTGTAACGCCTGTGGTTTACGCTGG
GCAAAGCAGATGAGGCGGTTAGATGAACCTTCAGAGGAAAATACTGCCAGCACCTCGACACCGGGTTCGGAGACC
GTGAACTCCAATGCCTGA
Gene >Agabi119p4|056270
ATGTCCCAGCCACGAACGCTACCCTCTTTCTCTCTCGAAAATAAGGTACTTACTATGCTCGTATCGTGAGGGACC
CACGGCTTAAAACTCCGCCGCGCCTTAGGTTTGTCTGGTCACAGGAGCTGCGCGAGGCTTAGGCTTAGAATTTTG
TCGTGCTTTTGTTCAATCGTGCGTGCTTCAATAACCGGGGCAACATTATATACCCACACACTTCCCCAGTGGAAG
CACAAAGGTTGCGATACTAGACCTTCAGGAGTCCGAAGCCAAGGCAGCGGCTGAGGAGTTAATTTCATTTGCTAT
CGGTCCGTCGAAAGTCGTCCTGACAACCAGTGAGCTTTGGACTAAGCTAGCGAGGTACCTAGAGAATAAGCTTCC
CGAGCCGACAATTCTGGGCATTGGATGTGACGTCGCTTCGGAAATTTCTGTTCAAAATGCGTACAGAGTTGTCAC
TGAATATTTTGGAAGAATAGATGTCGCAGTGGCTTGCGCAGGTGGAGGCGACCGACGATCATCGAAAATAGCACT
TATACTTTCTCATATAGGTATTACGGAGAATATCCCTGCGATTGAGTAAGTTGATCCGATGCTTGGTAGACATTC
TGCTGATTGTGATAATGAATTACCAGGTATCCTGCCGATCGCCTCAAGCTGCTCTATGATATAAACGTCCATGGT
GCCTTCTTTACCGCGCGAGAGGCTGCGAAATACATGATGAAGCAAGGCGGGGGCTCGATCATCCTCGTAGCGAGC
ATGAGTGCCAACGTAAGGCCTGAAGTTCGACGATTAGAGCTATAGAATAATATCCTCGCAAACACAGATTGTCAA
TATTCCCCAGGTATCTCGTGCCTCTCCCCTGCCGATTTTATTGGTTCCTGAACGGTGACTAGCCCCAGACACCTT
ATAATGCTTCTAAGGCTGGTGAGTTCAGACGCGTCCCAAGGGTGATCTAGGCTGAATTTCACTATAGCTGTCAAG
CATATGGCCTCGAGCCTTGCCGTGGAATGGGCTAGAACAGGAATCCGTGTCAATGCACTAAGGTGTCTCAATTTG
GGACTTGGCACCACTGTATTTCGCTAATACCCGTGTCAGCCCAGGCTACATGCTCACCAAGTTGACCAACACGGT
TCTGCAAGGGAAGGAAGAGCTTAAGGTTGTGATTAATCCAGTGGAATCTGCTCTATTGCTGAATCCGTTACGTTT
AGAAACAATGGGAAGACCTTACTCCGATGGGAAAGGTGTGTAGCCCTACTCTCACTAGGATCTACCTCCACTCAA
CCGAACTCCTTAAAGATGGGTGACCCTGAGGATCTGGCGGTGAGTACGCGCGATTGACTATTCCCCCCGGCTTAT
CAAGGAACCAGGGCGCGATCGTATTCTTGGCAAGCGATGCATCGAGGTTCATGACTGGGTCAGAGATACGTGTCG
ATGGGGGATACTGCTGCCTTTGAGGTACTATTGCCGATGTATCGTTACTTCGAATGGATGACGCAGTTGATTAGC
ACCTTGCAGCGTACTTAAATGTTGGCTCAGCCATATATAGAATCCTGCAGTCAAAGTCAAACGACCATGTCAGCC
ACATCCCAGACAAATACCATATCCAACACGTTGTCTACCTTCGAGTTCACAAAGCGGAAGCGGTGGGCTGATATA
CTTGTCACCGGACTTACCGATGTCATTATTTTTGTCCTTTCTCCTGAGGGGAAAGTTTTGTATTGTGGAAACGCT
GTCAACGAACTCCTTGGGTGGAACGAGACAGATATTTTAGATCTCCGTTTGGATGATTTTATCATAGGTACGCTC
GCTTCGTCCGTTCCTATCCGCGCTTATCTAACAAAAACAAGAGCAAGAACAGACAGTGTTTCAACGTGCTCTCCA
AAGCTCGATCCGAACCAATACGGAACTTCTTTCTTATGTTCGATTTAAATGTAATCCAGCTGCCCAGTCTGCGCA
ATCTTCAACGAGCGATATACTATTCGAAATCAAAGGCTACCCACACTTCGTGTCTGATCAGGATCCTGAATGCAA
GTGTTTTTTCGCTATGGCAAAGCCGTATCCCAGTCGCAATACTGCAATGTGTGTTAAGAGACCACGCTGAACAGG
GAACTTTTACAATTGACTGTTGCACAGGCTTAATACATTTCTGGAATTGCAGATGGAGAACGAGAGATTGCAGCA
ATGTCTTGCTGCTCTCAAACTCCAAGTGGACTCGCGAATTACGGCGTCTGGTCATATTTTGCCATCTGTCAACTC
GATGTACGCCACTTCTTTGCCAAGGTCAGAAACCTTACGCACAATGTTCGGAGCAAGCTCTCATGTCTTTCTAGC
GGAGGCCAGTATTCCAGTTCATTGGACGGTGCATTGAACACAGCGACAGCAACCTATGACAACAACTTGCTGAAA
GGAAACTATAATGGGGACAGCTCTCAGACACAAAATCCCGAGGATCTCGAAGACAGTTCGAGAAGGAAGAAGGTG
AGTTCAGACATGTTTCTCGAAATGATTCACTGATTGGCCGTAGCTCAAGAAAACGCACATTTTGGATCAGCATGT
TTGCAGAAAATGCGGGCGAACAGATTCCCCTGAATGGCGGAAAGTATGGCCCCACAGATTTTCGACTACATGAAA
AGGTGTTGATTCCTCTCACATAGGGTCCAGATGGCCCGAAGACTCTTTGTAACGCCTGTGGTTTACGCTGGGCAA
AGCAGATGAGGCGGTTAGATGAACCTTCAGAGGAAAATACTGCCAGCACCTCGACACCGGGTTCGGAGACCGTGA
ACTCCAATGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail