Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|055910
Gene name
Locationscaffold_03a:833286..834986
Strand+
Gene length (bp)1700
Transcript length (bp)1254
Coding sequence length (bp)1254
Protein length (aa) 418

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF18884 TSP3_bac Bacterial TSP3 repeat 2.5E-05 375 394

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0XMA2|PLYC_ASPFC Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|Q4WL88|PLYC_ASPFU Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|Q0CLG7|PLYC_ASPTN Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|A1DPF0|PLYC_NEOFI Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|B8NQQ7|PLYC_ASPFN Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=plyC PE=3 SV=1 1 417 1.0E-178
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0XMA2|PLYC_ASPFC Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|Q4WL88|PLYC_ASPFU Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|Q0CLG7|PLYC_ASPTN Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|A1DPF0|PLYC_NEOFI Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=plyC PE=3 SV=1 1 417 0.0E+00
sp|B8NQQ7|PLYC_ASPFN Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=plyC PE=3 SV=1 1 417 1.0E-178
sp|Q2UB83|PLYC_ASPOR Probable pectate lyase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=plyC PE=3 SV=1 1 417 3.0E-177
sp|Q5B297|PLYC_EMENI Probable pectate lyase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=plyC PE=3 SV=1 16 417 5.0E-177
sp|O65388|PLY2_ARATH Putative pectate lyase 2 OS=Arabidopsis thaliana GN=At1g11920 PE=3 SV=2 26 237 3.0E-07
sp|O65457|PLY17_ARATH Putative pectate lyase 17 OS=Arabidopsis thaliana GN=At4g22090 PE=3 SV=1 26 174 7.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|055910
MKLSICFASLLYLAGSCSGLLAFPGAEGFGAQATGGRGGSVYVVTNLNDSGSGSFRDAVSESNRIVVFAVGGVIN
ISSRIVVSSHVTIAGQTAPGQGITVYGNGVSYSGADNTITRYIRYRMGRSGDSGKDTITIADGANMIFDHVSVSW
GRDESFSINGDVSNVTISDSIIAQGLETHSCGGLIQTDGGVSIIRTLYIDNKTRNPKVKGVNEFVNNVVYNWGGG
GGYIAGDSAGPSHANIMNNVFISGPSTSVTAFTRGNENFHAYVSSNYYDPDRNGVLSGFILSPTTDNYSPIDFQS
TRYPYPTVKSLLNPLDALHKVASSAGASKSRDSVDNYLINNELLTYGKVGALISDEKASPINGPGNVEGGTPPRD
SDNDGIPDDYETAHGTDPHSNDSARIASNGYANIENYINSLV*
Coding >Agabi119p4|055910
ATGAAATTATCGATTTGTTTTGCCTCCCTCTTGTATCTCGCTGGCTCGTGTTCGGGCCTCCTCGCATTTCCAGGA
GCTGAAGGCTTCGGGGCCCAAGCCACCGGAGGGCGTGGTGGTTCTGTTTATGTGGTGACCAATCTTAACGATTCT
GGGTCTGGCAGCTTTCGCGACGCGGTTTCGGAATCAAATAGGATCGTGGTATTTGCCGTCGGGGGCGTAATCAAT
ATCAGTAGTCGCATCGTCGTCAGCAGCCATGTTACTATTGCTGGTCAAACGGCCCCTGGTCAAGGTATTACTGTA
TATGGCAATGGTGTCTCCTATTCTGGCGCAGACAACACCATCACTCGCTATATCCGTTACCGAATGGGAAGGTCA
GGTGATTCTGGGAAAGATACAATCACAATTGCAGATGGTGCAAACATGATTTTCGATCATGTTAGCGTCTCCTGG
GGTCGTGACGAGAGTTTTTCCATCAATGGAGACGTTTCAAATGTTACCATTTCGGACTCCATCATTGCACAGGGC
CTCGAGACTCATTCCTGCGGAGGTCTTATACAGACCGACGGGGGTGTGAGTATAATTCGCACTCTGTACATTGAT
AACAAAACTCGGAATCCTAAAGTGAAAGGTGTTAATGAGTTTGTCAACAACGTGGTTTATAACTGGGGAGGCGGA
GGCGGTTACATTGCCGGGGACTCTGCCGGTCCTTCACACGCCAATATCATGAATAATGTATTCATTAGTGGTCCC
TCGACCTCAGTCACTGCTTTCACGCGTGGAAATGAAAACTTCCACGCCTACGTCTCCAGCAATTACTACGATCCT
GACAGAAATGGCGTTCTCAGTGGATTTATCCTGTCACCTACGACTGACAACTACTCGCCAATCGATTTCCAATCT
ACTCGATACCCTTATCCCACCGTGAAGTCTTTATTAAACCCACTCGATGCGCTCCATAAGGTCGCATCATCCGCT
GGTGCTAGCAAATCCCGGGACAGCGTCGATAATTACCTCATCAACAACGAACTCTTAACCTATGGCAAAGTCGGA
GCTTTGATCTCAGATGAAAAAGCATCTCCTATAAATGGGCCTGGAAATGTCGAAGGTGGAACGCCACCTCGGGAT
AGTGATAATGATGGAATTCCAGATGATTACGAGACCGCCCATGGGACGGATCCCCACTCCAATGACTCTGCAAGG
ATCGCTTCCAACGGATATGCGAATATTGAGAACTATATCAACTCTTTGGTGTAG
Transcript >Agabi119p4|055910
ATGAAATTATCGATTTGTTTTGCCTCCCTCTTGTATCTCGCTGGCTCGTGTTCGGGCCTCCTCGCATTTCCAGGA
GCTGAAGGCTTCGGGGCCCAAGCCACCGGAGGGCGTGGTGGTTCTGTTTATGTGGTGACCAATCTTAACGATTCT
GGGTCTGGCAGCTTTCGCGACGCGGTTTCGGAATCAAATAGGATCGTGGTATTTGCCGTCGGGGGCGTAATCAAT
ATCAGTAGTCGCATCGTCGTCAGCAGCCATGTTACTATTGCTGGTCAAACGGCCCCTGGTCAAGGTATTACTGTA
TATGGCAATGGTGTCTCCTATTCTGGCGCAGACAACACCATCACTCGCTATATCCGTTACCGAATGGGAAGGTCA
GGTGATTCTGGGAAAGATACAATCACAATTGCAGATGGTGCAAACATGATTTTCGATCATGTTAGCGTCTCCTGG
GGTCGTGACGAGAGTTTTTCCATCAATGGAGACGTTTCAAATGTTACCATTTCGGACTCCATCATTGCACAGGGC
CTCGAGACTCATTCCTGCGGAGGTCTTATACAGACCGACGGGGGTGTGAGTATAATTCGCACTCTGTACATTGAT
AACAAAACTCGGAATCCTAAAGTGAAAGGTGTTAATGAGTTTGTCAACAACGTGGTTTATAACTGGGGAGGCGGA
GGCGGTTACATTGCCGGGGACTCTGCCGGTCCTTCACACGCCAATATCATGAATAATGTATTCATTAGTGGTCCC
TCGACCTCAGTCACTGCTTTCACGCGTGGAAATGAAAACTTCCACGCCTACGTCTCCAGCAATTACTACGATCCT
GACAGAAATGGCGTTCTCAGTGGATTTATCCTGTCACCTACGACTGACAACTACTCGCCAATCGATTTCCAATCT
ACTCGATACCCTTATCCCACCGTGAAGTCTTTATTAAACCCACTCGATGCGCTCCATAAGGTCGCATCATCCGCT
GGTGCTAGCAAATCCCGGGACAGCGTCGATAATTACCTCATCAACAACGAACTCTTAACCTATGGCAAAGTCGGA
GCTTTGATCTCAGATGAAAAAGCATCTCCTATAAATGGGCCTGGAAATGTCGAAGGTGGAACGCCACCTCGGGAT
AGTGATAATGATGGAATTCCAGATGATTACGAGACCGCCCATGGGACGGATCCCCACTCCAATGACTCTGCAAGG
ATCGCTTCCAACGGATATGCGAATATTGAGAACTATATCAACTCTTTGGTGTAG
Gene >Agabi119p4|055910
ATGAAATTATCGATTTGTTTTGCCTCCCTCTTGTATCTCGCTGGCTCGTGTTCGGGCCTCCTCGCATTTCCAGGA
GCTGAAGGCATGTTACATGAGTCTTTCCCCAACTATCCTCAGCTCCAATTTTGAAATAGGCTTCGGGGCCCAAGC
CACCGGAGGGCGTGGTGGTTCTGTTTATGTGGTGACCAATCTTAACGATTCTGGGTCTGGCAGCTTTCGCGACGC
GGTTTCGGAATCAAATAGGGTATGTTCAAGGAACTATAGGGATTCGTCTCTCAACCCTAATTCTGTCGGAGATCG
TGGTATTTGCCGTCGGGGGCGTAATCAATATCAGTAGTCGCATCGTCGTCAGCAGCCATGTTACTATTGCTGGTC
AAACGGCCCCTGGTCAAGGTATTACTGTATATGGCAATGGTGTCTCCTATTCTGGCGCAGACAACACCATCACTC
GCTATATCCGTTACCGAATGGGAAGGTCAGGTGTGTACATTGTTACGATTCCAGTACACTCCAGTTTTAGTTTAG
ATATAACCTACTAGGTGATTCTGGGAAAGATACAATCACAATTGCAGATGGTGCAAACATGATTTTCGATCATGT
TAGCGTCTCCTGGGGTCGTGACGAGAGTTTTTCCATCAATGGAGACGTTTCAAATGTTACCATTTCGGACTCCAT
CATTGCACAGGGCCTCGAGACTCATTCCTGCGGAGGTCTTATACAGACCGACGGGGGTGTGAGTATAATTCGCAC
TCTGTACATTGATAACAAAACTCGGAATCCTAAAGTGAAAGGTGTTAATGAGTTTGTCAACAACGTGGTATGTTT
TTCATTGGCGAGATGTCGTTACTTTGACGATATGCATATTCTACAGGTTTATAACTGGGGAGGCGGAGGCGGTTA
CATTGCCGGGGACTCTGCCGGTCCTTCACACGCCAATATCATGAATAATGTATTCATTAGTGGTCCCTCGACCTC
AGTCACTGCTTGTAAATGGCGTCTAATCCTTCATTGCACTGCTGCTCACCCGAACCTTTCTTTTTTTTATAAAGT
CACGCGTGGAAATGAAAACTTCCACGCCTACGTCTCCAGCAATTACTACGATCCTGACAGAGTATGAGGCAATCA
TGAATTGACCAACCAACAAAAGCTGAATGAACTCATAGAATGGCGTTCTCAGTGGATTTATCCTGTCACCTACGA
CTGACAACTACTCGCCAATCGATTTCCAATCTACTCGATACCCTTATCCCACCGTGAAGTCTTTATTAAACCCAC
TCGATGCGCTCCATAAGGTCGCATCATCCGCTGGTGCTAGCAAATCCCGGGACAGCGTCGATAATTACCTCATCA
ACAACGAACTCTTAACCTATGGCAAAGTCGGAGCTTTGATCTCAGATGAAAAAGCATCTCCTATAAATGGGCCTG
GAAATGTCGAAGGTGGAACGGTGAGCCGCTTCTTCTCCTCAAAAAACGTATATAAGTAAATGCTGAATATTTTCC
CCAGCCACCTCGGGATAGTGATAATGATGGAATTCCAGATGATTACGAGACCGCCCATGGGACGGATCCCCACTC
CAATGACTCTGCAAGGATCGCTTCCAACGGATATGCGAGTACGGTTTTTGACACATAATGCATTTGTCTACATTT
ACTGACTACTAGCTATAGATATTGAGAACTATATCAACTCTTTGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail