Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|055820
Gene name
Locationscaffold_03a:811276..812046
Strand+
Gene length (bp)770
Transcript length (bp)618
Coding sequence length (bp)618
Protein length (aa) 206

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04051 TRAPP Transport protein particle (TRAPP) component 4.8E-40 26 191

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P5|BET3_SCHPO Transport protein particle subunit bet3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet3 PE=3 SV=1 8 205 2.0E-73
sp|P36149|BET3_YEAST Trafficking protein particle complex subunit BET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET3 PE=1 SV=1 3 205 2.0E-69
sp|Q5ZI57|TPPC3_CHICK Trafficking protein particle complex subunit 3 OS=Gallus gallus GN=TRAPPC3 PE=2 SV=1 16 205 2.0E-67
sp|Q5U1Z2|TPPC3_RAT Trafficking protein particle complex subunit 3 OS=Rattus norvegicus GN=Trappc3 PE=2 SV=1 16 205 2.0E-67
sp|O55013|TPPC3_MOUSE Trafficking protein particle complex subunit 3 OS=Mus musculus GN=Trappc3 PE=1 SV=1 16 205 2.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6P5|BET3_SCHPO Transport protein particle subunit bet3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bet3 PE=3 SV=1 8 205 2.0E-73
sp|P36149|BET3_YEAST Trafficking protein particle complex subunit BET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET3 PE=1 SV=1 3 205 2.0E-69
sp|Q5ZI57|TPPC3_CHICK Trafficking protein particle complex subunit 3 OS=Gallus gallus GN=TRAPPC3 PE=2 SV=1 16 205 2.0E-67
sp|Q5U1Z2|TPPC3_RAT Trafficking protein particle complex subunit 3 OS=Rattus norvegicus GN=Trappc3 PE=2 SV=1 16 205 2.0E-67
sp|O55013|TPPC3_MOUSE Trafficking protein particle complex subunit 3 OS=Mus musculus GN=Trappc3 PE=1 SV=1 16 205 2.0E-67
sp|O43617|TPPC3_HUMAN Trafficking protein particle complex subunit 3 OS=Homo sapiens GN=TRAPPC3 PE=1 SV=1 16 205 4.0E-67
sp|Q86K94|TPPC3_DICDI Trafficking protein particle complex subunit 3 OS=Dictyostelium discoideum GN=trappc3 PE=3 SV=2 3 205 2.0E-63
sp|Q4KL14|TPC3L_MOUSE Trafficking protein particle complex subunit 3-like protein OS=Mus musculus GN=Trappc3l PE=2 SV=1 19 199 1.0E-50
sp|Q5T215|TPC3L_HUMAN Trafficking protein particle complex subunit 3-like protein OS=Homo sapiens GN=TRAPPC3L PE=1 SV=1 19 199 4.0E-47
sp|P34605|TPPC3_CAEEL Probable trafficking protein particle complex subunit 3 OS=Caenorhabditis elegans GN=trpp-3 PE=1 SV=1 7 205 2.0E-39
sp|Q61IU9|TPPC3_CAEBR Probable trafficking protein particle complex subunit 3 OS=Caenorhabditis briggsae GN=CBG10062 PE=3 SV=1 7 205 1.0E-38
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|055820
MATKNFKSIGEDLWKSRTEKINAELFALTYGALVVQLIQDYEDYDQVNKELEKMGYNIGTRLIEDFLAKSNVSRC
ADFRETGEVVAKVGFKAFLNITPTITHGALLPPASPRPDSTGGQPPAGSWFTLTLDDNPLAEFVELPDEVLEGGL
WFSNVLCGVIRGALEMIQMQVQAEFLSDVLRGDETTEIRVKLVKYLEEEVPVGDD*
Coding >Agabi119p4|055820
ATGGCGACAAAGAATTTCAAGAGCATCGGTGAAGACCTTTGGAAAAGTCGAACAGAAAAAATCAATGCAGAGCTA
TTCGCACTTACCTATGGCGCCTTGGTAGTCCAACTCATCCAGGATTATGAGGACTATGACCAAGTCAATAAAGAG
CTTGAGAAGATGGGATACAACATCGGCACGCGTCTCATCGAAGACTTCCTGGCAAAGTCGAATGTGAGTCGGTGC
GCAGATTTTAGGGAAACAGGCGAGGTTGTCGCGAAAGTAGGATTCAAGGCCTTCCTGAACATCACACCTACTATT
ACACATGGCGCTCTTCTACCGCCTGCCTCTCCGAGGCCAGATTCAACCGGTGGACAACCACCTGCGGGATCGTGG
TTCACGCTCACTCTCGACGATAATCCTCTAGCGGAATTTGTTGAATTGCCCGATGAAGTACTGGAGGGCGGCCTT
TGGTTCAGTAATGTGCTCTGCGGCGTTATTCGGGGTGCTTTAGAGATGATTCAGATGCAAGTTCAAGCAGAATTC
CTTTCAGATGTTCTTCGTGGAGATGAGACCACCGAGATTCGTGTAAAGCTAGTAAAATATCTAGAGGAGGAGGTC
CCTGTTGGAGATGATTAG
Transcript >Agabi119p4|055820
ATGGCGACAAAGAATTTCAAGAGCATCGGTGAAGACCTTTGGAAAAGTCGAACAGAAAAAATCAATGCAGAGCTA
TTCGCACTTACCTATGGCGCCTTGGTAGTCCAACTCATCCAGGATTATGAGGACTATGACCAAGTCAATAAAGAG
CTTGAGAAGATGGGATACAACATCGGCACGCGTCTCATCGAAGACTTCCTGGCAAAGTCGAATGTGAGTCGGTGC
GCAGATTTTAGGGAAACAGGCGAGGTTGTCGCGAAAGTAGGATTCAAGGCCTTCCTGAACATCACACCTACTATT
ACACATGGCGCTCTTCTACCGCCTGCCTCTCCGAGGCCAGATTCAACCGGTGGACAACCACCTGCGGGATCGTGG
TTCACGCTCACTCTCGACGATAATCCTCTAGCGGAATTTGTTGAATTGCCCGATGAAGTACTGGAGGGCGGCCTT
TGGTTCAGTAATGTGCTCTGCGGCGTTATTCGGGGTGCTTTAGAGATGATTCAGATGCAAGTTCAAGCAGAATTC
CTTTCAGATGTTCTTCGTGGAGATGAGACCACCGAGATTCGTGTAAAGCTAGTAAAATATCTAGAGGAGGAGGTC
CCTGTTGGAGATGATTAG
Gene >Agabi119p4|055820
ATGGCGACAAAGAATTTCAAGAGCATCGGTGAAGACCTTTGGAAAAGTCGAACAGAAAAAATCGTAAGATTATAC
TTCAACTGCTCTACTCTTTCATCTAACTCACACAGAATGCAGAGCTATTCGCACTTACCTATGGCGCCTTGGTAG
TCCAACTCATCCAGGATTATGAGGACTATGACCAAGTCAATAAAGAGCTTGAGAAGATGGGATACAACATCGGCA
CGCGTCTCATCGAAGACTTCCTGGCAAAGTCGAATGTGAGTCGGTGCGCAGATTTTAGGGAAACAGGCGAGGTTG
TCGCGAAAGTAAGTCAATTCACTGTCTATAAGTGCTGTCATTCTAGATGCTCTCTCTTTCAGGTAGGATTCAAGG
CCTTCCTGAACATCACACCTACTATTACACATGGCGCTCTTCTACCGCCTGCCTCTCCGAGGCCAGATTCAACCG
GTGGACAACCACCTGCGGGATCGTGGTTCACGCTCACTCTCGACGATAATCCTCTAGCGGAATTTGTTGAATTGC
CCGATGAAGTACTGGAGGGCGGCCTTTGGTTCAGTAATGTGCTCTGCGGCGTTATTCGGGGTGCTTTAGAGATGG
TATTTTTTTTACTCTTGCTGCTCATGCAACTTACCAACTCTCCTTGTCAGATTCAGATGCAAGTTCAAGCAGAAT
TCCTTTCAGATGTTCTTCGTGGAGATGAGACCACCGAGATTCGTGTAAAGCTAGTAAAATATCTAGAGGAGGAGG
TCCCTGTTGGAGATGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail