Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|055790
Gene name
Locationscaffold_03a:808268..809536
Strand-
Gene length (bp)1268
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04921 XAP5 XAP5, circadian clock regulator 4.4E-83 100 322

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VAY7|FAM50_DROME Protein FAM50 homolog OS=Drosophila melanogaster GN=CG12259 PE=2 SV=1 8 323 3.0E-101
sp|Q299F9|FAM50_DROPS Protein FAM50 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA11514 PE=3 SV=1 44 323 2.0E-100
sp|Q7PYQ5|FAM50_ANOGA Protein FAM50 homolog OS=Anopheles gambiae GN=AGAP002062 PE=3 SV=2 7 323 5.0E-98
sp|Q16U25|FAM50_AEDAE Protein FAM50 homolog OS=Aedes aegypti GN=AAEL010045 PE=3 SV=1 7 323 8.0E-97
sp|Q9WV03|FA50A_MOUSE Protein FAM50A OS=Mus musculus GN=Fam50a PE=1 SV=1 7 323 1.0E-93
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VAY7|FAM50_DROME Protein FAM50 homolog OS=Drosophila melanogaster GN=CG12259 PE=2 SV=1 8 323 3.0E-101
sp|Q299F9|FAM50_DROPS Protein FAM50 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA11514 PE=3 SV=1 44 323 2.0E-100
sp|Q7PYQ5|FAM50_ANOGA Protein FAM50 homolog OS=Anopheles gambiae GN=AGAP002062 PE=3 SV=2 7 323 5.0E-98
sp|Q16U25|FAM50_AEDAE Protein FAM50 homolog OS=Aedes aegypti GN=AAEL010045 PE=3 SV=1 7 323 8.0E-97
sp|Q9WV03|FA50A_MOUSE Protein FAM50A OS=Mus musculus GN=Fam50a PE=1 SV=1 7 323 1.0E-93
sp|Q14320|FA50A_HUMAN Protein FAM50A OS=Homo sapiens GN=FAM50A PE=1 SV=2 7 323 4.0E-93
sp|Q4KLV7|F50AB_XENLA Protein FAM50A-B OS=Xenopus laevis GN=fam50a-b PE=2 SV=1 7 323 1.0E-91
sp|Q2VPH1|F50AA_XENLA Protein FAM50A-A OS=Xenopus laevis GN=fam50a-a PE=2 SV=1 7 323 4.0E-90
sp|Q9WTJ8|FA50B_MOUSE Protein FAM50B OS=Mus musculus GN=Fam50b PE=2 SV=1 7 323 8.0E-90
sp|Q28BK4|FA50A_XENTR Protein FAM50A OS=Xenopus tropicalis GN=fam50a PE=2 SV=2 7 323 1.0E-89
sp|Q568K9|FA50A_DANRE Protein FAM50A OS=Danio rerio GN=fam50a PE=2 SV=1 7 323 2.0E-87
sp|Q69JZ7|XCT_ORYSJ Protein XAP5 CIRCADIAN TIMEKEEPER OS=Oryza sativa subsp. japonica GN=XCT PE=2 SV=1 8 324 9.0E-84
sp|B8BDW1|XCT_ORYSI Protein XAP5 CIRCADIAN TIMEKEEPER OS=Oryza sativa subsp. indica GN=XCT PE=3 SV=1 8 324 9.0E-84
sp|Q8H110|XCT_ARATH Protein XAP5 CIRCADIAN TIMEKEEPER OS=Arabidopsis thaliana GN=XCT PE=1 SV=1 8 324 1.0E-83
sp|Q4R846|FA50B_MACFA Protein FAM50B OS=Macaca fascicularis GN=FAM50B PE=2 SV=1 7 323 2.0E-82
sp|Q9Y247|FA50B_HUMAN Protein FAM50B OS=Homo sapiens GN=FAM50B PE=1 SV=1 7 323 2.0E-82
sp|A8WXX7|FAM50_CAEBR Protein FAM50 homolog OS=Caenorhabditis briggsae GN=CBG04561 PE=3 SV=1 14 320 1.0E-74
sp|Q18691|FAM50_CAEEL Protein FAM50 homolog OS=Caenorhabditis elegans GN=C47E8.4 PE=3 SV=3 14 320 2.0E-74
sp|Q54S94|FAM50_DICDI Protein FAM50 homolog OS=Dictyostelium discoideum GN=fam50 PE=3 SV=1 147 323 1.0E-71
sp|Q7LKZ5|FAM50_SCHPO FAM50 family protein C1020.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=xap5 PE=3 SV=2 51 319 3.0E-45
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0043229 intracellular organelle No
GO:0043227 membrane-bounded organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0043226 organelle No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|055790
MATNKMEGRREDALVKQRLQAREEFERQKQNLINETEKARPSTNRFVGQNDSMEESLKNSTIGLVKLEEFQQKRK
ELEEQKLREAARTNELKDGARKVKKRKKVAKATLSFALEDEESEEFGSRERSSKEKEDEENAPPTKRSRSHKNPD
VDTSFLPDREREEAERRERERLRVEWLTKQEQMKQEDIEITYSYWDGSGHRKSVVCKKGDDVATFLEKCRQQFPE
LRGISVDNLMYIKEDLIIPHQYTFYDFLVNKARGKSGPLFNFDVHDDVRLLADATREKDESHAGKVVERGWYQRN
KHIFPASRWEVFDPEKSYGKYTIH*
Coding >Agabi119p4|055790
ATGGCTACAAACAAGATGGAAGGTCGCAGAGAGGATGCGCTAGTCAAACAGCGCCTTCAAGCCCGCGAAGAATTT
GAACGCCAGAAACAAAATCTTATCAATGAGACCGAAAAAGCACGCCCATCCACCAATCGTTTTGTCGGTCAGAAT
GATTCTATGGAAGAGTCTCTCAAGAACAGCACCATTGGCCTGGTGAAACTCGAAGAATTTCAACAGAAGCGCAAA
GAACTCGAGGAACAAAAGCTCCGGGAAGCGGCGCGCACCAATGAACTCAAAGATGGCGCAAGGAAAGTCAAGAAA
CGTAAAAAGGTTGCCAAGGCTACTCTTTCCTTTGCATTAGAGGACGAGGAGAGCGAAGAATTCGGATCTCGAGAA
AGGTCTTCGAAAGAGAAGGAGGACGAAGAGAATGCTCCTCCTACCAAACGCAGTCGCTCTCACAAGAATCCCGAT
GTAGATACTTCGTTTCTTCCGGATCGTGAGCGCGAAGAGGCTGAACGGCGGGAGCGGGAGCGACTGCGAGTGGAA
TGGCTCACAAAGCAGGAGCAGATGAAGCAGGAAGACATTGAAATTACTTACTCTTACTGGGATGGCAGCGGTCAC
CGCAAAAGTGTAGTGTGCAAAAAGGGCGACGACGTTGCAACTTTCCTCGAAAAATGCCGACAACAATTTCCAGAG
CTACGGGGTATCAGCGTTGACAACCTCATGTATATCAAAGAGGATCTCATCATACCGCATCAATACACCTTCTAC
GACTTCCTCGTCAATAAAGCAAGGGGAAAATCAGGACCTTTGTTTAATTTCGACGTCCATGATGATGTTCGCCTT
TTAGCCGATGCCACTAGAGAGAAAGATGAATCGCACGCTGGTAAGGTCGTAGAGCGAGGTTGGTACCAACGTAAC
AAACATATTTTTCCCGCGTCGCGGTGGGAGGTCTTTGATCCAGAGAAAAGCTATGGAAAATATACTATTCACTGA
Transcript >Agabi119p4|055790
ATGGCTACAAACAAGATGGAAGGTCGCAGAGAGGATGCGCTAGTCAAACAGCGCCTTCAAGCCCGCGAAGAATTT
GAACGCCAGAAACAAAATCTTATCAATGAGACCGAAAAAGCACGCCCATCCACCAATCGTTTTGTCGGTCAGAAT
GATTCTATGGAAGAGTCTCTCAAGAACAGCACCATTGGCCTGGTGAAACTCGAAGAATTTCAACAGAAGCGCAAA
GAACTCGAGGAACAAAAGCTCCGGGAAGCGGCGCGCACCAATGAACTCAAAGATGGCGCAAGGAAAGTCAAGAAA
CGTAAAAAGGTTGCCAAGGCTACTCTTTCCTTTGCATTAGAGGACGAGGAGAGCGAAGAATTCGGATCTCGAGAA
AGGTCTTCGAAAGAGAAGGAGGACGAAGAGAATGCTCCTCCTACCAAACGCAGTCGCTCTCACAAGAATCCCGAT
GTAGATACTTCGTTTCTTCCGGATCGTGAGCGCGAAGAGGCTGAACGGCGGGAGCGGGAGCGACTGCGAGTGGAA
TGGCTCACAAAGCAGGAGCAGATGAAGCAGGAAGACATTGAAATTACTTACTCTTACTGGGATGGCAGCGGTCAC
CGCAAAAGTGTAGTGTGCAAAAAGGGCGACGACGTTGCAACTTTCCTCGAAAAATGCCGACAACAATTTCCAGAG
CTACGGGGTATCAGCGTTGACAACCTCATGTATATCAAAGAGGATCTCATCATACCGCATCAATACACCTTCTAC
GACTTCCTCGTCAATAAAGCAAGGGGAAAATCAGGACCTTTGTTTAATTTCGACGTCCATGATGATGTTCGCCTT
TTAGCCGATGCCACTAGAGAGAAAGATGAATCGCACGCTGGTAAGGTCGTAGAGCGAGGTTGGTACCAACGTAAC
AAACATATTTTTCCCGCGTCGCGGTGGGAGGTCTTTGATCCAGAGAAAAGCTATGGAAAATATACTATTCACTGA
Gene >Agabi119p4|055790
ATGGCTACAAACAAGATGGAAGGTCGCAGAGAGGATGCGCTAGTCAAACAGCGCCTTCAAGCCCGCGAAGAATTT
GAACGCCAGAAACAAAATCTTATCAATGAGACCGAAAAAGCACGCCCATCCACCAATCGTTTTGTCGGTCAGAAT
GATTCTATGGAAGAGTCTCTCAAGAACAGCACCATTGGCCTGGTGAAACTCGAAGAATTTCAACAGAAGCGCAAA
GAACTCGAGGAACAAAAGCTCCGGGAAGCGGCGCGCACCAATGAACTCAAGTATGTCTCCCTCTTCCGTTGGCGA
CTCTTCATTCCGGTCGTCAAAAGTGTCATCACTTACAGTGTATGGAGAATACGTTTAGAGATGGCGCAAGGAAAG
TCAAGAAACGTAAAAAGGTTGCCAAGGCTACTCTTTCCTTTGCATTAGAGGACGAGGAGAGCGAAGAATTCGGAT
CTCGAGAAAGGTCTTCGAAAGAGAAGGAGGACGAAGAGAATGCTCCTCCTACCAAACGCAGTCGCTCTCACAAGA
ATCCCGATGTAGATACTTCGTTTCTTCCGGATCGTGAGCGCGAAGAGGCTGAACGGCGGGAGCGGGAGCGACTGC
GAGTGGAATGGCTCACAAAGCAGGAGCAGATGAAGCAGGAAGACATTGAAATTACTTACTCTTACTGGGATGGCA
GCGGTCACCGCAAAAGTGTAGTGGTGGGTAGACTTCTGCTATCCTCAAATCTTATACTAACACCGGCAATCTCAG
TGCAAAAAGGGCGACGACGTTGCAACTTTCCTCGAAAAATGCCGACAACAATTTCCAGAGCTACGGGGTATCAGC
GTTGACAACCTCATGTATATCAAAGTATGTAATGTTCATTCCATGATAGTAGCAGTTCCATTAACGCACCTCCAG
GAGGATCTCATCATACCGCATGTATGTTGGATCATTCACTAAATTTTGCTTCACGCTTACCAATGTTTATAGCAA
TACACCTTCTACGACTTCCTCGTCAATAAAGCAAGGGGAAAATCAGGACCTTTGTTTAATTTCGACGTCCATGAT
GATGTTCGCCTTTTAGCCGATGCCACTAGAGAGAAAGATGAATCGCACGCTGGTAAGGTCGTAGAGCGAGGTTGG
TACCAACGTAACAAACATATTTTTCCCGCGTCGCGGTGGGAGGTAGGTCTTTTTATATATCAAACCTTTATCGGA
TCTGTCACTAAAAATCTTCATAGGTCTTTGATCCAGAGAAAAGCTATGGAAAATATACTATTCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail