Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|055760
Gene name
Locationscaffold_03a:804279..805007
Strand+
Gene length (bp)728
Transcript length (bp)408
Coding sequence length (bp)408
Protein length (aa) 136

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16906 Ribosomal_L26 Ribosomal proteins L26 eukaryotic, L24P archaeal 1.5E-36 8 121
PF00467 KOW KOW motif 2.6E-09 51 82

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FJX2|RL262_ARATH 60S ribosomal protein L26-2 OS=Arabidopsis thaliana GN=RPL26B PE=2 SV=1 1 128 6.0E-57
sp|P51414|RL261_ARATH 60S ribosomal protein L26-1 OS=Arabidopsis thaliana GN=RPL26A PE=2 SV=2 1 128 2.0E-55
sp|P61256|RL26_MACFA 60S ribosomal protein L26 OS=Macaca fascicularis GN=RPL26 PE=2 SV=1 1 121 9.0E-54
sp|P61255|RL26_MOUSE 60S ribosomal protein L26 OS=Mus musculus GN=Rpl26 PE=1 SV=1 1 121 9.0E-54
sp|P61257|RL26_BOVIN 60S ribosomal protein L26 OS=Bos taurus GN=RPL26 PE=2 SV=1 1 121 9.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FJX2|RL262_ARATH 60S ribosomal protein L26-2 OS=Arabidopsis thaliana GN=RPL26B PE=2 SV=1 1 128 6.0E-57
sp|P51414|RL261_ARATH 60S ribosomal protein L26-1 OS=Arabidopsis thaliana GN=RPL26A PE=2 SV=2 1 128 2.0E-55
sp|P61256|RL26_MACFA 60S ribosomal protein L26 OS=Macaca fascicularis GN=RPL26 PE=2 SV=1 1 121 9.0E-54
sp|P61255|RL26_MOUSE 60S ribosomal protein L26 OS=Mus musculus GN=Rpl26 PE=1 SV=1 1 121 9.0E-54
sp|P61257|RL26_BOVIN 60S ribosomal protein L26 OS=Bos taurus GN=RPL26 PE=2 SV=1 1 121 9.0E-54
sp|P61254|RL26_HUMAN 60S ribosomal protein L26 OS=Homo sapiens GN=RPL26 PE=1 SV=1 1 121 9.0E-54
sp|Q9UNX3|RL26L_HUMAN 60S ribosomal protein L26-like 1 OS=Homo sapiens GN=RPL26L1 PE=1 SV=1 1 121 2.0E-53
sp|P12749|RL26_RAT 60S ribosomal protein L26 OS=Rattus norvegicus GN=Rpl26 PE=1 SV=1 1 121 2.0E-52
sp|Q2I0I6|RL26_AILME 60S ribosomal protein L26 OS=Ailuropoda melanoleuca GN=RPL26 PE=2 SV=1 1 121 3.0E-50
sp|Q95WA0|RL26_LITLI 60S ribosomal protein L26 OS=Littorina littorea GN=RPL26 PE=2 SV=1 1 121 1.0E-49
sp|Q39411|RL26_BRACM 60S ribosomal protein L26 OS=Brassica campestris GN=RPL26 PE=2 SV=1 1 128 6.0E-49
sp|P47832|RL26_CHICK 60S ribosomal protein L26 (Fragment) OS=Gallus gallus GN=RPL26 PE=2 SV=1 18 121 5.0E-47
sp|Q19869|RL26_CAEEL 60S ribosomal protein L26 OS=Caenorhabditis elegans GN=rpl-26 PE=3 SV=1 1 121 1.0E-46
sp|P78946|RL26_SCHPO 60S ribosomal protein L26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl26 PE=3 SV=1 1 121 2.0E-45
sp|Q54QM8|RL26_DICDI 60S ribosomal protein L26 OS=Dictyostelium discoideum GN=rpl26 PE=3 SV=1 1 123 2.0E-45
sp|Q23F79|RL26_TETTS 60S ribosomal protein L26 OS=Tetrahymena thermophila (strain SB210) GN=RPL26 PE=1 SV=2 1 121 2.0E-45
sp|P05743|RL26A_YEAST 60S ribosomal protein L26-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL26A PE=1 SV=3 2 121 6.0E-44
sp|P53221|RL26B_YEAST 60S ribosomal protein L26-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL26B PE=1 SV=2 2 121 8.0E-44
sp|O59429|RL24_PYRHO 50S ribosomal protein L24P OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl24p PE=3 SV=2 1 115 2.0E-25
sp|Q9V1U7|RL24_PYRAB 50S ribosomal protein L24P OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl24p PE=3 SV=1 8 121 5.0E-25
sp|Q8U010|RL24_PYRFU 50S ribosomal protein L24P OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl24p PE=1 SV=2 8 121 5.0E-25
sp|B1L777|RL24_KORCO 50S ribosomal protein L24P OS=Korarchaeum cryptofilum (strain OPF8) GN=rpl24p PE=3 SV=1 13 121 4.0E-24
sp|Q5JJF9|RL24_THEKO 50S ribosomal protein L24P OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl24p PE=3 SV=1 12 121 5.0E-24
sp|O26122|RL24_METTH 50S ribosomal protein L24P OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl24p PE=3 SV=1 7 121 9.0E-24
sp|P54038|RL24_METJA 50S ribosomal protein L24P OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl24p PE=3 SV=1 8 115 1.0E-23
sp|Q8TW19|RL24_METKA 50S ribosomal protein L24P OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl24p PE=3 SV=1 8 120 1.0E-23
sp|Q9YF83|RL24_AERPE 50S ribosomal protein L24P OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl24p PE=3 SV=1 5 119 6.0E-22
sp|Q2NFW8|RL24_METST 50S ribosomal protein L24P OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl24p PE=3 SV=1 7 115 1.0E-21
sp|A2BMD0|RL24_HYPBU 50S ribosomal protein L24P OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl24p PE=3 SV=1 8 125 2.0E-21
sp|Q46GA6|RL24_METBF 50S ribosomal protein L24P OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl24p PE=3 SV=1 7 116 6.0E-21
sp|A3DNB8|RL24_STAMF 50S ribosomal protein L24P OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl24p PE=3 SV=1 8 121 6.0E-21
sp|A6VGZ6|RL24_METM7 50S ribosomal protein L24P OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl24p PE=3 SV=1 8 112 1.0E-20
sp|A4FWB0|RL24_METM5 50S ribosomal protein L24P OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl24p PE=3 SV=1 8 112 1.0E-20
sp|A6UQ55|RL24_METVS 50S ribosomal protein L24P OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl24p PE=3 SV=1 8 115 2.0E-20
sp|P14034|RL24_METVA 50S ribosomal protein L24P OS=Methanococcus vannielii GN=rpl24p PE=3 SV=1 8 115 2.0E-20
sp|A0B9V9|RL24_METTP 50S ribosomal protein L24P OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl24p PE=3 SV=1 7 115 3.0E-20
sp|A6UWU9|RL24_META3 50S ribosomal protein L24P OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl24p PE=3 SV=1 7 115 4.0E-20
sp|Q8PV39|RL24_METMA 50S ribosomal protein L24P OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl24p PE=3 SV=1 7 116 4.0E-20
sp|Q8TRT6|RL24_METAC 50S ribosomal protein L24P OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl24p PE=3 SV=1 7 116 5.0E-20
sp|A8ACD3|RL24_IGNH4 50S ribosomal protein L24P OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl24p PE=3 SV=1 13 123 6.0E-20
sp|Q6LXE2|RL24_METMP 50S ribosomal protein L24P OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl24p PE=3 SV=1 8 115 1.0E-19
sp|A3MWZ8|RL24_PYRCJ 50S ribosomal protein L24P OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl24p PE=3 SV=1 8 128 1.0E-19
sp|Q8ZTD4|RL24_PYRAE 50S ribosomal protein L24P OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl24p PE=3 SV=1 8 124 5.0E-19
sp|A4WLL3|RL24_PYRAR 50S ribosomal protein L24P OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl24p PE=3 SV=1 8 121 8.0E-19
sp|A1RWS4|RL24_THEPD 50S ribosomal protein L24P OS=Thermofilum pendens (strain Hrk 5) GN=rpl24p PE=3 SV=1 8 129 4.0E-18
sp|Q2FT34|RL24_METHJ 50S ribosomal protein L24P OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl24p PE=3 SV=1 7 115 2.0E-17
sp|A5UL77|RL24_METS3 50S ribosomal protein L24P OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl24p PE=3 SV=1 7 103 3.0E-17
sp|O28365|RL24_ARCFU 50S ribosomal protein L24P OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl24p PE=3 SV=1 5 120 4.0E-17
sp|A8MB21|RL24_CALMQ 50S ribosomal protein L24P OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl24p PE=3 SV=1 8 134 1.0E-16
sp|A3CT08|RL24_METMJ 50S ribosomal protein L24P OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl24p PE=3 SV=1 7 110 6.0E-15
sp|P41960|RL26_BRUPA 60S ribosomal protein L26 (Fragment) OS=Brugia pahangi PE=2 SV=1 1 60 8.0E-15
sp|Q12ZU0|RL24_METBU 50S ribosomal protein L24P OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl24p PE=3 SV=1 7 120 9.0E-15
sp|O05633|RL24_SULAC 50S ribosomal protein L24P OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl24p PE=3 SV=2 7 121 2.0E-14
sp|P10972|RL24_HALMA 50S ribosomal protein L24P OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl24p PE=1 SV=3 1 122 2.0E-13
sp|A9A5I4|RL24_NITMS 50S ribosomal protein L24P OS=Nitrosopumilus maritimus (strain SCM1) GN=rpl24p PE=3 SV=1 19 125 1.0E-12
sp|A1RS05|RL24_PYRIL 50S ribosomal protein L24P OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl24p PE=3 SV=1 12 124 2.0E-12
sp|Q975J1|RL24_SULTO 50S ribosomal protein L24P OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl24p PE=3 SV=2 7 121 3.0E-12
sp|Q9UX95|RL24_SULSO 50S ribosomal protein L24P OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl24p PE=3 SV=1 7 120 3.0E-12
sp|A7I5Q0|RL24_METB6 50S ribosomal protein L24P OS=Methanoregula boonei (strain 6A8) GN=rpl24p PE=3 SV=1 8 116 5.0E-12
sp|A4YCX7|RL24_METS5 50S ribosomal protein L24P OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpl24p PE=3 SV=1 34 129 5.0E-12
sp|P60663|RL24_NANEQ 50S ribosomal protein L24P OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl24p PE=3 SV=1 3 124 7.0E-11
sp|Q18GG0|RL24_HALWD 50S ribosomal protein L24P OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl24p PE=3 SV=1 7 124 1.0E-10
sp|Q0W1X7|RL24_METAR 50S ribosomal protein L24P OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rpl24p PE=3 SV=1 8 121 1.0E-10
sp|A2SPL3|RL24_METLZ 50S ribosomal protein L24P OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl24p PE=3 SV=1 8 121 2.0E-10
sp|Q6L1B6|RL24_PICTO 50S ribosomal protein L24P OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl24p PE=3 SV=1 34 115 1.0E-08
sp|Q3IMX7|RL24_NATPD 50S ribosomal protein L24P OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl24p PE=3 SV=1 26 122 2.0E-08
sp|A0RVY4|RL24_CENSY 50S ribosomal protein L24P OS=Cenarchaeum symbiosum (strain A) GN=rpl24p PE=3 SV=1 19 108 3.0E-08
sp|Q97BW5|RL24_THEVO 50S ribosomal protein L24P OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl24p PE=3 SV=1 30 115 1.0E-07
sp|P49629|RL26_XENLA 60S ribosomal protein L26 (Fragment) OS=Xenopus laevis GN=rpl26 PE=2 SV=1 22 54 3.0E-07
sp|P60746|RL24_THEAC 50S ribosomal protein L24P OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl24p PE=3 SV=1 30 115 6.0E-07
sp|Q9HPC3|RL24_HALSA 50S ribosomal protein L24P OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl24p PE=3 SV=1 34 115 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0015934 large ribosomal subunit Yes
GO:0006412 translation Yes
GO:0003735 structural constituent of ribosome Yes
GO:0006807 nitrogen compound metabolic process No
GO:0009058 biosynthetic process No
GO:0019538 protein metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0032991 protein-containing complex No
GO:0044249 cellular biosynthetic process No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:1901564 organonitrogen compound metabolic process No
GO:0009987 cellular process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044391 ribosomal subunit No
GO:0043043 peptide biosynthetic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006518 peptide metabolic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:1990904 ribonucleoprotein complex No
GO:0005198 structural molecule activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|055760
MKYNPDVSSSRRKCRKAHFAAPSSIRRKIMSSGLSKELKARHNTRSLPIRKDDEVRIVRGKYKGREGKVTQVYRK
KWVIHVDRVQRDKSNGATVPIGIHPSNVVITTIKLDKDRRAILEKKDRKKTASGDVEMVD*
Coding >Agabi119p4|055760
ATGAAATACAACCCCGATGTCTCCTCATCGCGGCGCAAGTGCCGCAAGGCCCACTTCGCTGCGCCTTCCTCCATT
CGACGCAAGATCATGTCCTCTGGCCTCTCAAAAGAACTCAAAGCTCGACACAATACCCGTTCACTTCCCATTCGC
AAAGATGATGAAGTTCGGATCGTTAGGGGCAAGTACAAGGGGCGAGAGGGAAAGGTTACACAGGTATATCGCAAG
AAATGGGTGATCCATGTAGACCGTGTTCAGCGTGACAAGTCAAATGGTGCAACCGTCCCCATCGGCATCCACCCT
AGCAATGTTGTGATTACAACGATCAAACTAGACAAAGATCGCCGGGCAATTCTTGAGAAGAAGGACAGGAAGAAG
ACCGCTTCCGGTGATGTTGAGATGGTTGACTGA
Transcript >Agabi119p4|055760
ATGAAATACAACCCCGATGTCTCCTCATCGCGGCGCAAGTGCCGCAAGGCCCACTTCGCTGCGCCTTCCTCCATT
CGACGCAAGATCATGTCCTCTGGCCTCTCAAAAGAACTCAAAGCTCGACACAATACCCGTTCACTTCCCATTCGC
AAAGATGATGAAGTTCGGATCGTTAGGGGCAAGTACAAGGGGCGAGAGGGAAAGGTTACACAGGTATATCGCAAG
AAATGGGTGATCCATGTAGACCGTGTTCAGCGTGACAAGTCAAATGGTGCAACCGTCCCCATCGGCATCCACCCT
AGCAATGTTGTGATTACAACGATCAAACTAGACAAAGATCGCCGGGCAATTCTTGAGAAGAAGGACAGGAAGAAG
ACCGCTTCCGGTGATGTTGAGATGGTTGACTGA
Gene >Agabi119p4|055760
ATGAAATACAACCCCGGTATGTCATAAGTCTGTTCTGTCGTTCCTGTGCGTATCTCGCATCTCCCGGTTGAACGA
TGAAATTTGGCAAAGTACTGGGCTGGATGCTGCATAGGAACTGTGGATGACTTTCTCCCACAGAAAATACGCTAA
TATACTTGTACCATGGCAGATGTCTCCTCATCGCGGCGCAAGTGCCGCAAGGCCCACTTCGCTGCGCCTTCCTCC
ATTCGACGCAAGATCATGTCCTCTGGCCTCTCAAAAGAACTCAAAGCTCGACACAATGTCAGTGGATGTTTTAAT
CCAGCAAACACACCTACTGATATATTCATACATCCGGATCAGACCCGTTCACTTCCCATTCGCAAAGATGATGAA
GTTCGGATCGTTAGGGGCAAGTACAAGGGGCGAGAGGGAAAGGTTACACAGGTATATCGCAAGAAATGGGTGATC
CATGTAGACCGTGTTCAGCGTGACAAGTCAAATGGTGCAACCGTCCCCATCGGCATCCACCCTAGCAATGTTGTG
ATTACAACGATCAAACTAGACAAAGATCGGTATGCTCTCCCATTCCCGCCCGACAAGTCTCTCCTGATTATATTG
ACTCAGCCGGGCAATTCTTGAGAAGAAGGACAGGAAGAAGACCGCTTCCGGTGATGTTGAGATGGTTGACGTGCG
TTACTCCATCTTTTCTCTCTTCAATGTTGTGTTTACTTGAATTTTTTCAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail