Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|055480
Gene name
Locationscaffold_03a:739625..741220
Strand+
Gene length (bp)1595
Transcript length (bp)1248
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04389 Peptidase_M28 Peptidase family M28 1.6E-33 118 375

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CYK2|QPCT_MOUSE Glutaminyl-peptide cyclotransferase OS=Mus musculus GN=Qpct PE=1 SV=2 68 383 2.0E-69
sp|Q16769|QPCT_HUMAN Glutaminyl-peptide cyclotransferase OS=Homo sapiens GN=QPCT PE=1 SV=1 68 383 6.0E-68
sp|Q90YA8|QPCT_GLOBL Glutaminyl-peptide cyclotransferase OS=Gloydius blomhoffii GN=QPCT PE=2 SV=1 11 383 1.0E-66
sp|A7ISW1|QPCT_BOIIR Glutaminyl-peptide cyclotransferase OS=Boiga irregularis GN=QPCT PE=2 SV=1 11 383 2.0E-66
sp|Q0V8G3|QPCTL_BOVIN Glutaminyl-peptide cyclotransferase-like protein OS=Bos taurus GN=QPCTL PE=2 SV=1 56 383 4.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9CYK2|QPCT_MOUSE Glutaminyl-peptide cyclotransferase OS=Mus musculus GN=Qpct PE=1 SV=2 68 383 2.0E-69
sp|Q16769|QPCT_HUMAN Glutaminyl-peptide cyclotransferase OS=Homo sapiens GN=QPCT PE=1 SV=1 68 383 6.0E-68
sp|Q90YA8|QPCT_GLOBL Glutaminyl-peptide cyclotransferase OS=Gloydius blomhoffii GN=QPCT PE=2 SV=1 11 383 1.0E-66
sp|A7ISW1|QPCT_BOIIR Glutaminyl-peptide cyclotransferase OS=Boiga irregularis GN=QPCT PE=2 SV=1 11 383 2.0E-66
sp|Q0V8G3|QPCTL_BOVIN Glutaminyl-peptide cyclotransferase-like protein OS=Bos taurus GN=QPCTL PE=2 SV=1 56 383 4.0E-66
sp|A7ISW2|QPCT_BOIDE Glutaminyl-peptide cyclotransferase OS=Boiga dendrophila GN=QPCT PE=2 SV=1 11 383 4.0E-66
sp|Q8BH73|QPCTL_MOUSE Glutaminyl-peptide cyclotransferase-like protein OS=Mus musculus GN=Qpctl PE=1 SV=1 56 383 2.0E-64
sp|Q28120|QPCT_BOVIN Glutaminyl-peptide cyclotransferase OS=Bos taurus GN=QPCT PE=1 SV=1 68 383 5.0E-64
sp|Q9YIB5|QPCT_BOTJA Glutaminyl-peptide cyclotransferase OS=Bothrops jararaca GN=QPCT PE=2 SV=1 68 383 8.0E-63
sp|Q4R942|QPCTL_MACFA Glutaminyl-peptide cyclotransferase-like protein OS=Macaca fascicularis GN=QPCTL PE=2 SV=1 56 383 5.0E-61
sp|Q9NXS2|QPCTL_HUMAN Glutaminyl-peptide cyclotransferase-like protein OS=Homo sapiens GN=QPCTL PE=1 SV=2 56 383 1.0E-59
sp|Q54B14|QPCT_DICDI Glutaminyl-peptide cyclotransferase OS=Dictyostelium discoideum GN=qpct PE=3 SV=1 14 381 4.0E-57
sp|P43599|YFI8_YEAST Uncharacterized protein YFR018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFR018C PE=1 SV=1 57 386 2.0E-41
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|055480
MPSWLFGCCRVSLFCALWCLASTFLSLQASVLGERDLPQLSSDELSVLVTGVPDPIHKLDPANPNSHLSKILIPR
APGTENITLVRNYIVSTLKNLNWEVEVDEFTDETPIGKKRFANIIATKDPSASRRLVLSAHYDSKWFPDYPQNQF
VGATDSAAPCAFMLDIAETLNPLLEDRIKRFEEGLIEEDDDDDIDDMTLQLVFFDGEEAFHSWTDTDSIYGARHL
AQKWARTYRQHTKRRLLSVQETEISAVEHLILLDLLGAPNPLIKSYFADTRWMFDALVRIEQRLGDSGAFEYGEE
KSMAPDSWQSWFLSRQNMNLGFGYLGDDHVPFLRQGVSVLHVIADPFPKVWHKLGDDRAALDLPTMRRWSLLLRV
FLSEYLHLRPEVSGKGAESPSENLTPQPESHRYDKNISDL*
Coding >Agabi119p4|055480
ATGCCTTCGTGGCTCTTTGGCTGTTGTCGAGTGTCCCTGTTCTGTGCGTTATGGTGCCTGGCGAGCACCTTCCTG
TCATTGCAAGCGTCTGTGCTCGGAGAACGCGACCTACCACAGCTGTCTTCCGATGAGCTTTCTGTACTTGTGACT
GGAGTGCCCGACCCTATCCACAAGTTGGACCCGGCCAATCCAAACTCCCACCTCTCCAAAATTCTTATACCCCGA
GCCCCTGGCACCGAAAACATTACCTTAGTTAGAAACTACATCGTGTCAACTCTCAAAAATCTCAATTGGGAGGTC
GAAGTAGATGAATTCACTGACGAGACTCCCATTGGAAAGAAGCGCTTCGCGAATATCATTGCTACCAAGGATCCC
TCTGCGTCTCGTCGACTTGTTCTATCCGCTCATTATGATAGCAAGTGGTTTCCGGACTATCCTCAAAATCAGTTT
GTTGGTGCAACAGATTCTGCAGCACCCTGTGCATTCATGCTGGACATTGCAGAAACTCTTAATCCACTTTTGGAA
GACCGTATAAAGCGTTTTGAAGAGGGATTAATTGAGGAAGACGATGACGATGACATTGACGATATGACTCTGCAA
CTCGTATTCTTCGACGGAGAGGAGGCTTTTCATAGCTGGACGGACACAGATTCCATCTATGGTGCGCGACACCTT
GCACAAAAATGGGCACGAACCTATCGCCAACACACGAAGCGACGTCTATTGAGCGTACAGGAAACTGAAATATCT
GCCGTAGAACACCTAATTCTTCTCGATCTTCTCGGGGCGCCTAATCCACTTATTAAATCATACTTTGCCGACACT
AGATGGATGTTTGATGCCCTTGTTCGTATCGAGCAGCGACTTGGGGATAGCGGCGCTTTCGAATACGGAGAGGAA
AAATCTATGGCTCCAGATTCATGGCAAAGCTGGTTTCTCTCGCGCCAAAATATGAATCTAGGGTTTGGCTATCTC
GGTGATGATCATGTTCCATTCCTACGCCAAGGTGTTAGTGTGTTACATGTCATCGCTGACCCTTTCCCCAAAGTA
TGGCATAAATTGGGGGATGATAGGGCTGCTCTGGACCTCCCGACCATGCGCCGCTGGTCCCTCCTTCTCCGGGTT
TTCTTATCGGAGTACTTGCACTTACGCCCAGAGGTATCCGGAAAGGGAGCAGAGTCGCCTTCTGAAAACTTAACG
CCACAACCGGAGTCCCATCGATATGACAAAAACATCTCGGATTTGTAG
Transcript >Agabi119p4|055480
ATGCCTTCGTGGCTCTTTGGCTGTTGTCGAGTGTCCCTGTTCTGTGCGTTATGGTGCCTGGCGAGCACCTTCCTG
TCATTGCAAGCGTCTGTGCTCGGAGAACGCGACCTACCACAGCTGTCTTCCGATGAGCTTTCTGTACTTGTGACT
GGAGTGCCCGACCCTATCCACAAGTTGGACCCGGCCAATCCAAACTCCCACCTCTCCAAAATTCTTATACCCCGA
GCCCCTGGCACCGAAAACATTACCTTAGTTAGAAACTACATCGTGTCAACTCTCAAAAATCTCAATTGGGAGGTC
GAAGTAGATGAATTCACTGACGAGACTCCCATTGGAAAGAAGCGCTTCGCGAATATCATTGCTACCAAGGATCCC
TCTGCGTCTCGTCGACTTGTTCTATCCGCTCATTATGATAGCAAGTGGTTTCCGGACTATCCTCAAAATCAGTTT
GTTGGTGCAACAGATTCTGCAGCACCCTGTGCATTCATGCTGGACATTGCAGAAACTCTTAATCCACTTTTGGAA
GACCGTATAAAGCGTTTTGAAGAGGGATTAATTGAGGAAGACGATGACGATGACATTGACGATATGACTCTGCAA
CTCGTATTCTTCGACGGAGAGGAGGCTTTTCATAGCTGGACGGACACAGATTCCATCTATGGTGCGCGACACCTT
GCACAAAAATGGGCACGAACCTATCGCCAACACACGAAGCGACGTCTATTGAGCGTACAGGAAACTGAAATATCT
GCCGTAGAACACCTAATTCTTCTCGATCTTCTCGGGGCGCCTAATCCACTTATTAAATCATACTTTGCCGACACT
AGATGGATGTTTGATGCCCTTGTTCGTATCGAGCAGCGACTTGGGGATAGCGGCGCTTTCGAATACGGAGAGGAA
AAATCTATGGCTCCAGATTCATGGCAAAGCTGGTTTCTCTCGCGCCAAAATATGAATCTAGGGTTTGGCTATCTC
GGTGATGATCATGTTCCATTCCTACGCCAAGGTGTTAGTGTGTTACATGTCATCGCTGACCCTTTCCCCAAAGTA
TGGCATAAATTGGGGGATGATAGGGCTGCTCTGGACCTCCCGACCATGCGCCGCTGGTCCCTCCTTCTCCGGGTT
TTCTTATCGGAGTACTTGCACTTACGCCCAGAGGTATCCGGAAAGGGAGCAGAGTCGCCTTCTGAAAACTTAACG
CCACAACCGGAGTCCCATCGATATGACAAAAACATCTCGGATTTGTAG
Gene >Agabi119p4|055480
ATGCCTTCGTGGCTCTTTGGCTGTTGTCGAGTGTCCCTGTTCTGTGCGTTATGGTGCCTGGCGAGCACCTTCCTG
TCATTGCAAGCGTCTGTGCTCGGAGAACGCGACCTACCACAGCTGTCTTCCGATGAGCTTTCTGTACTTGTGACT
GGAGTGCCCGACCCTATCCACAAGTTGGACCCGGCCAATCCAAACTCCCACCTCTCCAAAATTCTTATACCCCGA
GCCCGTGAGTTGCTGTGTTATCTCTCAAGGTTACTCCGAATTGAACCGGGCATACAGCTGGCACCGAAAACATTA
CCTTAGTTAGAAACTACATCGTGTCAACTCTCAAAAATCTCAATTGGGAGGTCGAAGTAGATGAATTCACTGACG
AGACTCCCATTGGAAAGAAGCGCTTCGCGAATATCATTGCTACCAAGGATCCCTCTGCGTCTCGTCGACTTGTTC
TATCCGCTCATTATGATAGCAAGTGGTTTCCGGACTATCCTCAAAATCAGGTTCGTGGTCAAAAATTCAAGCTTA
TGCATGCATGGCTCAAATATGCCTCCAGTTTGTTGGTGCAACAGATTCTGCAGCACCCTGTGCATTCATGCTGGA
CATTGCAGAAACTCTTAATCCACTTTTGGAAGACCGTATAAAGCGTTTTGAAGAGGGATTAATTGAGGAAGACGA
TGACGATGACATTGACGATATGACTCTGCAACTCGTATTCTTCGACGGAGAGGAGGCTTTTCATAGCTGGACGGA
CACAGATTCCATCTATGGTGCGCGGTATGGAATATTTATTCTCATCCGGGATTGAGACCTTTAGTGAACTTCTAA
AATCAGACACCTTGCACAAAAATGGGCACGAACCTATCGCCAACACACGAAGCGACGTCTATTGAGCGTACAGGA
AACTGAAATATCTGCCGTAGAACACCTAATTCTTCTCGATCTTCTCGGGGCGCCTAATCCACTTATTAAATCATA
CTTTGCCGACACTAGATGGATGTTTGATGCCCTTGTTCGTATCGAGCAGCGACTTGGGGATAGCGGCGCTTTCGA
ATACGGAGAGGAAAAATCTATGGCTCCAGATTCATGGCAAAGCTGGTTTCTCTCGCGCCAAAATATGAATCTAGG
GTTTGGCTATCTCGGTGATGATCATGTTCCATTCCTACGCCAAGGTGTTAGTGTGTTACATGTCATCGCTGACCC
TTTCCCCAAAGTATGGCATAAATTGGGGGTGAGCTACGGCACGCAGAGTCTCGAATTTTTTTCTAACATAGGCGT
TACTATAGGATGATAGGGCTGCTCTGGACCTCCCGACCATGCGCCGCTGGTCCCTCCTTCTCCGGGTTTTCTTAT
CGGAGTACTTGCACTTACGCCCAGAGGTATCCGGAAAGGGAGCAGAGTCGCCTTCTGAAAACTTAGTAAGTCGTA
TGACCGGTCTCTGGCCAATGTTGTATGTACTAACTAACACTAACCTCTACCCGAGCCAGACGCCACAACCGGAGT
CCCATCGATATGACAAAAACATCTCGGATTTGGTGAGAAACTTTCTACGGCCTTGAGTTTTGAGCTCTGAATCTG
ATTATTTCTTCGCCCAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail