Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|055410
Gene name
Locationscaffold_03a:730526..731280
Strand-
Gene length (bp)754
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 2.0E-37 7 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 7 201 4.0E-17
sp|Q12040|YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR283W PE=1 SV=1 6 94 8.0E-15
sp|Q9SCS3|PGML4_ARATH Phosphoglycerate mutase-like protein 4 OS=Arabidopsis thaliana GN=At3g50520 PE=2 SV=1 5 97 1.0E-14
sp|D3DFP8|PSPB_HYDTT Putative phosphoserine phosphatase 2 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspB PE=1 SV=1 6 203 3.0E-14
sp|P52086|COBC_ECOLI Adenosylcobalamin/alpha-ribazole phosphatase OS=Escherichia coli (strain K12) GN=cobC PE=3 SV=1 6 160 3.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O07617|PHOE_BACSU Uncharacterized phosphatase PhoE OS=Bacillus subtilis (strain 168) GN=phoE PE=3 SV=1 7 201 4.0E-17
sp|Q12040|YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR283W PE=1 SV=1 6 94 8.0E-15
sp|Q9SCS3|PGML4_ARATH Phosphoglycerate mutase-like protein 4 OS=Arabidopsis thaliana GN=At3g50520 PE=2 SV=1 5 97 1.0E-14
sp|D3DFP8|PSPB_HYDTT Putative phosphoserine phosphatase 2 OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=pspB PE=1 SV=1 6 203 3.0E-14
sp|P52086|COBC_ECOLI Adenosylcobalamin/alpha-ribazole phosphatase OS=Escherichia coli (strain K12) GN=cobC PE=3 SV=1 6 160 3.0E-14
sp|O94461|YFFL_SCHPO Probable phosphatase C1687.21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1687.21 PE=3 SV=1 6 201 1.0E-13
sp|Q4V7R0|TIGAR_XENLA Fructose-2,6-bisphosphatase TIGAR OS=Xenopus laevis GN=tigar PE=2 SV=1 9 94 1.0E-12
sp|B1WAX6|TIGAR_XENTR Fructose-2,6-bisphosphatase TIGAR OS=Xenopus tropicalis GN=tigar PE=2 SV=1 9 94 1.0E-12
sp|Q8BZA9|TIGAR_MOUSE Fructose-2,6-bisphosphatase TIGAR OS=Mus musculus GN=Tigar PE=1 SV=1 1 94 1.0E-12
sp|A9MR94|GPMB_SALAR Probable phosphoglycerate mutase GpmB OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gpmB PE=3 SV=1 6 160 1.0E-12
sp|Q57G26|GPMB_SALCH Probable phosphoglycerate mutase GpmB OS=Salmonella choleraesuis (strain SC-B67) GN=gpmB PE=3 SV=1 6 160 1.0E-12
sp|Q8ZJU8|GPMB_SALTY Probable phosphoglycerate mutase GpmB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|B4TU55|GPMB_SALSV Probable phosphoglycerate mutase GpmB OS=Salmonella schwarzengrund (strain CVM19633) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|A9N7F5|GPMB_SALPB Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|Q5PK44|GPMB_SALPA Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|B4T4I9|GPMB_SALNS Probable phosphoglycerate mutase GpmB OS=Salmonella newport (strain SL254) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|B4TH18|GPMB_SALHS Probable phosphoglycerate mutase GpmB OS=Salmonella heidelberg (strain SL476) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|B5R9W3|GPMB_SALG2 Probable phosphoglycerate mutase GpmB OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|B5R3B7|GPMB_SALEP Probable phosphoglycerate mutase GpmB OS=Salmonella enteritidis PT4 (strain P125109) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|B5FTD9|GPMB_SALDC Probable phosphoglycerate mutase GpmB OS=Salmonella dublin (strain CT_02021853) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|B5F543|GPMB_SALA4 Probable phosphoglycerate mutase GpmB OS=Salmonella agona (strain SL483) GN=gpmB PE=3 SV=1 6 160 2.0E-12
sp|F4KI56|SERCL_ARATH Metal-independent phosphoserine phosphatase OS=Arabidopsis thaliana GN=IPSP PE=1 SV=1 7 212 3.0E-12
sp|B5BAL1|GPMB_SALPK Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi A (strain AKU_12601) GN=gpmB PE=3 SV=1 6 160 4.0E-12
sp|C0Q8F5|GPMB_SALPC Probable phosphoglycerate mutase GpmB OS=Salmonella paratyphi C (strain RKS4594) GN=gpmB PE=3 SV=1 6 160 5.0E-12
sp|A8ALW1|GPMB_CITK8 Probable phosphoglycerate mutase GpmB OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gpmB PE=3 SV=1 6 160 5.0E-12
sp|Q8Z0T4|GPMB_SALTI Probable phosphoglycerate mutase GpmB OS=Salmonella typhi GN=gpmB PE=3 SV=1 6 160 7.0E-12
sp|Q1JQA7|TIGAR_BOVIN Fructose-2,6-bisphosphatase TIGAR OS=Bos taurus GN=TIGAR PE=2 SV=1 9 141 1.0E-11
sp|B1JL20|GPMB_YERPY Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q66EU3|GPMB_YERPS Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|A4TQH5|GPMB_YERPP Probable phosphoglycerate mutase GpmB OS=Yersinia pestis (strain Pestoides F) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q1CMX2|GPMB_YERPN Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|A9R032|GPMB_YERPG Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Angola) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q8ZIP0|GPMB_YERPE Probable phosphoglycerate mutase GpmB OS=Yersinia pestis GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|B2K3K5|GPMB_YERPB Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q1C0L5|GPMB_YERPA Probable phosphoglycerate mutase GpmB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|A7FMF8|GPMB_YERP3 Probable phosphoglycerate mutase GpmB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gpmB PE=3 SV=1 6 160 1.0E-11
sp|Q9NQ88|TIGAR_HUMAN Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens GN=TIGAR PE=1 SV=1 9 94 2.0E-11
sp|B7LNT7|GPMB_ESCF3 Probable phosphoglycerate mutase GpmB OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gpmB PE=3 SV=1 6 160 2.0E-11
sp|B5Y264|GPMB_KLEP3 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae (strain 342) GN=gpmB PE=3 SV=1 6 160 2.0E-11
sp|A6TI09|GPMB_KLEP7 Probable phosphoglycerate mutase GpmB OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gpmB PE=3 SV=1 6 189 2.0E-11
sp|A4W6B3|GPMB_ENT38 Probable phosphoglycerate mutase GpmB OS=Enterobacter sp. (strain 638) GN=gpmB PE=3 SV=1 6 160 2.0E-11
sp|P39701|COBC_SALTY Adenosylcobalamin/alpha-ribazole phosphatase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cobC PE=1 SV=3 6 159 2.0E-11
sp|Q11SV1|GPMA_CYTH3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=gpmA PE=3 SV=1 9 158 2.0E-11
sp|Q1R246|GPMB_ECOUT Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain UTI89 / UPEC) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|Q8FA40|GPMB_ECOL6 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|Q0T8R6|GPMB_ECOL5 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|A1AJW4|GPMB_ECOK1 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O1:K1 / APEC GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B7MTE3|GPMB_ECO81 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O81 (strain ED1a) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B7NW76|GPMB_ECO7I Probable phosphoglycerate mutase GpmB OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B7MNK4|GPMB_ECO45 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|Q31SU3|GPMB_SHIBS Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B2TZS8|GPMB_SHIB3 Probable phosphoglycerate mutase GpmB OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|Q3YTZ9|GPMB_SHISS Probable phosphoglycerate mutase GpmB OS=Shigella sonnei (strain Ss046) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|P0A7A4|GPMB_SHIFL Probable phosphoglycerate mutase GpmB OS=Shigella flexneri GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|Q0SX17|GPMB_SHIF8 Probable phosphoglycerate mutase GpmB OS=Shigella flexneri serotype 5b (strain 8401) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B1LEK2|GPMB_ECOSM Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B6I6P3|GPMB_ECOSE Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain SE11) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B7NH70|GPMB_ECOLU Probable phosphoglycerate mutase GpmB OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|P0A7A2|GPMB_ECOLI Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B1IS24|GPMB_ECOLC Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|A8A8C4|GPMB_ECOHS Probable phosphoglycerate mutase GpmB OS=Escherichia coli O9:H4 (strain HS) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B1XFK5|GPMB_ECODH Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / DH10B) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|C4ZT77|GPMB_ECOBW Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B7LXV9|GPMB_ECO8A Probable phosphoglycerate mutase GpmB OS=Escherichia coli O8 (strain IAI1) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B5Z4S7|GPMB_ECO5E Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|P0A7A3|GPMB_ECO57 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O157:H7 GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B7LEP1|GPMB_ECO55 Probable phosphoglycerate mutase GpmB OS=Escherichia coli (strain 55989 / EAEC) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|A7ZVT7|GPMB_ECO24 Probable phosphoglycerate mutase GpmB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmB PE=3 SV=1 6 160 3.0E-11
sp|B4EY52|GPMB_PROMH Probable phosphoglycerate mutase GpmB OS=Proteus mirabilis (strain HI4320) GN=gpmB PE=3 SV=1 6 160 7.0E-11
sp|Q7NJF7|GPMA2_GLOVI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Gloeobacter violaceus (strain PCC 7421) GN=gpmA2 PE=3 SV=1 5 126 8.0E-11
sp|A8G9J4|GPMB_SERP5 Probable phosphoglycerate mutase GpmB OS=Serratia proteamaculans (strain 568) GN=gpmB PE=3 SV=1 6 160 1.0E-10
sp|P36623|PMGY_SCHPO Phosphoglycerate mutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpm1 PE=1 SV=1 9 176 1.0E-10
sp|A7MIJ0|GPMB_CROS8 Probable phosphoglycerate mutase GpmB OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmB PE=3 SV=1 6 160 1.0E-10
sp|Q327K0|GPMB_SHIDS Probable phosphoglycerate mutase GpmB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmB PE=3 SV=1 6 160 2.0E-10
sp|Q7N900|GPMB_PHOLL Probable phosphoglycerate mutase GpmB OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gpmB PE=3 SV=1 6 175 2.0E-10
sp|P58652|COBC_SALTI Adenosylcobalamin/alpha-ribazole phosphatase OS=Salmonella typhi GN=cobC PE=3 SV=1 6 160 2.0E-10
sp|A1JJB8|GPMB_YERE8 Probable phosphoglycerate mutase GpmB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gpmB PE=3 SV=1 6 160 2.0E-10
sp|B2VH13|GPMB_ERWT9 Probable phosphoglycerate mutase GpmB OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gpmB PE=3 SV=1 6 160 7.0E-10
sp|B7J2L3|GPMA_BORBZ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia burgdorferi (strain ZS7) GN=gpmA PE=3 SV=1 6 125 7.0E-10
sp|O51602|GPMA_BORBU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=gpmA PE=1 SV=2 6 125 7.0E-10
sp|P9WIC7|GPGP_MYCTU Glucosyl-3-phosphoglycerate phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=gpgP PE=1 SV=1 6 94 8.0E-10
sp|P9WIC6|GPGP_MYCTO Glucosyl-3-phosphoglycerate phosphatase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=gpgP PE=1 SV=1 6 94 8.0E-10
sp|B2S101|GPMA_BORHD 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia hermsii (strain HS1 / DAH) GN=gpmA PE=3 SV=1 6 138 8.0E-10
sp|B9JYQ2|GPMA_AGRVS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=gpmA PE=3 SV=1 9 94 1.0E-09
sp|B9J6R3|GPMA_AGRRK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=gpmA PE=3 SV=1 9 94 2.0E-09
sp|A1R083|GPMA_BORT9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia turicatae (strain 91E135) GN=gpmA PE=3 SV=1 6 138 2.0E-09
sp|Q660L2|GPMA_BORBP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=gpmA PE=3 SV=1 6 125 2.0E-09
sp|A7HZ35|GPMA_PARL1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=gpmA PE=3 SV=1 9 158 2.0E-09
sp|A1TC01|GPGP_MYCVP Glucosyl-3-phosphoglycerate phosphatase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=gpgP PE=1 SV=1 6 97 4.0E-09
sp|Q8PST3|GPMA_METMA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gpmA PE=3 SV=1 9 117 5.0E-09
sp|A7IC75|GPMA_XANP2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=gpmA PE=3 SV=1 9 94 5.0E-09
sp|B0UBD4|GPMA_METS4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium sp. (strain 4-46) GN=gpmA PE=3 SV=1 7 94 8.0E-09
sp|Q0SMJ5|GPMA_BORAP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia afzelii (strain PKo) GN=gpmA PE=3 SV=1 6 125 8.0E-09
sp|Q7ZVE3|TIGRB_DANRE Fructose-2,6-bisphosphatase TIGAR B OS=Danio rerio GN=tigarb PE=1 SV=2 9 181 1.0E-08
sp|A6US15|GPMA_METVS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gpmA PE=3 SV=1 5 73 2.0E-08
sp|A5E8K1|GPMA_BRASB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gpmA PE=3 SV=1 3 94 2.0E-08
sp|A5VVV5|GPMA_BRUO2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gpmA PE=3 SV=1 9 160 3.0E-08
sp|A4YJP8|GPMA_BRASO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bradyrhizobium sp. (strain ORS278) GN=gpmA PE=3 SV=1 3 94 3.0E-08
sp|B5RMK4|GPMA_BORDL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia duttonii (strain Ly) GN=gpmA PE=3 SV=1 6 138 3.0E-08
sp|A6UEW3|GPMA_SINMW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sinorhizobium medicae (strain WSM419) GN=gpmA PE=3 SV=1 9 94 4.0E-08
sp|Q15SN0|GPMA_PSEA6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=gpmA PE=3 SV=1 9 158 5.0E-08
sp|P59160|GPMA_BRUSU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis biovar 1 (strain 1330) GN=gpmA PE=3 SV=1 9 94 5.0E-08
sp|A9WW62|GPMA_BRUSI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gpmA PE=3 SV=1 9 94 5.0E-08
sp|A9MCX8|GPMA_BRUC2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gpmA PE=3 SV=1 9 94 5.0E-08
sp|Q576R3|GPMA_BRUAB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus biovar 1 (strain 9-941) GN=gpmA PE=3 SV=1 9 94 5.0E-08
sp|Q2YJN6|GPMA_BRUA2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain 2308) GN=gpmA PE=3 SV=1 9 94 5.0E-08
sp|B2SC37|GPMA_BRUA1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella abortus (strain S19) GN=gpmA PE=3 SV=1 9 94 5.0E-08
sp|Q8YDC9|GPMA_BRUME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gpmA PE=3 SV=2 9 94 5.0E-08
sp|C0RMJ1|GPMA_BRUMB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gpmA PE=3 SV=1 9 94 5.0E-08
sp|Q29RA5|TIGRA_DANRE Probable fructose-2,6-bisphosphatase TIGAR A OS=Danio rerio GN=tigara PE=2 SV=1 9 94 6.0E-08
sp|B5RQ00|GPMA_BORRA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borrelia recurrentis (strain A1) GN=gpmA PE=3 SV=1 6 138 6.0E-08
sp|C5BEL3|GPMA_EDWI9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Edwardsiella ictaluri (strain 93-146) GN=gpmA PE=3 SV=1 6 140 6.0E-08
sp|A1VKR6|GPMA_POLNA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Polaromonas naphthalenivorans (strain CJ2) GN=gpmA PE=3 SV=1 6 125 1.0E-07
sp|C4K389|GPMA_HAMD5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=gpmA PE=3 SV=1 6 170 1.0E-07
sp|B8EML2|GPMA_METSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=gpmA PE=3 SV=1 9 94 2.0E-07
sp|Q8KL44|GPMA_RHIEC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gpmA PE=3 SV=1 5 94 2.0E-07
sp|Q88YY8|GPMA1_LACPL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gpmA1 PE=3 SV=1 9 137 2.0E-07
sp|Q5P7N4|GPMA_AROAE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Aromatoleum aromaticum (strain EbN1) GN=gpmA PE=3 SV=1 6 125 3.0E-07
sp|Q8A8R2|GPMA1_BACTN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmA1 PE=3 SV=1 6 188 3.0E-07
sp|B6JCI9|GPMA_OLICO 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=gpmA PE=3 SV=1 9 94 4.0E-07
sp|P00950|PMG1_YEAST Phosphoglycerate mutase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPM1 PE=1 SV=3 6 176 5.0E-07
sp|B2S2B5|GPMA_TREPS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=gpmA PE=3 SV=1 6 126 6.0E-07
sp|P96121|GPMA_TREPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema pallidum (strain Nichols) GN=gpmA PE=3 SV=1 6 126 6.0E-07
sp|Q2YBZ1|GPMA1_NITMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gpmA1 PE=3 SV=1 5 94 9.0E-07
sp|Q64R85|GPMA_BACFR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacteroides fragilis (strain YCH46) GN=gpmA PE=3 SV=1 6 185 9.0E-07
sp|Q5LAT7|GPMA_BACFN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=gpmA PE=3 SV=1 6 185 9.0E-07
sp|Q7VR80|GPMA_BLOFL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Blochmannia floridanus GN=gpmA PE=3 SV=1 9 126 1.0E-06
sp|B5FP39|GPMA_SALDC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella dublin (strain CT_02021853) GN=gpmA PE=3 SV=1 5 140 1.0E-06
sp|A6T6I3|GPMA_KLEP7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B5XZB2|GPMA_KLEP3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Klebsiella pneumoniae (strain 342) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B0BAH7|GPMA_CHLTB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=gpmA PE=3 SV=1 9 189 2.0E-06
sp|Q8Z8B2|GPMA_SALTI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella typhi GN=gpmA PE=3 SV=3 5 140 2.0E-06
sp|B4TQR7|GPMA_SALSV 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella schwarzengrund (strain CVM19633) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|C0PWW0|GPMA_SALPC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi C (strain RKS4594) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B4SZH5|GPMA_SALNS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella newport (strain SL254) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|Q57RI5|GPMA_SALCH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella choleraesuis (strain SC-B67) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|Q8ZQS2|GPMA_SALTY 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gpmA PE=3 SV=3 5 140 2.0E-06
sp|A9MTL3|GPMA_SALPB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B4TC26|GPMA_SALHS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella heidelberg (strain SL476) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B5R739|GPMA_SALG2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B5QX43|GPMA_SALEP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella enteritidis PT4 (strain P125109) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|B5F050|GPMA_SALA4 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella agona (strain SL483) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|Q92T25|GPMA_RHIME 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhizobium meliloti (strain 1021) GN=gpmA PE=3 SV=1 9 94 2.0E-06
sp|Q8L1Z7|GPMA_BARHE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gpmA PE=3 SV=1 9 94 2.0E-06
sp|B5BC52|GPMA_SALPK 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi A (strain AKU_12601) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|Q5PG75|GPMA_SALPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gpmA PE=3 SV=1 5 140 2.0E-06
sp|Q88T35|GPMA2_LACPL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=gpmA2 PE=3 SV=1 5 125 2.0E-06
sp|Q2NUK6|GPMA_SODGM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Sodalis glossinidius (strain morsitans) GN=gpmA PE=3 SV=1 5 124 2.0E-06
sp|Q3B5J2|GPMA_CHLL7 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=gpmA PE=3 SV=1 6 125 3.0E-06
sp|B0B8U8|GPMA_CHLT2 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=gpmA PE=3 SV=1 9 189 3.0E-06
sp|Q21YW0|GPMA_RHOFT 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gpmA PE=3 SV=1 6 125 3.0E-06
sp|O84727|GPMA_CHLTR 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gpmA PE=3 SV=1 9 189 3.0E-06
sp|Q3KKX2|GPMA_CHLTA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=gpmA PE=3 SV=1 9 189 3.0E-06
sp|Q32IH0|GPMA_SHIDS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gpmA PE=3 SV=1 5 140 3.0E-06
sp|Q9PLK4|GPMA_CHLMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gpmA PE=3 SV=1 9 189 3.0E-06
sp|P50201|MAS12_AGRRH Agropine synthesis reductase OS=Agrobacterium rhizogenes GN=mas1 PE=3 SV=1 2 151 3.0E-06
sp|A9IXE7|GPMA_BART1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gpmA PE=3 SV=1 9 94 3.0E-06
sp|B2IEV6|GPMA_BEII9 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=gpmA PE=3 SV=1 9 94 3.0E-06
sp|Q2Y9Z7|GPMA2_NITMU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=gpmA2 PE=3 SV=1 6 140 4.0E-06
sp|Q3Z455|GPMA_SHISS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella sonnei (strain Ss046) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|P62710|GPMA_SHIFL 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella flexneri GN=gpmA PE=3 SV=2 5 140 4.0E-06
sp|Q0T6Y5|GPMA_SHIF8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella flexneri serotype 5b (strain 8401) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|Q324G4|GPMA_SHIBS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella boydii serotype 4 (strain Sb227) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|B2TUY6|GPMA_SHIB3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|B7LK04|GPMA_ESCF3 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|B1LM46|GPMA_ECOSM 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|B6I7Q9|GPMA_ECOSE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain SE11) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|B7N9Z7|GPMA_ECOLU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|P62707|GPMA_ECOLI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12) GN=gpmA PE=1 SV=2 5 140 4.0E-06
sp|B1IXY1|GPMA_ECOLC 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|P62708|GPMA_ECOL6 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gpmA PE=3 SV=2 5 140 4.0E-06
sp|Q0TJU6|GPMA_ECOL5 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|A1A8Z8|GPMA_ECOK1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O1:K1 / APEC GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|A7ZY11|GPMA_ECOHS 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O9:H4 (strain HS) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|B1X786|GPMA_ECODH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12 / DH10B) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|C4ZXS6|GPMA_ECOBW 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|B7M6B8|GPMA_ECO8A 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O8 (strain IAI1) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|B7MPN9|GPMA_ECO81 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O81 (strain ED1a) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|B7NNH7|GPMA_ECO7I 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|B5YRF2|GPMA_ECO5E 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|P62709|GPMA_ECO57 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O157:H7 GN=gpmA PE=3 SV=2 5 140 4.0E-06
sp|B7LAF6|GPMA_ECO55 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain 55989 / EAEC) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|B7MGL2|GPMA_ECO45 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|B7ULM8|GPMA_ECO27 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|P82612|PMGY_CANAL Phosphoglycerate mutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPM1 PE=1 SV=3 6 138 4.0E-06
sp|A7ZJD0|GPMA_ECO24 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gpmA PE=3 SV=1 5 140 4.0E-06
sp|A1K9B9|GPMA_AZOSB 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Azoarcus sp. (strain BH72) GN=gpmA PE=3 SV=1 6 125 4.0E-06
sp|B9L9H5|GPMA_NAUPA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=gpmA PE=3 SV=1 5 94 5.0E-06
sp|Q73M14|GPMA_TREDE 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=gpmA PE=3 SV=1 6 126 6.0E-06
sp|Q8A765|GPMA2_BACTN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=gpmA2 PE=3 SV=1 6 186 6.0E-06
sp|B1M6A7|GPMA_METRJ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=gpmA PE=3 SV=1 9 182 6.0E-06
sp|B2KBU4|GPMA_ELUMP 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Elusimicrobium minutum (strain Pei191) GN=gpmA PE=3 SV=1 6 141 6.0E-06
sp|Q5HLI0|GPMA_STAEQ 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gpmA PE=3 SV=1 1 94 7.0E-06
sp|Q8CN61|GPMA_STAES 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gpmA PE=3 SV=1 1 94 8.0E-06
sp|Q8RFG9|GPMA_FUSNN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=gpmA PE=3 SV=1 6 126 8.0E-06
sp|P15259|PGAM2_HUMAN Phosphoglycerate mutase 2 OS=Homo sapiens GN=PGAM2 PE=1 SV=3 6 176 9.0E-06
sp|Q9Z743|GPMA_CHLPN 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlamydia pneumoniae GN=gpmA PE=3 SV=1 5 189 9.0E-06
sp|A4W897|GPMA_ENT38 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Enterobacter sp. (strain 638) GN=gpmA PE=3 SV=1 5 140 9.0E-06
sp|A7MIX7|GPMA_CROS8 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gpmA PE=3 SV=1 5 140 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|055410
MPSQARVYLVRHGETDGNRNKIIQGQLDIPLNKIGLEQAARVADVLRVIKFDVALSSDLSRAKETAAAILREQPG
LALQEQEDLRERFMGDLEGHVYGTRLDGRLSTMETGPAFAKRTLTWWRKNIVEYTATMVPREEPYNILAVSHGGF
LGTLVKNLVGAGDLRLVEGVVLASLPNASVSLIEWDGRKGKVIQYGEEGHLRRADRLDQNVDELPI*
Coding >Agabi119p4|055410
ATGCCCAGCCAAGCAAGGGTATACCTGGTCCGCCATGGAGAAACCGACGGAAACAGAAATAAAATTATCCAAGGA
CAACTTGACATACCGTTAAACAAGATAGGATTAGAGCAGGCAGCCCGTGTAGCAGATGTGCTCCGAGTGATCAAG
TTTGACGTTGCGTTGTCAAGTGATCTGAGCAGAGCTAAAGAGACGGCAGCTGCGATTTTAAGGGAACAACCTGGC
CTAGCCTTGCAGGAGCAAGAGGATCTGCGAGAGCGTTTCATGGGCGATCTCGAAGGACATGTGTATGGAACGAGA
CTTGACGGCAGATTGTCCACGATGGAGACGGGACCAGCGTTCGCAAAACGAACTCTCACCTGGTGGAGAAAAAAT
ATAGTTGAATACACCGCCACAATGGTACCGCGGGAAGAGCCGTATAATATTCTGGCAGTTTCACATGGAGGGTTT
CTAGGCACGTTGGTGAAAAACTTGGTGGGGGCTGGAGATTTAAGACTGGTCGAAGGGGTGGTCTTGGCGTCGCTG
CCTAATGCGTCTGTGTCGCTAATTGAGTGGGATGGGCGGAAAGGGAAGGTCATTCAGTATGGAGAAGAAGGACAC
TTGAGACGGGCAGATCGGCTTGACCAGAATGTGGATGAGCTCCCGATTTAG
Transcript >Agabi119p4|055410
ATGCCCAGCCAAGCAAGGGTATACCTGGTCCGCCATGGAGAAACCGACGGAAACAGAAATAAAATTATCCAAGGA
CAACTTGACATACCGTTAAACAAGATAGGATTAGAGCAGGCAGCCCGTGTAGCAGATGTGCTCCGAGTGATCAAG
TTTGACGTTGCGTTGTCAAGTGATCTGAGCAGAGCTAAAGAGACGGCAGCTGCGATTTTAAGGGAACAACCTGGC
CTAGCCTTGCAGGAGCAAGAGGATCTGCGAGAGCGTTTCATGGGCGATCTCGAAGGACATGTGTATGGAACGAGA
CTTGACGGCAGATTGTCCACGATGGAGACGGGACCAGCGTTCGCAAAACGAACTCTCACCTGGTGGAGAAAAAAT
ATAGTTGAATACACCGCCACAATGGTACCGCGGGAAGAGCCGTATAATATTCTGGCAGTTTCACATGGAGGGTTT
CTAGGCACGTTGGTGAAAAACTTGGTGGGGGCTGGAGATTTAAGACTGGTCGAAGGGGTGGTCTTGGCGTCGCTG
CCTAATGCGTCTGTGTCGCTAATTGAGTGGGATGGGCGGAAAGGGAAGGTCATTCAGTATGGAGAAGAAGGACAC
TTGAGACGGGCAGATCGGCTTGACCAGAATGTGGATGAGCTCCCGATTTAG
Gene >Agabi119p4|055410
ATGCCCAGCCAAGCAAGGGTATACCTGGTCCGCCATGGAGAAACCGACGGAAACAGAAATAAAATTATCCAAGGA
CAACTTGACATACCGTTAAACAAGATAGGATTAGAGCAGGCAGCCCGTGTAGCAGATGTGCTCCGAGTGATCAAG
TTTGACGTTGCGTTGTCAAGTGATCTGAGCAGAGCTAAAGAGGTGAGCGCTACAGACGACTGTCAGAACCACAAT
TAGACTGTTCGTAGACGGCAGCTGCGATTTTAAGGGAACAACCTGGCCTAGCCTTGCAGGAGCAAGAGGATCTGC
GAGAGCGTGTGCGTTGTATTTTTACAGTCGTTCAAGGCTAGGTATCGATATTGATTAAGTGTAGTTCATGGGCGA
TCTCGAAGGACATGTGTATGGAACGAGACTTGACGGCAGATTGTCCACGATGGAGACGGGACCAGCGTTCGCAAA
ACGAACTCTCACCTGGTGGAGAAAAAATATAGTTGAATACACCGCCACAATGGTACCGCGGGAAGAGCCGTATAA
TATTCTGGCAGTTTCACATGGAGGGTTTCTAGGCACGTTGGTGAAAAACTTGGTGGGGGCTGGAGATTTAAGACT
GGTCGAAGGGGTGGTCTTGGCGTCGCTGCCTAATGCGTCTGTGTCGCTAATTGAGTGGGATGGGCGGAAAGGGAA
GGTCATTCAGTATGGAGAAGAAGGACACTTGAGACGGGCAGATCGGCTTGACCAGAATGTGGATGAGCTCCCGAT
TTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail