Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|055190
Gene name
Locationscaffold_03a:681422..683989
Strand-
Gene length (bp)2567
Transcript length (bp)1893
Coding sequence length (bp)1893
Protein length (aa) 631

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00710 Asparaginase Asparaginase, N-terminal 9.0E-58 11 250
PF17763 Asparaginase_C Glutaminase/Asparaginase C-terminal domain 3.4E-29 270 383
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.3E-12 520 588
PF13637 Ank_4 Ankyrin repeats (many copies) 1.2E-08 532 584
PF00023 Ank Ankyrin repeat 2.8E-04 531 561
PF00023 Ank Ankyrin repeat 2.7E-03 564 588
PF13606 Ank_3 Ankyrin repeat 1.8E-03 564 587

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9U518|ASPG_DIRIM L-asparaginase OS=Dirofilaria immitis PE=1 SV=1 7 609 5.0E-104
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 9 621 3.0E-102
sp|O88202|LPP60_RAT 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 9 393 7.0E-90
sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 9 393 2.0E-89
sp|P0A962|ASPG1_ECOLI L-asparaginase 1 OS=Escherichia coli (strain K12) GN=ansA PE=1 SV=1 107 393 2.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9U518|ASPG_DIRIM L-asparaginase OS=Dirofilaria immitis PE=1 SV=1 7 609 5.0E-104
sp|Q86U10|LPP60_HUMAN 60 kDa lysophospholipase OS=Homo sapiens GN=ASPG PE=2 SV=3 9 621 3.0E-102
sp|O88202|LPP60_RAT 60 kDa lysophospholipase OS=Rattus norvegicus GN=Aspg PE=1 SV=1 9 393 7.0E-90
sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 9 393 2.0E-89
sp|P0A962|ASPG1_ECOLI L-asparaginase 1 OS=Escherichia coli (strain K12) GN=ansA PE=1 SV=1 107 393 2.0E-73
sp|P0A963|ASPG1_ECO57 L-asparaginase 1 OS=Escherichia coli O157:H7 GN=ansA PE=3 SV=1 107 393 2.0E-73
sp|P26900|ASPG1_BACSU L-asparaginase 1 OS=Bacillus subtilis (strain 168) GN=ansA PE=2 SV=1 116 373 3.0E-35
sp|O59132|GATD_PYRHO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=gatD PE=3 SV=1 118 396 6.0E-35
sp|Q9V0T9|GATD_PYRAB Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=gatD PE=1 SV=1 118 396 3.0E-34
sp|Q8TV84|GATD_METKA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=gatD PE=3 SV=1 118 397 1.0E-33
sp|A5UK11|GATD_METS3 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=gatD PE=3 SV=1 27 396 1.0E-32
sp|Q8U0X0|GATD_PYRFU Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=gatD PE=3 SV=1 118 398 2.0E-32
sp|Q5JI77|GATD_THEKO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=gatD PE=3 SV=1 118 396 1.0E-31
sp|Q60331|GATD_METJA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=gatD PE=3 SV=1 140 396 3.0E-31
sp|A4YHH3|GATD_METS5 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=gatD PE=3 SV=1 42 391 9.0E-30
sp|Q971W5|GATD_SULTO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=gatD PE=3 SV=1 48 398 1.0E-28
sp|O29380|GATD_ARCFU Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=gatD PE=3 SV=1 118 392 1.0E-28
sp|O26802|GATD_METTH Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=gatD PE=1 SV=1 118 396 3.0E-28
sp|Q2NEH1|GATD_METST Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=gatD PE=3 SV=1 118 392 8.0E-28
sp|Q9Y9T8|GATD_AERPE Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=gatD PE=3 SV=1 106 397 2.0E-26
sp|Q46GJ6|GATD_METBF Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=gatD PE=3 SV=1 118 393 2.0E-25
sp|C3NE01|GATD_SULIY Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=gatD PE=3 SV=1 55 393 2.0E-25
sp|C3NHQ2|GATD_SULIN Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=gatD PE=3 SV=1 55 393 2.0E-25
sp|C3MYR5|GATD_SULIM Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=gatD PE=3 SV=1 55 393 2.0E-25
sp|C4KH13|GATD_SULIK Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=gatD PE=3 SV=1 55 393 2.0E-25
sp|C3N5E7|GATD_SULIA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain M.16.27) GN=gatD PE=3 SV=1 55 393 2.0E-25
sp|Q9HJJ5|GATD_THEAC Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=gatD PE=3 SV=1 114 398 3.0E-25
sp|Q4J955|GATD_SULAC Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=gatD PE=3 SV=1 55 393 3.0E-25
sp|C3MPS1|GATD_SULIL Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=gatD PE=3 SV=1 55 393 7.0E-25
sp|Q12X65|GATD_METBU Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=gatD PE=3 SV=1 54 397 2.0E-24
sp|Q97ZH5|GATD_SULSO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=gatD PE=3 SV=1 54 393 2.0E-24
sp|A6VGK5|GATD_METM7 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=gatD PE=3 SV=1 118 393 2.0E-24
sp|Q8PUM7|GATD_METMA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=gatD PE=3 SV=1 118 392 2.0E-24
sp|A4FWR5|GATD_METM5 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=gatD PE=3 SV=1 130 393 7.0E-24
sp|A9AA46|GATD_METM6 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=gatD PE=3 SV=1 118 393 7.0E-24
sp|P61400|GATD_METMP Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus maripaludis (strain S2 / LL) GN=gatD PE=3 SV=1 118 393 1.0E-23
sp|Q8TR66|GATD_METAC Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=gatD PE=3 SV=1 49 393 4.0E-23
sp|A1RX40|GATD_THEPD Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Thermofilum pendens (strain Hrk 5) GN=gatD PE=3 SV=1 118 396 7.0E-23
sp|Q8ZY04|GATD_PYRAE Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=gatD PE=3 SV=1 143 398 2.0E-22
sp|Q979L8|GATD_THEVO Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=gatD PE=3 SV=1 118 398 2.0E-21
sp|A6UPR4|GATD_METVS Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=gatD PE=3 SV=1 118 393 3.0E-21
sp|Q18GL3|GATD_HALWD Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=gatD PE=3 SV=1 118 398 3.0E-21
sp|Q9HP20|GATD_HALSA Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gatD PE=3 SV=1 118 398 3.0E-20
sp|B0R6H4|GATD_HALS3 Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=gatD PE=3 SV=1 118 398 3.0E-20
sp|P30363|ASPG_BACLI L-asparaginase OS=Bacillus licheniformis GN=ansA PE=3 SV=1 116 371 7.0E-16
sp|P61401|GATD_NANEQ Glutamyl-tRNA(Gln) amidotransferase subunit D OS=Nanoarchaeum equitans (strain Kin4-M) GN=gatD PE=3 SV=1 118 375 1.0E-13
sp|P81069|GABP2_MOUSE GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 532 614 1.0E-10
sp|Q337A0|XB33_ORYSJ Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 529 584 2.0E-10
sp|Q0V8G2|GABP2_BOVIN GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 532 616 4.0E-10
sp|P00805|ASPG2_ECOLI L-asparaginase 2 OS=Escherichia coli (strain K12) GN=ansB PE=1 SV=2 120 373 1.0E-09
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 530 621 3.0E-09
sp|Q8TAK5|GABP2_HUMAN GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 532 616 3.0E-09
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 530 621 3.0E-09
sp|Q00420|GABP1_MOUSE GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 532 616 6.0E-09
sp|Q06547|GABP1_HUMAN GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 532 616 6.0E-09
sp|Q1RMI3|GABP1_BOVIN GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 532 616 7.0E-09
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 530 588 2.0E-08
sp|Q8R560|ANKR1_RAT Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 532 594 2.0E-08
sp|Q865U8|ANKR1_PIG Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 532 594 2.0E-08
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 533 609 2.0E-08
sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 533 609 2.0E-08
sp|Q15327|ANKR1_HUMAN Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 532 594 2.0E-08
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 523 588 3.0E-08
sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 533 609 3.0E-08
sp|Q812A3|ANR23_MOUSE Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 532 630 4.0E-08
sp|Q3ZBX7|ANKR1_BOVIN Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 532 594 5.0E-08
sp|A2VDR2|ACBD6_BOVIN Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 523 588 6.0E-08
sp|Q4JHE0|XB36_ORYSJ Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 521 584 7.0E-08
sp|Q9BR61|ACBD6_HUMAN Acyl-CoA-binding domain-containing protein 6 OS=Homo sapiens GN=ACBD6 PE=1 SV=1 513 588 8.0E-08
sp|Q9TU71|ANKR1_RABIT Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 532 594 8.0E-08
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 523 588 9.0E-08
sp|A0JNU3|LPP60_MOUSE 60 kDa lysophospholipase OS=Mus musculus GN=Aspg PE=1 SV=1 530 621 1.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 527 588 1.0E-07
sp|Q9CR42|ANKR1_MOUSE Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 532 594 1.0E-07
sp|Q6NLQ8|XB32_ARATH E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 529 588 1.0E-07
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 530 621 1.0E-07
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 520 594 2.0E-07
sp|Q4FE45|XB33_ARATH E3 ubiquitin-protein ligase XBAT33 OS=Arabidopsis thaliana GN=XBAT33 PE=2 SV=1 529 584 2.0E-07
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 523 621 2.0E-07
sp|Q9D061|ACBD6_MOUSE Acyl-CoA-binding domain-containing protein 6 OS=Mus musculus GN=Acbd6 PE=1 SV=2 523 588 3.0E-07
sp|O70511|ANK3_RAT Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 530 621 3.0E-07
sp|P40480|HOS4_YEAST Protein HOS4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOS4 PE=1 SV=1 520 588 3.0E-07
sp|Q9WV06|ANKR2_MOUSE Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 532 588 3.0E-07
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 523 588 3.0E-07
sp|Q9C0D5|TANC1_HUMAN Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 531 596 3.0E-07
sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 520 621 3.0E-07
sp|Q9QZH2|BARD1_RAT BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 477 588 4.0E-07
sp|Q6KAE5|XB32_ORYSJ Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 529 600 4.0E-07
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 478 588 5.0E-07
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 525 595 5.0E-07
sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 478 583 6.0E-07
sp|A6QPE7|ANR65_BOVIN Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 529 588 6.0E-07
sp|Q8Q0U0|Y045_METMA Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 519 590 6.0E-07
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 530 621 6.0E-07
sp|E5RJM6|ANR65_HUMAN Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 531 588 7.0E-07
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 516 585 7.0E-07
sp|Q9GZV1|ANKR2_HUMAN Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 532 588 8.0E-07
sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 531 602 9.0E-07
sp|Q6DGX3|ANR54_DANRE Ankyrin repeat domain-containing protein 54 OS=Danio rerio GN=ankrd54 PE=2 SV=1 525 594 9.0E-07
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 531 596 9.0E-07
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 531 596 9.0E-07
sp|Q6NXT1|ANR54_HUMAN Ankyrin repeat domain-containing protein 54 OS=Homo sapiens GN=ANKRD54 PE=1 SV=2 518 594 9.0E-07
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 477 588 1.0E-06
sp|Q07DV3|ASZ1_AOTNA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Aotus nancymaae GN=ASZ1 PE=3 SV=1 533 588 1.0E-06
sp|Q2QLG0|ASZ1_CALJA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callithrix jacchus GN=ASZ1 PE=3 SV=1 533 588 1.0E-06
sp|Q09YH1|ASZ1_SAIBB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Saimiri boliviensis boliviensis GN=ASZ1 PE=3 SV=1 533 588 1.0E-06
sp|Q5RJK8|ACBD6_RAT Acyl-CoA-binding domain-containing protein 6 OS=Rattus norvegicus GN=Acbd6 PE=1 SV=1 523 588 1.0E-06
sp|Q505D1|ANR28_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 529 588 1.0E-06
sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 529 588 1.0E-06
sp|A4D7T3|ASZ1_MACEU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 533 588 1.0E-06
sp|Q9WV74|ASB1_MOUSE Ankyrin repeat and SOCS box protein 1 OS=Mus musculus GN=Asb1 PE=2 SV=1 533 621 1.0E-06
sp|Q9ZLB9|ASPG_HELPJ Probable L-asparaginase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ansA PE=1 SV=1 119 374 1.0E-06
sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 523 594 1.0E-06
sp|Q2IBB4|ASZ1_RHIFE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 533 588 1.0E-06
sp|Q1LZC5|ANR54_BOVIN Ankyrin repeat domain-containing protein 54 OS=Bos taurus GN=ANKRD54 PE=2 SV=1 521 594 1.0E-06
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 520 584 2.0E-06
sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 523 594 2.0E-06
sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 523 587 2.0E-06
sp|Q6F6B3|TANC1_RAT Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 531 596 2.0E-06
sp|Q7ZT11|ANKR1_CHICK Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 532 587 2.0E-06
sp|Q0VGY8|TANC1_MOUSE Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 531 596 2.0E-06
sp|Q8VD46|ASZ1_MOUSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 474 588 2.0E-06
sp|Q108U1|ASZ1_LOXAF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Loxodonta africana GN=ASZ1 PE=3 SV=1 533 588 2.0E-06
sp|Q94A76|GORK_ARATH Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 531 588 2.0E-06
sp|Q4V8X4|ACBD6_DANRE Acyl-CoA-binding domain-containing protein 6 OS=Danio rerio GN=acbd6 PE=2 SV=1 523 588 2.0E-06
sp|Q07DY6|ASZ1_COLGU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 533 588 2.0E-06
sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 531 588 3.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 478 588 3.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 530 621 3.0E-06
sp|Q7EZ44|XB35_ORYSJ Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 533 584 3.0E-06
sp|Q2IBE3|ASZ1_PONAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 533 588 3.0E-06
sp|Q9J512|V223_FOWPN Putative ankyrin repeat protein FPV223 OS=Fowlpox virus (strain NVSL) GN=FPV223 PE=3 SV=1 523 630 3.0E-06
sp|Q2QLC6|ASZ1_CARPS Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 533 588 3.0E-06
sp|Q2IBF5|ASZ1_GORGO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 533 588 3.0E-06
sp|Q09YN0|ASZ1_RABIT Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Oryctolagus cuniculus GN=ASZ1 PE=3 SV=1 533 588 3.0E-06
sp|Q8WWH4|ASZ1_HUMAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 533 588 3.0E-06
sp|Q8WMX6|ASZ1_PANTR Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 533 588 3.0E-06
sp|A0M8T3|ASZ1_FELCA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 533 588 3.0E-06
sp|Q2IBB1|ASZ1_CHLAE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 533 588 3.0E-06
sp|Q2QLA4|ASZ1_HORSE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 533 588 3.0E-06
sp|Q8WMX7|ASZ1_PAPAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 533 588 3.0E-06
sp|Q5ZIJ9|MIB2_CHICK E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 527 588 3.0E-06
sp|Q09YJ5|ASZ1_MUNMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 533 588 3.0E-06
sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 520 587 3.0E-06
sp|Q07DX6|ASZ1_NOMLE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 533 588 3.0E-06
sp|Q8WMX8|ASZ1_BOVIN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 533 588 3.0E-06
sp|Q00PJ3|ASZ1_ATEAB Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Atelerix albiventris GN=ASZ1 PE=3 SV=1 533 588 3.0E-06
sp|Q09YI3|ASZ1_SHEEP Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 533 588 3.0E-06
sp|Q2QLB5|ASZ1_CALMO Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Callicebus moloch GN=ASZ1 PE=3 SV=1 533 588 3.0E-06
sp|Q07E30|ASZ1_NEONE Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 533 588 4.0E-06
sp|Q07DZ7|ASZ1_ORNAN Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 533 588 4.0E-06
sp|Q2QLH1|ASZ1_OTOGA Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 533 588 4.0E-06
sp|Q2IBG0|ASZ1_EULMM Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 533 588 4.0E-06
sp|Q9VBP3|TNKS_DROME Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 523 594 4.0E-06
sp|P53355|DAPK1_HUMAN Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 531 630 4.0E-06
sp|Q9Y576|ASB1_HUMAN Ankyrin repeat and SOCS box protein 1 OS=Homo sapiens GN=ASB1 PE=1 SV=1 533 621 4.0E-06
sp|O70445|BARD1_MOUSE BRCA1-associated RING domain protein 1 OS=Mus musculus GN=Bard1 PE=2 SV=1 477 588 4.0E-06
sp|Q8WXD9|CSKI1_HUMAN Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 531 585 4.0E-06
sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 520 594 5.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 519 596 5.0E-06
sp|Q07E17|ASZ1_MUSPF Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 533 588 5.0E-06
sp|Q9H9B1|EHMT1_HUMAN Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 532 589 5.0E-06
sp|Q8TC84|FANK1_HUMAN Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 520 606 5.0E-06
sp|Q6JAN1|INVS_CANLF Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 531 596 5.0E-06
sp|Q86SG2|ANR23_HUMAN Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 532 594 5.0E-06
sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 531 588 6.0E-06
sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 531 585 6.0E-06
sp|Q6P9K8|CSKI1_MOUSE Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 531 585 6.0E-06
sp|Q3V0J4|ANR53_MOUSE Ankyrin repeat domain-containing protein 53 OS=Mus musculus GN=Ankrd53 PE=2 SV=2 478 583 6.0E-06
sp|Q66H07|FANK1_RAT Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 520 625 6.0E-06
sp|Q91WK7|ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus GN=Ankrd54 PE=1 SV=1 525 594 6.0E-06
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 531 588 6.0E-06
sp|Q566C8|ANR54_RAT Ankyrin repeat domain-containing protein 54 OS=Rattus norvegicus GN=Ankrd54 PE=2 SV=1 525 594 6.0E-06
sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 517 588 7.0E-06
sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 477 587 7.0E-06
sp|Q9Y283|INVS_HUMAN Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 531 596 7.0E-06
sp|Q9D738|ASB12_MOUSE Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 533 592 7.0E-06
sp|Q5REW9|ANR27_PONAB Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 534 591 7.0E-06
sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 528 590 9.0E-06
sp|A2A690|TANC2_MOUSE Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 505 588 9.0E-06
sp|Q9HCD6|TANC2_HUMAN Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 505 588 9.0E-06
sp|Q99728|BARD1_HUMAN BRCA1-associated RING domain protein 1 OS=Homo sapiens GN=BARD1 PE=1 SV=2 531 591 9.0E-06
sp|Q2QL84|ASZ1_MICMU Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 533 588 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 12 31 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|055190
MDGPQLADESRVLVIYTGGTIGMLVGQQGYVPEPYYLTETLRSQNRFHDPLQDSLFSNSGTVQGFREWSGGSGRS
SPAPSLTQTTAPQESTEMHQIPGGTTSKSIRYAILEWDPLLDSSNIDIQDWIRLATEIELNYSFDAFVILHGTDT
MSYTSSALSFLLEDLGKTVVITGAQIPMSQLRNDAVDNLMGALTIAGHFIIPECCLYFNHTLYRGNRATKMSSYD
LAAFESPNFEPLVKVGIDIDVNWDHVIRQTSLRKFRAHKEMCPYVATLRLFPGIGGATIKAFCSHPIRGVVLETF
GAGNAPQRPDLIEALKEACDRGVVVVAISQCVKGSVSDAYETARTLRQVGVVPGNDMTPECALSKLSYLLSKSDL
TLDQVRDLIGKPLRGELTSHSVPAPSQDTKGKPAATLDSNIETIHTVLSQFVRLARPPSFVPGIKLSSDALATAT
GAQSTAAPWTWTAAEASATEYVLLPFLVHYASAKNDLESLRYCIEIERQFTTNPGESPRIGTVRSGNIAGGIVNC
LDAGSGRSPLHVSALNGHMQIVTLLLQSGALVHMRDTLGHTALYYAARHGHLDVVDMLLQAGAILGGFDTEFAKL
GFKNARRMGDKTMLKVWARVGIKKPVLDKE*
Coding >Agabi119p4|055190
ATGGACGGTCCTCAACTCGCGGACGAATCCAGGGTGCTCGTCATTTACACAGGCGGCACCATTGGAATGCTCGTT
GGACAACAAGGATACGTACCGGAACCATACTATCTGACGGAAACACTTCGAAGCCAAAACCGCTTCCATGACCCG
TTACAGGATTCTCTGTTCTCTAATTCCGGTACTGTGCAGGGGTTCAGAGAATGGAGCGGGGGAAGTGGAAGGTCA
AGCCCTGCACCTTCGCTAACGCAAACCACCGCACCTCAGGAATCGACCGAGATGCATCAAATTCCTGGTGGAACG
ACCAGCAAATCCATTCGATATGCCATCCTTGAATGGGATCCTTTACTTGACAGTAGCAATATAGACATCCAAGAC
TGGATTCGTCTCGCAACCGAGATCGAGTTGAACTACAGCTTTGATGCTTTCGTTATTCTGCATGGAACTGATACC
ATGTCTTACACGTCAAGTGCTTTGAGTTTTTTGTTAGAAGACCTCGGAAAAACAGTGGTCATCACCGGAGCACAA
ATACCTATGTCACAACTTCGGAATGATGCTGTAGATAATCTGATGGGCGCTCTCACAATCGCCGGACACTTCATC
ATTCCAGAATGTTGCCTATACTTCAACCACACGTTGTACCGTGGAAACCGGGCAACAAAAATGTCATCTTATGAC
CTAGCAGCTTTTGAAAGCCCGAACTTTGAACCCCTTGTGAAAGTCGGCATCGATATTGACGTCAACTGGGATCAT
GTCATTCGCCAAACCAGCCTGCGGAAATTTAGAGCCCACAAAGAGATGTGCCCTTATGTCGCAACGCTGCGTCTA
TTTCCGGGTATTGGAGGCGCAACTATTAAAGCATTCTGCAGCCATCCAATCCGTGGCGTGGTTCTTGAAACCTTC
GGCGCGGGCAACGCACCACAACGCCCTGATCTTATCGAAGCGCTGAAAGAAGCCTGCGACAGAGGTGTCGTCGTA
GTAGCCATATCACAATGCGTCAAAGGCTCAGTCTCAGATGCATATGAGACCGCTCGAACACTTCGGCAAGTTGGT
GTAGTGCCTGGGAATGATATGACACCCGAGTGCGCGTTGTCGAAGCTCAGCTATCTGCTCTCTAAATCCGACTTA
ACACTCGACCAAGTCCGAGATCTTATTGGTAAACCATTACGAGGCGAATTGACTAGCCATTCGGTACCAGCTCCC
AGTCAGGATACAAAAGGCAAACCCGCGGCTACCTTAGACTCAAATATAGAAACAATCCACACTGTCCTCTCACAA
TTCGTCCGCCTTGCTCGACCACCGTCCTTTGTCCCCGGGATCAAATTATCTTCCGATGCACTCGCTACCGCAACA
GGAGCTCAAAGCACTGCCGCACCGTGGACGTGGACCGCTGCCGAGGCATCCGCAACCGAATATGTACTCCTACCG
TTCTTAGTCCACTACGCGTCGGCGAAGAACGATTTGGAAAGCCTGCGATACTGCATTGAAATCGAACGGCAGTTT
ACAACCAATCCCGGTGAATCTCCCCGTATAGGGACGGTGAGGTCCGGGAATATCGCAGGTGGTATTGTCAATTGC
TTGGATGCTGGTTCTGGGAGGTCACCTTTACATGTGTCGGCGCTGAATGGTCATATGCAGATTGTTACACTTTTG
TTGCAATCAGGCGCTTTGGTTCATATGAGAGACACGCTCGGACACACAGCGTTATATTATGCTGCGAGACACGGG
CATCTTGACGTCGTTGATATGCTTCTTCAAGCCGGAGCTATCCTTGGTGGGTTTGATACAGAATTTGCCAAGCTG
GGGTTTAAAAACGCTCGTCGTATGGGGGACAAGACCATGTTGAAGGTCTGGGCAAGGGTGGGCATTAAAAAGCCT
GTGCTTGACAAGGAATAA
Transcript >Agabi119p4|055190
ATGGACGGTCCTCAACTCGCGGACGAATCCAGGGTGCTCGTCATTTACACAGGCGGCACCATTGGAATGCTCGTT
GGACAACAAGGATACGTACCGGAACCATACTATCTGACGGAAACACTTCGAAGCCAAAACCGCTTCCATGACCCG
TTACAGGATTCTCTGTTCTCTAATTCCGGTACTGTGCAGGGGTTCAGAGAATGGAGCGGGGGAAGTGGAAGGTCA
AGCCCTGCACCTTCGCTAACGCAAACCACCGCACCTCAGGAATCGACCGAGATGCATCAAATTCCTGGTGGAACG
ACCAGCAAATCCATTCGATATGCCATCCTTGAATGGGATCCTTTACTTGACAGTAGCAATATAGACATCCAAGAC
TGGATTCGTCTCGCAACCGAGATCGAGTTGAACTACAGCTTTGATGCTTTCGTTATTCTGCATGGAACTGATACC
ATGTCTTACACGTCAAGTGCTTTGAGTTTTTTGTTAGAAGACCTCGGAAAAACAGTGGTCATCACCGGAGCACAA
ATACCTATGTCACAACTTCGGAATGATGCTGTAGATAATCTGATGGGCGCTCTCACAATCGCCGGACACTTCATC
ATTCCAGAATGTTGCCTATACTTCAACCACACGTTGTACCGTGGAAACCGGGCAACAAAAATGTCATCTTATGAC
CTAGCAGCTTTTGAAAGCCCGAACTTTGAACCCCTTGTGAAAGTCGGCATCGATATTGACGTCAACTGGGATCAT
GTCATTCGCCAAACCAGCCTGCGGAAATTTAGAGCCCACAAAGAGATGTGCCCTTATGTCGCAACGCTGCGTCTA
TTTCCGGGTATTGGAGGCGCAACTATTAAAGCATTCTGCAGCCATCCAATCCGTGGCGTGGTTCTTGAAACCTTC
GGCGCGGGCAACGCACCACAACGCCCTGATCTTATCGAAGCGCTGAAAGAAGCCTGCGACAGAGGTGTCGTCGTA
GTAGCCATATCACAATGCGTCAAAGGCTCAGTCTCAGATGCATATGAGACCGCTCGAACACTTCGGCAAGTTGGT
GTAGTGCCTGGGAATGATATGACACCCGAGTGCGCGTTGTCGAAGCTCAGCTATCTGCTCTCTAAATCCGACTTA
ACACTCGACCAAGTCCGAGATCTTATTGGTAAACCATTACGAGGCGAATTGACTAGCCATTCGGTACCAGCTCCC
AGTCAGGATACAAAAGGCAAACCCGCGGCTACCTTAGACTCAAATATAGAAACAATCCACACTGTCCTCTCACAA
TTCGTCCGCCTTGCTCGACCACCGTCCTTTGTCCCCGGGATCAAATTATCTTCCGATGCACTCGCTACCGCAACA
GGAGCTCAAAGCACTGCCGCACCGTGGACGTGGACCGCTGCCGAGGCATCCGCAACCGAATATGTACTCCTACCG
TTCTTAGTCCACTACGCGTCGGCGAAGAACGATTTGGAAAGCCTGCGATACTGCATTGAAATCGAACGGCAGTTT
ACAACCAATCCCGGTGAATCTCCCCGTATAGGGACGGTGAGGTCCGGGAATATCGCAGGTGGTATTGTCAATTGC
TTGGATGCTGGTTCTGGGAGGTCACCTTTACATGTGTCGGCGCTGAATGGTCATATGCAGATTGTTACACTTTTG
TTGCAATCAGGCGCTTTGGTTCATATGAGAGACACGCTCGGACACACAGCGTTATATTATGCTGCGAGACACGGG
CATCTTGACGTCGTTGATATGCTTCTTCAAGCCGGAGCTATCCTTGGTGGGTTTGATACAGAATTTGCCAAGCTG
GGGTTTAAAAACGCTCGTCGTATGGGGGACAAGACCATGTTGAAGGTCTGGGCAAGGGTGGGCATTAAAAAGCCT
GTGCTTGACAAGGAATAA
Gene >Agabi119p4|055190
ATGGACGGTCCTCAACTCGCGGACGAATCCAGGGTGCTCGTCATTTACACAGGCGCGGCTCTCATCTTCCGGCAT
CTCATCACATCTGACATAGCCTGAAGGCGGCACCATTGGAATGCTCGTTGGACAACAAGGATACGTACCGGAACC
ATACTATCTGACGGAAACACTTCGAAGCCAAAACCGCTTCCATGACCCGTTACAGGATTCTCTGTTCTCTAATTC
CGGTACTGTGCAGGGGTTCAGAGAATGGAGCGGGGGAAGTGGAAGGTCAAGCCCTGCACCTTCGCTAACGCAAAC
CACCGCACCTCAGGTAGCTCACTCAACACTCCTCGTGCGATCAACGCGTCCGATAGGCGATGCATCTTTGATTCT
ACTCAACGAACATGTCTTCAGGAATCGACCGAGATGCATCAAAGTTGCCGACAACGTCTACGAGGCACTCTTGCC
TAGTCTCGTCACGCCTCGGAGTAAAGTTCCTGGTGGAACGACCAGCAAATCCATTCGATATGCCATCCTTGAAGT
GAGCTTTCTTACTACAAAATTCAATCATACTTCTAATTTTCACTCCAGTGGGATCCTTTACTTGACAGTAGCAAT
ATAGACATCCAAGGTTTCGTTGCATGTATCTCAGATCGATATAGTGCTGATTCTTGGATTTAAGACTGGATTCGT
CTCGCAACCGAGATCGAGTTGAACTACAGCTTTGATGCTTTCGTTATTCTGCATGGAACTGATACCATGTCTTAC
ACGTCAAGTGCTTTGAGTTTTTTGTTAGAAGACCTCGGAAAAACAGTGGTACGTTCAAGCCTTTTTGAGACATGA
TAATGAGCCAACGTAGCATTCTAGGTCATCACCGGAGCACAAATACCTATGTCACAACTTCGGAATGATGCTGTA
GATAATCTGATGGGCGCTCTCACAATCGCCGGACACTTCATCATTCCAGGTATGGCAAACAGAGCATTTGATTAG
ACCAATTTACGACTTTTCCGGTTGACAGAATGTTGCCTATACTTCAACCACACGTTGTACCGTGGAAACCGGGCA
ACAAAAATGTCATCTTATGACCTAGCAGCTTTTGAAAGCCCGAACTTTGAACCCCTTGTGAAAGGTGTGTCTTGA
TACAGTCGTAATCCCATTGGACATTTCTCATCTAGGTCAACAAGTCGGCATCGATATTGACGTCAACTGGGATCA
TGTCATTCGCCAAACCAGCCTGCGGAAATTTAGAGCCCACAAAGGTCTGTTACATTGCTCTGTAGCCAAAGTTTG
AATTAGTGATATATGAAAAACAGAGATGTGCCCTTATGTCGGTGAGTTTAACATACCTCAGTTGCTGTATCGCTT
CTTTATTCTGGTGGCCGATGATCATTCCAGCAACGCTGCGTCTATTTCCGGGTATTGGAGGCGCAACTATTAAAG
CATTCTGCAGCCATCCAATCCGTGGCGTGGTTCTTGAAACCTTCGGCGCGGGCAACGCACCACAACGCCCTGATC
TTATCGAAGCGCTGAAAGAAGCCTGCGACAGAGGTGTCGTCGTAGTAGCCATATCACAATGCGTCAAAGGCTCAG
TCTCAGATGCATATGAGACCGCTCGAACACTTCGGCAAGTTGGTGTAGTGCCTGGGAATGATATGACACCCGAGG
TATTGGCTCATGGATCTAATCTCCCTCACGTTACTCAACAACCTTTGAAAGTGCGCGTTGTCGAAGCTCAGCTAT
CTGCTCTCTAAATCCGACTTAACACTCGACCAAGTCCGAGATCTTATTGGTAAACCATTACGAGGCGAATTGACT
AGCCATTCGGTACCAGCTCCCAGTCAGGATACAAAAGGCAAACCCGCGGCTACCTTAGACTCAAATATAGAAACA
ATCCACACTGTCCTCTCACAATTCGTCCGCCTTGCTCGACCACCGTCCTTTGTCCCCGGGATCAAATTATCTTCC
GATGCACTCGCTACCGCAACAGGAGCTCAAAGCACTGCCGCACCGTGGACGTGGACCGCTGCCGAGGCATCCGCA
ACCGAATATGTACTCCTACCGTTCTTAGTCCACTACGCGTCGGCGAAGAACGATTTGGAAAGCCTGCGATACTGC
ATTGAAATCGAACGGCAGTTTACAACCAATCCCGGTGAATCTCCCCGTATAGGGACGGTGAGGTCCGGGAATATC
GCAGGTGGTATTGTCAATTGCTTGGATGCTGGTTCTGGGAGGTCACCTTTACATGTGTCGGCGCTGAATGGTCAT
ATGCAGATTGTTACACTTTTGTTGCAATCAGGCGCTTTGGTTCATATGAGAGACACGCTCGGACACACAGCGTTA
TATTATGTACGTTTGATGTCTGATCCCACCGCCACAATCGTGTTCAATTTTCTTCTAAGGCTGCGAGACACGGGC
ATCTTGACGTCGTTGATATGCTTCTTCAAGCCGGAGCTATCCTTGGTGGGTTTGATACAGAATTTGCCAAGCTGG
GGTTTAAAAACGCTCGTCGTATGGGGGACAAGACCATGTTGAAGGTCTGGGCAAGGGTGGGCATTAAAAAGCCTG
TGCTTGACAAGGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail