Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|055140
Gene name
Locationscaffold_03a:667385..670300
Strand-
Gene length (bp)2915
Transcript length (bp)2262
Coding sequence length (bp)2262
Protein length (aa) 754

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12891 Glyco_hydro_44 Glycoside hydrolase family 44 6.1E-68 319 534

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P22533|MANB_CALSA Beta-mannanase/endoglucanase A OS=Caldicellulosiruptor saccharolyticus GN=manA PE=1 SV=2 275 714 4.0E-38
sp|P29719|GUNA_PAELA Endoglucanase A OS=Paenibacillus lautus GN=celA PE=3 SV=1 272 707 2.0E-37

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|055140
MHSGSCFVKLLAFVLAAAISKVAADDLSIYTDNNVNTGWENWSWSSTIDFAATDLIAGSSGSSISVTSEQFAALS
LHYNAAPIKGFEGLQFDIAGDQPDISISIESVADGVISPSMALSSISQSITSDSFTTVLINFNDLPGNGGTLADQ
NWDRISFQAGNNGATYHVDNMLFVESIVITPEFLSAEPLASNVVAVTTKGDVDFSTVRVKLNGNTVRITGKTSYS
PVDTPAQSITYLTLASSLRPGKLVITADGGKSFDYTLSNALSGSINKSVKSPINPHIYGVNFPVSADYIQHLGIT
ISRWGGNAVTAYNPFDGFTNAGADWYFENRGSTDGTAEDWLAWVQGAGSDALLTVPALDWVSKDSTSYSYPVSIY
GEQADTDPFNSDAGNGLFPNGSAVAPPDPTTVYTGWNTSLAQTWLKSLVNKPLMVAIDNEIEIASSTHRDMHPDP
MSYDEELDRVVRFATTAKEAIPDILVVAPSTCCWWFYWTTTVGWDDTTAHNNTDFLPWFLGQMKAVEATTGKRLL
DYLDIHYYFAADTSANDDAAKAKRLRMTRSWWDESYVDESWVGQDPIQNHQPEADRVELIPRFKSLIDTIYPGTK
LSISEWNSQADNDITGGLVTAESLGIFGRHGIDAATYWATPGEKAPAGLAYWLYRGYGTYFGDQTAQVKLYNPDP
DTWSIFAGSDNNKLTLVIINKKPDQALSFNLSNVPTGSYFMRHFGGAAGVAKWQTTITLTTNKFIVVPSYTAVFL
KQQ*
Coding >Agabi119p4|055140
ATGCACAGCGGAAGCTGCTTCGTCAAGCTACTTGCCTTCGTCTTGGCCGCGGCTATCTCAAAAGTAGCTGCTGAC
GACTTGAGCATTTACACAGACAACAACGTCAATACTGGCTGGGAAAATTGGAGTTGGAGCAGTACAATTGACTTT
GCAGCAACCGATCTCATTGCTGGATCTTCTGGAAGTAGTATTTCAGTCACCTCCGAACAGTTTGCGGCTCTCTCG
CTTCACTACAATGCCGCACCCATCAAAGGGTTTGAGGGTCTACAATTCGACATCGCCGGAGACCAACCTGATATT
TCCATCTCGATCGAATCTGTTGCAGATGGTGTCATTTCTCCTTCTATGGCGTTGTCAAGTATCAGCCAATCTATC
ACCTCCGACAGCTTTACCACCGTTCTGATTAATTTCAATGACTTGCCTGGTAATGGAGGCACCCTTGCCGACCAG
AATTGGGACCGTATCAGTTTTCAAGCTGGTAACAATGGTGCAACATATCATGTGGACAATATGCTGTTTGTTGAA
AGTATTGTTATCACACCCGAATTTCTGAGTGCCGAACCTCTCGCAAGTAATGTAGTCGCAGTTACCACCAAGGGC
GATGTCGACTTTTCCACTGTGCGGGTGAAATTGAACGGCAACACTGTCAGAATCACTGGAAAGACGTCATATTCA
CCAGTCGATACCCCTGCCCAATCCATTACCTACTTGACCCTCGCATCTAGCCTTAGGCCTGGTAAACTCGTTATC
ACTGCCGACGGTGGCAAATCTTTCGACTATACTCTGTCCAACGCCCTATCTGGCAGCATTAACAAGAGCGTCAAG
TCACCCATCAATCCTCATATTTATGGTGTCAACTTCCCCGTCAGTGCTGATTATATTCAGCATCTTGGTATCACA
ATTTCGCGTTGGGGTGGTAATGCTGTTACTGCTTACAACCCTTTTGACGGTTTCACCAACGCTGGGGCCGATTGG
TACTTTGAGAATAGAGGCTCTACCGATGGCACGGCAGAAGACTGGTTGGCTTGGGTCCAGGGTGCCGGTTCAGAT
GCGCTCTTGACAGTTCCTGCTCTAGATTGGGTCTCTAAAGACAGTACATCGTACTCATATCCAGTATCTATCTAT
GGAGAGCAGGCGGACACGGACCCATTCAATTCGGACGCAGGGAACGGTCTTTTCCCTAACGGTTCCGCAGTAGCT
CCACCCGATCCTACCACTGTTTATACAGGTTGGAACACTAGCCTTGCCCAAACGTGGCTCAAGAGTCTTGTTAAT
AAACCCCTTATGGTCGCAATCGACAACGAAATCGAAATCGCAAGTAGTACCCACCGGGATATGCATCCCGATCCA
ATGAGCTACGACGAAGAATTGGACCGCGTCGTGCGATTTGCTACTACGGCAAAGGAAGCCATTCCGGATATTTTG
GTTGTGGCGCCTTCTACCTGCTGTTGGTGGTTCTACTGGACCACTACTGTCGGTTGGGATGATACGACGGCACAT
AATAACACTGATTTCTTACCTTGGTTCTTGGGTCAAATGAAGGCGGTCGAGGCGACCACTGGAAAGCGACTTCTT
GATTATCTCGACATTCATTATTACTTCGCGGCTGATACCAGTGCAAATGACGATGCTGCTAAAGCTAAGAGGTTG
AGAATGACCCGTAGCTGGTGGGACGAATCCTACGTCGATGAGTCCTGGGTCGGCCAAGATCCTATCCAGAACCAT
CAACCCGAAGCTGATCGTGTTGAACTCATTCCTCGTTTCAAGTCATTAATAGATACTATCTATCCTGGAACCAAA
CTTTCCATCTCTGAATGGAATTCTCAAGCAGACAATGACATCACTGGCGGCCTTGTAACAGCGGAGTCTCTCGGT
ATCTTTGGTCGGCATGGCATTGATGCCGCTACATACTGGGCAACTCCTGGAGAAAAAGCTCCTGCTGGTTTGGCT
TACTGGCTTTATCGAGGATATGGTACCTACTTCGGAGACCAGACCGCTCAGGTCAAACTTTATAATCCTGACCCT
GACACTTGGAGTATCTTTGCTGGAAGCGACAACAACAAGCTTACTCTTGTCATCATTAACAAGAAACCTGATCAG
GCTCTTTCCTTTAATCTTTCCAATGTCCCGACCGGTTCTTACTTTATGAGACACTTTGGTGGCGCTGCCGGCGTT
GCTAAGTGGCAGACTACGATTACTTTGACTACAAACAAGTTTATTGTTGTTCCTAGCTATACTGCTGTCTTCTTG
AAGCAACAGTAG
Transcript >Agabi119p4|055140
ATGCACAGCGGAAGCTGCTTCGTCAAGCTACTTGCCTTCGTCTTGGCCGCGGCTATCTCAAAAGTAGCTGCTGAC
GACTTGAGCATTTACACAGACAACAACGTCAATACTGGCTGGGAAAATTGGAGTTGGAGCAGTACAATTGACTTT
GCAGCAACCGATCTCATTGCTGGATCTTCTGGAAGTAGTATTTCAGTCACCTCCGAACAGTTTGCGGCTCTCTCG
CTTCACTACAATGCCGCACCCATCAAAGGGTTTGAGGGTCTACAATTCGACATCGCCGGAGACCAACCTGATATT
TCCATCTCGATCGAATCTGTTGCAGATGGTGTCATTTCTCCTTCTATGGCGTTGTCAAGTATCAGCCAATCTATC
ACCTCCGACAGCTTTACCACCGTTCTGATTAATTTCAATGACTTGCCTGGTAATGGAGGCACCCTTGCCGACCAG
AATTGGGACCGTATCAGTTTTCAAGCTGGTAACAATGGTGCAACATATCATGTGGACAATATGCTGTTTGTTGAA
AGTATTGTTATCACACCCGAATTTCTGAGTGCCGAACCTCTCGCAAGTAATGTAGTCGCAGTTACCACCAAGGGC
GATGTCGACTTTTCCACTGTGCGGGTGAAATTGAACGGCAACACTGTCAGAATCACTGGAAAGACGTCATATTCA
CCAGTCGATACCCCTGCCCAATCCATTACCTACTTGACCCTCGCATCTAGCCTTAGGCCTGGTAAACTCGTTATC
ACTGCCGACGGTGGCAAATCTTTCGACTATACTCTGTCCAACGCCCTATCTGGCAGCATTAACAAGAGCGTCAAG
TCACCCATCAATCCTCATATTTATGGTGTCAACTTCCCCGTCAGTGCTGATTATATTCAGCATCTTGGTATCACA
ATTTCGCGTTGGGGTGGTAATGCTGTTACTGCTTACAACCCTTTTGACGGTTTCACCAACGCTGGGGCCGATTGG
TACTTTGAGAATAGAGGCTCTACCGATGGCACGGCAGAAGACTGGTTGGCTTGGGTCCAGGGTGCCGGTTCAGAT
GCGCTCTTGACAGTTCCTGCTCTAGATTGGGTCTCTAAAGACAGTACATCGTACTCATATCCAGTATCTATCTAT
GGAGAGCAGGCGGACACGGACCCATTCAATTCGGACGCAGGGAACGGTCTTTTCCCTAACGGTTCCGCAGTAGCT
CCACCCGATCCTACCACTGTTTATACAGGTTGGAACACTAGCCTTGCCCAAACGTGGCTCAAGAGTCTTGTTAAT
AAACCCCTTATGGTCGCAATCGACAACGAAATCGAAATCGCAAGTAGTACCCACCGGGATATGCATCCCGATCCA
ATGAGCTACGACGAAGAATTGGACCGCGTCGTGCGATTTGCTACTACGGCAAAGGAAGCCATTCCGGATATTTTG
GTTGTGGCGCCTTCTACCTGCTGTTGGTGGTTCTACTGGACCACTACTGTCGGTTGGGATGATACGACGGCACAT
AATAACACTGATTTCTTACCTTGGTTCTTGGGTCAAATGAAGGCGGTCGAGGCGACCACTGGAAAGCGACTTCTT
GATTATCTCGACATTCATTATTACTTCGCGGCTGATACCAGTGCAAATGACGATGCTGCTAAAGCTAAGAGGTTG
AGAATGACCCGTAGCTGGTGGGACGAATCCTACGTCGATGAGTCCTGGGTCGGCCAAGATCCTATCCAGAACCAT
CAACCCGAAGCTGATCGTGTTGAACTCATTCCTCGTTTCAAGTCATTAATAGATACTATCTATCCTGGAACCAAA
CTTTCCATCTCTGAATGGAATTCTCAAGCAGACAATGACATCACTGGCGGCCTTGTAACAGCGGAGTCTCTCGGT
ATCTTTGGTCGGCATGGCATTGATGCCGCTACATACTGGGCAACTCCTGGAGAAAAAGCTCCTGCTGGTTTGGCT
TACTGGCTTTATCGAGGATATGGTACCTACTTCGGAGACCAGACCGCTCAGGTCAAACTTTATAATCCTGACCCT
GACACTTGGAGTATCTTTGCTGGAAGCGACAACAACAAGCTTACTCTTGTCATCATTAACAAGAAACCTGATCAG
GCTCTTTCCTTTAATCTTTCCAATGTCCCGACCGGTTCTTACTTTATGAGACACTTTGGTGGCGCTGCCGGCGTT
GCTAAGTGGCAGACTACGATTACTTTGACTACAAACAAGTTTATTGTTGTTCCTAGCTATACTGCTGTCTTCTTG
AAGCAACAGTAG
Gene >Agabi119p4|055140
ATGCACAGCGGAAGCTGCTTCGTCAAGCTACTTGCCTTCGTCTTGGCCGCGGCTATCTCAAAAGTAGCTGCTGAC
GACTTGAGCATTTACACAGACAACAACGTCAATACTGGCTGGGAAAATTGGAGTTGGAGCAGTACAATTGACTTT
GCAGCAACCGATCTCATTGCTGGATCTTCTGGAAGTAGTATTTCAGTCACCTCCGAACAGTTTGCGGCTCTCTCG
CTTCACTACAATGCCGCACCCATCAAAGGGTTTGAGGGTCTACAATTCGACATCGCCGTAGGTTTTGGAGTGTGT
TTTGAAGTACGACTATAACTGAACTTTCGTGTTACTCAGGGAGACCAACCTGATATTTCCATCTCGATCGAATCT
GTTGCAGATGGTGTCATTTCTCCTTCTATGGCGTTGTCAAGTATCAGCCAATCTATCACCTCCGACAGCTTTACC
ACCGTTCTGATTAATTTCAATGACTTGCCTGGTAATGGAGGCACCCTTGTGAGCCAAGATGCCTTTAGCTTGGAG
AACACTAGCTAATTTCGTATGGAAAAAAGGCCGACCAGAATTGGGACCGTATCAGTTTTCAAGCTGGTAACAATG
GTGCAACAGTTAGTTTTTTTGCAACAATGCTACTGGAACTAAAGTGCTAACCGGTAAATTCGCTAGTATCATGTG
GACAATATGCTGTTTGTTGAAAGTATTGTTATCACACCCGAATTTCTGAGTGCCGAACCTCTCGCAAGTAATGTA
GTCGCAGTTACCACCAAGGGCGATGTCGACTTTTCCACTGTGCGGGTGAAATTGAACGGCAACGTAAGCTATTCA
GTTGGTATTTTAATGCTTGCTTTGACAATCTGCAATGCAAGACTGTCAGAATCACTGGAAAGACGTCATATTCAC
CAGTCGATACCCCTGCCCAATCCATTACCTACTTGACCCTCGCATCTAGCCTTAGGCCTGGTAAACTCGTTATCA
CTGCCGACGGTGGCAAATCTTTCGACTATACTCTGTCCAACGCCCTATCTGGCAGGTATGTTGCCGTCCACCTGC
TTGCGAGCAACACTAATAGGGAGCATTTAGCATTAACAAGAGCGTCAAGTCACCCATCAATCCTCATATTTATGG
TGTCAACTTCCCCGTCAGTGCTGATTATATTCAGCATCTTGGTATCACAATTTCGCGTTGGGGTGGTAATGCTGT
TACTGCTTACAACCCTTTTGACGGTTTCACCAACGCTGGGGCCGATTGGTACTTTGAGAATAGAGGCTCTACCGA
TGGCACGGCAGAAGACTGGTTGGCTTGGGTCCAGGGTGCCGGTTCAGATGCGCTCTTGACAGTTCCTGCGTATGT
ATTGCTTTCGGACCCGCCAATTTCAGTTTTCGATTAATCCTTCTTAAAGTCTAGATTGGGTCTCTAAAGACAGTA
CATCGTACTCATATCCAGTATCTATCTATGGAGGTAATTCATATAAACCTTGTGCTCTCTTGCACTCAAACTAAC
GTCCCGTAGAGCAGGCGGACACGGACCCATTCAATTCGGACGCAGGGAACGGTCTTTTCCCTAACGGTTCCGCAG
TAGCTCCACCCGATCCTACCACTGTTTATACAGGTTGGAACACTAGCCTTGCCCAAACGTGGCTCAAGAGTCTTG
TTAATAAACCCCTTATGGTCGCAATCGACAACGAAATCGAAATCGCAAGTAGTACCCACCGGGATATGCATCCCG
AGTACGTTATTTCAAACTCGCTGATAGTTCTCGGTTTGTTCTTATGATCCACTAGTCCAATGAGCTACGACGAAG
AATTGGACCGCGTCGTGCGATTTGCTACTACGGCAAAGGAAGCCATTCCGGATATTTTGGTTGTGGCGCCTTCTA
CCTGCTGTTGGTGGTTCTGTGAGTAGGACATCTATTCCTATATCAGTTTGATTGAATTGTCCTGCGCAGACTGGA
CCACTACTGTCGGTTGGGATGATACGACGGCACATAATAACACTGATTTCTTACCTTGGTTCTTGGGTCAAATGA
AGGCGGTCGAGGCGACCACTGGAAAGCGACTTCTTGATTATCTCGACATTCATTATTACTTCGCGGCTGATACCA
GTGCAAATGACGATGCTGCTAAAGCTAAGAGGTTGAGAATGACCCGTAGCTGGTGGGTAAGTCGAACGTAACTCC
CCGTGTGGTCGAAAGATGTAATATTCATAAATTATTTAGGACGAATCCTACGTCGATGAGTCCTGGGTCGGCCAA
GATCCTATCCAGAACCATCAACCCGAAGCTGATCGTGTTGAACTCATTCCTCGTTTCAAGTCATTAATAGATACT
ATCTATCCTGGAACCAAACTTTCCATCTCTGAATGGAATTCTCAAGCAGACAATGACATCACTGGCGGCCTTGTA
ACAGCGGAGTCTCTCGGTATCTTTGGTCGGCATGGCATTGATGCCGCTACATACTGGGCAACTCCTGGAGAAAAA
GCTCCTGCTGGTTTGGCTTACTGGCTTTATCGAGGGTATGATATTCGATCTTTTGGTTCAATGCTATTCTAAGCG
ATTTCCGGCCGTCAGATATGGTACCTACTTCGGAGACCAGACCGCTCAGGTCAAACTTTATAATCCTGACCCTGA
CACTTGGAGTATCTTTGCTGGAAGCGACAACAACAAGCTTACTCTTGTCATCATTAACAAGAAACCTGATCAGGC
TCTTTCCTTTAATCTTTCCAATGTCCCGACCGGTTCTTACTTTATGAGACACTTTGGTGGCGCTGCCGGCGTTGC
TAAGTGGCAGGTATGTGATGTGTGGCTCGTATATTTTGTATCCTCTGCTGACCTTTGATTTGTAGACTACGATTA
CTTTGACTACAAACAAGTTTATTGTTGTTCCTAGCTATACTGCTGTCTTCTTGAAGCAACAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail