Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|055130
Gene name
Locationscaffold_03a:664845..666836
Strand-
Gene length (bp)1991
Transcript length (bp)1722
Coding sequence length (bp)1722
Protein length (aa) 574

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03901 Glyco_transf_22 Alg9-like mannosyltransferase family 2.3E-84 10 442

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WPG0|GPI10_ASPFU GPI mannosyltransferase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi10 PE=3 SV=1 4 571 3.0E-76
sp|Q2UH15|GPI10_ASPOR GPI mannosyltransferase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi10 PE=3 SV=1 17 571 4.0E-69
sp|Q6FTY5|GPI10_CANGA GPI mannosyltransferase 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPI10 PE=3 SV=1 13 567 3.0E-67
sp|Q6BH65|GPI10_DEBHA GPI mannosyltransferase 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPI10 PE=3 SV=2 10 571 7.0E-67
sp|Q6CAB8|GPI10_YARLI GPI mannosyltransferase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPI10 PE=3 SV=1 13 572 7.0E-65
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WPG0|GPI10_ASPFU GPI mannosyltransferase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gpi10 PE=3 SV=1 4 571 3.0E-76
sp|Q2UH15|GPI10_ASPOR GPI mannosyltransferase 3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=gpi10 PE=3 SV=1 17 571 4.0E-69
sp|Q6FTY5|GPI10_CANGA GPI mannosyltransferase 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GPI10 PE=3 SV=1 13 567 3.0E-67
sp|Q6BH65|GPI10_DEBHA GPI mannosyltransferase 3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GPI10 PE=3 SV=2 10 571 7.0E-67
sp|Q6CAB8|GPI10_YARLI GPI mannosyltransferase 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GPI10 PE=3 SV=1 13 572 7.0E-65
sp|Q5BCB9|GPI10_EMENI GPI mannosyltransferase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=gpi10 PE=3 SV=1 13 571 4.0E-59
sp|Q1LZA0|PIGB_BOVIN GPI mannosyltransferase 3 OS=Bos taurus GN=PIGB PE=2 SV=1 2 494 6.0E-58
sp|Q4IB63|GPI10_GIBZE GPI mannosyltransferase 3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GPI10 PE=3 SV=1 10 482 4.0E-57
sp|Q7SXZ1|PIGB_DANRE GPI mannosyltransferase 3 OS=Danio rerio GN=pigb PE=2 SV=1 4 494 4.0E-57
sp|Q4V7R2|PIGB_XENLA GPI mannosyltransferase 3 OS=Xenopus laevis GN=pigb PE=2 SV=1 2 484 2.0E-56
sp|Q9VZM5|PIGB_DROME GPI mannosyltransferase 3 OS=Drosophila melanogaster GN=CG12006 PE=2 SV=2 10 494 4.0E-55
sp|Q75BG9|GPI10_ASHGO GPI mannosyltransferase 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GPI10 PE=3 SV=1 1 553 4.0E-55
sp|Q92521|PIGB_HUMAN GPI mannosyltransferase 3 OS=Homo sapiens GN=PIGB PE=2 SV=1 9 494 9.0E-55
sp|Q9JJQ0|PIGB_MOUSE GPI mannosyltransferase 3 OS=Mus musculus GN=Pigb PE=2 SV=2 2 484 3.0E-54
sp|Q5AK24|GPI10_CANAL GPI mannosyltransferase 3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GPI10 PE=3 SV=1 1 482 2.0E-53
sp|P30777|GPI10_YEAST GPI mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI10 PE=1 SV=2 10 567 1.0E-51
sp|Q6CN76|GPI10_KLULA GPI mannosyltransferase 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GPI10 PE=3 SV=1 10 567 2.0E-51
sp|Q9USN0|GPI10_SCHPO GPI mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi10 PE=3 SV=1 10 480 5.0E-44
sp|P86935|GPI10_TRYBB GPI mannosyltransferase 3 OS=Trypanosoma brucei brucei GN=GPI10 PE=2 SV=1 9 480 1.0E-30
sp|P86936|GPI10_TRYB2 GPI mannosyltransferase 3 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=GPI10 PE=3 SV=1 9 480 7.0E-30
sp|Q9P7Q9|ALG9_SCHPO Alpha-1,2-mannosyltransferase alg9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg9 PE=3 SV=1 11 361 2.0E-11
sp|Q5BAX7|SMP3_EMENI GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=smp3 PE=3 SV=2 1 337 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 69 91 22
2 180 202 22
3 214 236 22
4 270 292 22
5 381 403 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|055130
MNRNTVVSSLLIRICVALFTRTVFQPDEYFQSLEPAFHLVFGYGHLTWEWISETPIRSIIYPALNVPVYWFLKAS
GLAYAGAFGDILLILLPKILHGCFAALTDIWLCELARVTLGNDYVSTAHFLSMSSLFHALALSRSLSNSLETSLS
TVAFAYYPWDASSKLSPQVLYNRQRLWKTLIFSALACLIRPTNAVIWVFLYLRLAWSLRRFPRILGKMLSDASLV
AFTALGSMFILDSLYYSRPLFTPYNFLKTNLSSVSLFYGSSPWHYYLTQAIPILCTTALPFTLHGTITTFRQPKH
SSAALGNMLNVILWSISIYSFAGHKEWRFIHPLLPLLHIFAAKSLIDMSPKAQSHVKAKVKTMNARATALIPPLR
RSHLTFLLLSLPASIYVILFYCSGPISVLSYLRSLPVNVTLVDGKQQPQSVGFLMPCHSTPGQAYLHRPTWEVWS
LGCEPPLQGQNLSTYRDQTDIFFASPLTYVTSTFPEVVDTTFPSSPFPASKPGSLSSKSKGTGGEIYVWQHSWPR
HLVFFGTLLERPSVKELLEEKGYVETYRAGREWEGEGERKGGVRVWSW*
Coding >Agabi119p4|055130
ATGAATAGGAATACTGTTGTGTCATCTCTACTCATTCGCATATGTGTCGCCTTGTTCACTCGGACAGTCTTTCAA
CCCGATGAATACTTTCAGTCTCTCGAACCTGCCTTCCATCTTGTTTTCGGCTACGGGCACCTAACTTGGGAATGG
ATCTCTGAGACCCCAATCAGGAGCATAATTTATCCTGCGTTGAATGTTCCGGTCTATTGGTTTTTGAAAGCTAGT
GGTCTGGCGTATGCAGGCGCGTTCGGTGACATTTTACTGATACTTCTACCAAAGATTCTTCACGGCTGCTTTGCC
GCTCTTACGGATATATGGTTGTGCGAGTTGGCACGGGTCACTTTAGGGAACGACTACGTTTCTACAGCACATTTC
CTTTCAATGTCGTCCTTATTTCATGCCTTAGCACTTTCGCGGTCACTCTCTAATTCACTAGAGACATCCTTGTCT
ACCGTTGCCTTCGCTTATTATCCCTGGGATGCGAGCTCTAAACTGAGCCCACAGGTACTTTACAACAGGCAACGC
CTTTGGAAGACATTAATTTTCAGCGCTTTAGCATGCTTAATCAGACCTACCAACGCTGTCATCTGGGTTTTCTTA
TACTTGCGCTTAGCGTGGTCACTACGACGGTTTCCTCGTATACTAGGCAAAATGCTTTCTGACGCTTCTTTGGTC
GCTTTCACTGCCCTTGGAAGCATGTTCATACTGGACTCGCTGTATTACAGTCGACCACTCTTCACACCCTACAAT
TTCCTCAAAACAAATCTCTCCTCTGTGTCTCTTTTCTATGGTTCAAGCCCGTGGCACTACTATTTAACGCAAGCC
ATTCCTATCCTTTGCACCACTGCATTACCTTTTACTCTTCATGGTACCATTACCACTTTTCGACAACCAAAGCAT
AGTAGTGCCGCCCTCGGGAACATGCTCAACGTTATATTATGGTCGATTTCGATCTATTCATTTGCGGGTCACAAA
GAATGGCGATTCATCCATCCGTTGTTACCGCTACTTCATATCTTCGCAGCTAAATCACTCATCGATATGTCACCC
AAAGCTCAATCCCACGTGAAGGCCAAGGTAAAGACTATGAATGCTCGTGCCACAGCTCTCATTCCTCCCTTACGT
CGATCTCACCTCACCTTTCTACTTCTCAGCTTGCCAGCCTCCATCTACGTCATTTTATTTTATTGTAGTGGTCCC
ATCAGCGTTCTATCCTACCTCCGCTCTTTACCTGTGAACGTAACTCTTGTTGATGGAAAGCAACAACCGCAAAGT
GTAGGTTTCCTCATGCCCTGCCATTCAACGCCAGGTCAGGCATATCTACATAGGCCGACTTGGGAAGTCTGGTCT
CTAGGATGTGAACCTCCTCTCCAAGGTCAGAATCTTTCGACGTATCGTGATCAGACAGATATATTCTTTGCCTCG
CCGTTGACATACGTCACTTCGACATTCCCCGAAGTTGTAGATACAACATTCCCTTCTTCCCCCTTCCCTGCTTCG
AAACCTGGATCCCTATCTTCGAAATCCAAAGGCACAGGAGGGGAAATATATGTATGGCAACATTCATGGCCGCGT
CACCTTGTTTTCTTCGGTACTCTCCTTGAGAGACCGAGTGTCAAGGAACTATTGGAAGAAAAAGGTTATGTTGAA
ACGTATCGCGCGGGACGAGAATGGGAGGGCGAAGGAGAAAGGAAAGGCGGAGTGCGTGTTTGGAGCTGGTAA
Transcript >Agabi119p4|055130
ATGAATAGGAATACTGTTGTGTCATCTCTACTCATTCGCATATGTGTCGCCTTGTTCACTCGGACAGTCTTTCAA
CCCGATGAATACTTTCAGTCTCTCGAACCTGCCTTCCATCTTGTTTTCGGCTACGGGCACCTAACTTGGGAATGG
ATCTCTGAGACCCCAATCAGGAGCATAATTTATCCTGCGTTGAATGTTCCGGTCTATTGGTTTTTGAAAGCTAGT
GGTCTGGCGTATGCAGGCGCGTTCGGTGACATTTTACTGATACTTCTACCAAAGATTCTTCACGGCTGCTTTGCC
GCTCTTACGGATATATGGTTGTGCGAGTTGGCACGGGTCACTTTAGGGAACGACTACGTTTCTACAGCACATTTC
CTTTCAATGTCGTCCTTATTTCATGCCTTAGCACTTTCGCGGTCACTCTCTAATTCACTAGAGACATCCTTGTCT
ACCGTTGCCTTCGCTTATTATCCCTGGGATGCGAGCTCTAAACTGAGCCCACAGGTACTTTACAACAGGCAACGC
CTTTGGAAGACATTAATTTTCAGCGCTTTAGCATGCTTAATCAGACCTACCAACGCTGTCATCTGGGTTTTCTTA
TACTTGCGCTTAGCGTGGTCACTACGACGGTTTCCTCGTATACTAGGCAAAATGCTTTCTGACGCTTCTTTGGTC
GCTTTCACTGCCCTTGGAAGCATGTTCATACTGGACTCGCTGTATTACAGTCGACCACTCTTCACACCCTACAAT
TTCCTCAAAACAAATCTCTCCTCTGTGTCTCTTTTCTATGGTTCAAGCCCGTGGCACTACTATTTAACGCAAGCC
ATTCCTATCCTTTGCACCACTGCATTACCTTTTACTCTTCATGGTACCATTACCACTTTTCGACAACCAAAGCAT
AGTAGTGCCGCCCTCGGGAACATGCTCAACGTTATATTATGGTCGATTTCGATCTATTCATTTGCGGGTCACAAA
GAATGGCGATTCATCCATCCGTTGTTACCGCTACTTCATATCTTCGCAGCTAAATCACTCATCGATATGTCACCC
AAAGCTCAATCCCACGTGAAGGCCAAGGTAAAGACTATGAATGCTCGTGCCACAGCTCTCATTCCTCCCTTACGT
CGATCTCACCTCACCTTTCTACTTCTCAGCTTGCCAGCCTCCATCTACGTCATTTTATTTTATTGTAGTGGTCCC
ATCAGCGTTCTATCCTACCTCCGCTCTTTACCTGTGAACGTAACTCTTGTTGATGGAAAGCAACAACCGCAAAGT
GTAGGTTTCCTCATGCCCTGCCATTCAACGCCAGGTCAGGCATATCTACATAGGCCGACTTGGGAAGTCTGGTCT
CTAGGATGTGAACCTCCTCTCCAAGGTCAGAATCTTTCGACGTATCGTGATCAGACAGATATATTCTTTGCCTCG
CCGTTGACATACGTCACTTCGACATTCCCCGAAGTTGTAGATACAACATTCCCTTCTTCCCCCTTCCCTGCTTCG
AAACCTGGATCCCTATCTTCGAAATCCAAAGGCACAGGAGGGGAAATATATGTATGGCAACATTCATGGCCGCGT
CACCTTGTTTTCTTCGGTACTCTCCTTGAGAGACCGAGTGTCAAGGAACTATTGGAAGAAAAAGGTTATGTTGAA
ACGTATCGCGCGGGACGAGAATGGGAGGGCGAAGGAGAAAGGAAAGGCGGAGTGCGTGTTTGGAGCTGGTAA
Gene >Agabi119p4|055130
ATGAATAGGAATACTGTTGTGTCATCTCTACTCATTCGCATATGTGTCGCCTTGTTCACTCGGACAGTCTTTCAA
CCCGATGAATACTTTCAGTCTCTCGAACCTGCCTTCCATCTTGTTTTCGGCTACGGGCACCTAACTTGGGAATGG
ATCTCTGAGACCCCAATCAGGAGCATAATTTATCCTGCGTTGAATGTTCCGGTCTATTGGTTTTTGAAAGCTAGT
GGTCTGGCGTATGCAGGCGCGTTCGGTGACATTTTACTGGTAAGTGGGTCATAATTTTGCGTATTGTGGACCTTA
TTTACACGAGAAATCTAGATACTTCTACCAAAGATTCTTCACGGCTGCTTTGCCGCTCTTACGGATATATGGTTG
TGCGAGTTGGCACGGGTCACTTTAGGGAACGACTACGTTTCTACAGCAGTATGTCCTATGCCATGCATCGCATAC
AATAAACACTGAAGGCTGATGAACAAAAAGCATTTCCTTTCAATGTCGTCCTTATTTCATGCCTTAGCACTTTCG
CGGTCACTCTCTAATTCACTAGAGACATCCTTGTCTACCGTTGCCTTCGCTTATTATCCCTGGGATGCGAGCTCT
AAACTGAGCCCACAGGTACTTTACAACAGGTGTGCCACACTTCATATTGTGATGACTTATCTTTCTCAAATGATC
AGGCAACGCCTTTGGAAGACATTAATTTTCAGCGCTTTAGCATGCTTAATCAGACCTACCAACGCTGTCATCTGG
GTTTTCTTATACTTGCGCTTAGCGTGGTCACTACGACGGTTTCCTCGTATACTAGGCAAAATGCTTTCTGACGCT
TCTTTGGTCGCGTAGGTCGTTTCCCTAGTTGACGCGACATATCATTAAGTCTTGTGATTCATTAGTTTCACTGCC
CTTGGAAGCATGTTCATACTGGACTCGCTGTATTACAGTCGACCACTCTTCACACCCTACAATTTCCTCAAAACA
AATCTCTCCTCTGTGTCTCTTTTCTATGGTTCAAGCCCGTGGCACTACTATTTAACGCAAGCCATTCCTATCCTT
TGCACCACTGCATTACCTTTTACTCTTCATGGTACCATTACCACTTTTCGACAACCAAAGCATAGTAGTGCCGCC
CTCGGGAACATGCTCAACGTTATATTATGGTCGATTTCGATCTATTCATTTGCGGGTCACAAAGAATGGCGATTC
ATCCATCCGTTGTTACCGCTACTTCATATCTTCGCAGCTAAATCACTCATCGATATGTCACCCAAAGCTCAATCC
CACGTGAAGGCCAAGGTAAAGACTATGAATGCTCGTGCCACAGCTCTCATTCCTCCCTTACGTCGATCTCACCTC
ACCTTTCTACTTCTCAGCTTGCCAGCCTCCATCTACGTCATTTTATTTTATTGTAGTGGTCCCATCAGCGTTCTA
TCCTACCTCCGCTCTTTACCTGTGAACGTAACTCTTGTTGATGGAAAGCAACAACCGCAAAGTGTAGGTTTCCTC
ATGCCCTGCCATTCAACGCCAGGTCAGGCATATCTACATAGGCCGACTTGGGAAGTCTGGTCTCTAGGATGTGAA
CCTCCTCTCCAGTAAGTTTATATCGTCCTTAAATCTGCCGTCTTAATGTTGACCATAATTCCTTCAGAGGTCAGA
ATCTTTCGACGTATCGTGATCAGACAGATATATTCTTTGCCTCGCCGTTGACATACGTCACTTCGACATTCCCCG
AAGTTGTAGATACAACATTCCCTTCTTCCCCCTTCCCTGCTTCGAAACCTGGATCCCTATCTTCGAAATCCAAAG
GCACAGGAGGGGAAATATATGTATGGCAACATTCATGGCCGCGTCACCTTGTTTTCTTCGGTACTCTCCTTGAGA
GACCGAGTGTCAAGGAACTATTGGAAGAAAAAGGTTATGTTGAAACGTATCGCGCGGGACGAGAATGGGAGGGCG
AAGGAGAAAGGAAAGGCGGAGTGCGTGTTTGGAGCTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail