Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|054950
Gene name
Locationscaffold_03a:631902..634051
Strand+
Gene length (bp)2149
Transcript length (bp)1794
Coding sequence length (bp)1794
Protein length (aa) 598

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00141 peroxidase Peroxidase 1.7E-26 62 255

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 20 425 7.0E-62
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 70 271 3.0E-18
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 70 196 1.0E-16
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 70 279 1.0E-13
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 70 279 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 20 425 7.0E-62
sp|Q7XZP5|APX5_ARATH L-ascorbate peroxidase 5, peroxisomal OS=Arabidopsis thaliana GN=APX5 PE=1 SV=2 70 271 3.0E-18
sp|Q8GY91|APX6_ARATH Putative L-ascorbate peroxidase 6 OS=Arabidopsis thaliana GN=APX6 PE=2 SV=1 70 196 1.0E-16
sp|Q42564|APX3_ARATH L-ascorbate peroxidase 3, peroxisomal OS=Arabidopsis thaliana GN=APX3 PE=1 SV=1 70 279 1.0E-13
sp|Q0JEQ2|APX3_ORYSJ Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. japonica GN=APX3 PE=3 SV=1 70 279 2.0E-12
sp|Q6ZJJ1|APX4_ORYSJ Probable L-ascorbate peroxidase 4 OS=Oryza sativa subsp. japonica GN=APX4 PE=2 SV=1 70 279 2.0E-12
sp|Q01MI9|APX3_ORYSI Probable L-ascorbate peroxidase 3 OS=Oryza sativa subsp. indica GN=APX3 PE=2 SV=1 70 279 5.0E-12
sp|Q6C7U1|CCPR3_YARLI Putative heme-binding peroxidase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D25366g PE=3 SV=1 70 196 8.0E-12
sp|O49293|PER13_ARATH Peroxidase 13 OS=Arabidopsis thaliana GN=PER13 PE=3 SV=2 67 300 5.0E-11
sp|P0CP54|CCPR_CRYNJ Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CCP1 PE=3 SV=1 70 196 4.0E-10
sp|P0CP55|CCPR_CRYNB Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CCP1 PE=3 SV=1 70 196 4.0E-10
sp|Q6BKY9|CCPR_DEBHA Cytochrome c peroxidase, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CCP1 PE=3 SV=1 71 196 3.0E-09
sp|Q5AEN1|CCPR_CANAL Cytochrome c peroxidase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP1 PE=3 SV=1 62 196 6.0E-09
sp|Q6URB0|CCPR_CRYNH Cytochrome c peroxidase, mitochondrial OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CCP1 PE=3 SV=1 70 196 7.0E-09
sp|Q9UR19|VPL1_PLEER Versatile peroxidase VPL1 OS=Pleurotus eryngii GN=vpl1 PE=1 SV=1 70 234 9.0E-09
sp|O94753|VPL2_PLEER Versatile peroxidase VPL2 OS=Pleurotus eryngii GN=vpl2 PE=1 SV=1 70 234 1.0E-08
sp|Q4WPF8|CCPR_ASPFU Cytochrome c peroxidase, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ccp1 PE=3 SV=1 70 196 2.0E-08
sp|P48534|APX1_PEA L-ascorbate peroxidase, cytosolic OS=Pisum sativum GN=APX1 PE=1 SV=2 70 255 3.0E-08
sp|Q02567|PEM1_PHACH Manganese peroxidase 1 OS=Phanerochaete chrysosporium GN=MNP1 PE=1 SV=1 68 258 4.0E-08
sp|P19136|PEM4_PHACH Manganese peroxidase H4 OS=Phanerochaete chrysosporium PE=1 SV=1 68 243 5.0E-08
sp|Q9LNL0|PER8_ARATH Peroxidase 8 OS=Arabidopsis thaliana GN=PER8 PE=2 SV=1 62 196 1.0E-07
sp|Q6C0Z6|CCPR_YARLI Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCP1 PE=3 SV=1 70 196 1.0E-07
sp|Q93V93|PER44_ARATH Peroxidase 44 OS=Arabidopsis thaliana GN=PER44 PE=2 SV=1 7 196 2.0E-07
sp|Q6FMG7|CCPR_CANGA Cytochrome c peroxidase, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0K08184g PE=3 SV=1 70 196 2.0E-07
sp|P78733|PEM3_PHACH Manganese peroxidase H3 OS=Phanerochaete chrysosporium PE=1 SV=2 68 258 3.0E-07
sp|P00431|CCPR_YEAST Cytochrome c peroxidase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCP1 PE=1 SV=2 70 196 3.0E-07
sp|Q59X94|CCPR2_CANAL Putative heme-binding peroxidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP2 PE=3 SV=1 70 196 5.0E-07
sp|P0C0L1|APX6_ORYSJ Probable L-ascorbate peroxidase 6, chloroplastic OS=Oryza sativa subsp. japonica GN=APX6 PE=2 SV=1 70 259 8.0E-07
sp|A4R606|CCPR2_MAGO7 Putative heme-binding peroxidase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MGG_10368 PE=3 SV=1 70 196 9.0E-07
sp|Q10N21|APX1_ORYSJ L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. japonica GN=APX1 PE=1 SV=1 70 255 1.0E-06
sp|A2XFC7|APX1_ORYSI L-ascorbate peroxidase 1, cytosolic OS=Oryza sativa subsp. indica GN=APX1 PE=2 SV=1 70 255 1.0E-06
sp|P0C0V3|CCPR_EMENI Cytochrome c peroxidase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ccp1 PE=3 SV=1 70 196 1.0E-06
sp|Q7XJ02|APX7_ORYSJ Probable L-ascorbate peroxidase 7, chloroplastic OS=Oryza sativa subsp. japonica GN=APX7 PE=2 SV=1 70 270 2.0E-06
sp|Q6CW24|CCPR_KLULA Cytochrome c peroxidase, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CCP1 PE=3 SV=1 70 196 3.0E-06
sp|Q05431|APX1_ARATH L-ascorbate peroxidase 1, cytosolic OS=Arabidopsis thaliana GN=APX1 PE=1 SV=2 70 255 4.0E-06
sp|Q69SV0|APX8_ORYSJ Probable L-ascorbate peroxidase 8, chloroplastic OS=Oryza sativa subsp. japonica GN=APX8 PE=2 SV=2 70 196 4.0E-06
sp|Q9SJZ2|PER17_ARATH Peroxidase 17 OS=Arabidopsis thaliana GN=PER17 PE=2 SV=1 67 291 5.0E-06
sp|Q6CAB5|CCPR2_YARLI Putative cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0D04268g PE=3 SV=1 70 196 5.0E-06
sp|O23474|PER40_ARATH Peroxidase 40 OS=Arabidopsis thaliana GN=PER40 PE=2 SV=2 67 196 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0006979 response to oxidative stress Yes
GO:0020037 heme binding Yes
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0016209 antioxidant activity No
GO:0003824 catalytic activity No
GO:0050896 response to stimulus No
GO:0046906 tetrapyrrole binding No
GO:0008150 biological_process No
GO:0006950 response to stress No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 574 596 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|054950
MHLVKKLAPSALLLQAQLSLAAYHWPSPQYDALETFMYEGQRGDGSNLASLVHPCRKRSGTNASVPAQWLRLAFH
DIATYNNDNGTGGLDGSIVYELGREENLSIGFNQSLTDFEAFPNKYVSRADLIALGAIFSVATCQGPTIPFRGGR
IDAWTAGDFGTPLPQDDITTLTDSFKRMGFSPSDMVGLIACGHSIGGVTSADEPDIVPPGNDPSKPTIVDFDSTG
NFDNKVVTEYLDGSTQNPLVVTSNQTLASDLKIFISDANQTIRSFADPNQYNSQCQTLLERMINTVAHGVSLTDE
ITMIPAKVHDVQLTIERNQLVFKSSLRLPQPMGQKLNTQRTVTMFWCDRYGDSADCQGNTKSAQSVKTTQDDPNN
SPITFNMGLFFVHYHFVVPIDSKVSISKFWFEVDEHNGTSAAVYNNGGDDYVVQQDQVILVPTLSSSVMRSNGSY
TQTYTNRVGEFFTKVYNITVAVREGSNPSRVYATAYDSAVANFTYAVNTTFDFTRNSSMSPVGGYEFYSGSVEDS
GHQMTLDTFADVDGTTYTDDFRQTTFLDNSPYNAPSDVATKTSTSSSPISFVISAPSLIFGLLLILLPLHVL*
Coding >Agabi119p4|054950
ATGCATTTAGTCAAGAAACTCGCTCCGTCTGCCTTGCTACTCCAAGCGCAGCTGTCTCTCGCAGCCTACCACTGG
CCATCTCCGCAGTACGATGCCCTGGAGACTTTCATGTACGAGGGGCAGCGGGGTGACGGGTCCAATCTTGCCTCG
CTTGTTCATCCTTGCCGCAAGCGCTCGGGAACCAATGCCTCCGTGCCTGCCCAATGGCTTCGCCTTGCTTTTCAC
GACATTGCCACTTACAATAATGACAACGGAACGGGTGGCTTGGATGGGTCCATAGTGTACGAACTTGGGAGGGAG
GAGAACCTTAGCATTGGATTCAATCAGAGTCTTACTGACTTTGAAGCATTCCCCAACAAATATGTCTCTCGTGCT
GACCTGATTGCCCTGGGTGCTATTTTCTCCGTTGCAACTTGTCAAGGGCCCACTATCCCATTCCGAGGCGGCCGG
ATTGACGCGTGGACGGCAGGAGATTTTGGGACTCCCTTACCCCAGGATGACATAACCACTCTGACGGACAGCTTC
AAGAGAATGGGATTTTCGCCTTCAGACATGGTTGGTCTGATTGCATGTGGCCACAGTATCGGTGGTGTCACCAGC
GCCGATGAACCTGATATTGTGCCCCCGGGGAACGATCCGTCCAAACCAACCATTGTCGACTTTGATTCGACTGGT
AATTTTGATAATAAAGTTGTCACAGAATATCTTGATGGATCGACTCAAAATCCCCTCGTTGTAACGTCAAACCAA
ACTCTGGCTTCCGATCTCAAAATTTTTATCAGTGATGCCAACCAGACTATCCGCAGTTTCGCCGATCCGAATCAA
TATAATAGTCAATGTCAGACCTTGTTGGAACGAATGATCAACACTGTTGCACATGGCGTTTCGCTAACAGATGAA
ATCACCATGATTCCGGCAAAAGTGCATGACGTGCAACTGACAATAGAACGCAATCAGCTAGTTTTCAAGTCCAGT
CTTCGACTTCCTCAACCCATGGGCCAGAAACTCAACACTCAAAGGACAGTGACAATGTTTTGGTGTGACAGGTAC
GGAGATTCGGCCGATTGTCAAGGAAATACAAAGTCGGCACAGTCTGTTAAGACTACTCAAGATGATCCTAACAAC
TCGCCGATAACATTCAACATGGGGCTCTTCTTTGTACACTACCACTTCGTCGTACCCATAGACTCGAAAGTGTCG
ATTTCGAAGTTCTGGTTCGAAGTGGACGAGCACAACGGTACCAGCGCAGCTGTTTATAACAACGGTGGCGATGAC
TACGTCGTGCAGCAAGATCAGGTTATATTAGTGCCGACGCTCAGCTCATCAGTGATGCGGTCGAATGGATCATAT
ACACAGACGTACACCAATCGGGTCGGAGAATTTTTCACTAAGGTCTACAACATCACGGTTGCTGTTCGTGAGGGT
AGCAATCCTTCTCGGGTTTACGCTACCGCATACGATAGTGCCGTTGCCAATTTCACGTATGCCGTAAACACCACT
TTTGATTTTACCAGGAATTCTTCCATGTCTCCTGTTGGAGGCTATGAGTTCTACTCTGGATCGGTTGAAGATAGT
GGACACCAGATGACGTTGGATACTTTTGCCGATGTGGACGGCACGACTTACACAGATGACTTCAGACAGACGACG
TTCCTGGACAATTCTCCCTACAATGCTCCTTCGGACGTGGCCACGAAAACATCAACGTCGTCGTCTCCCATTTCA
TTTGTGATATCGGCGCCCAGTCTGATTTTCGGCCTACTGTTAATACTTTTACCGCTTCATGTGCTCTGA
Transcript >Agabi119p4|054950
ATGCATTTAGTCAAGAAACTCGCTCCGTCTGCCTTGCTACTCCAAGCGCAGCTGTCTCTCGCAGCCTACCACTGG
CCATCTCCGCAGTACGATGCCCTGGAGACTTTCATGTACGAGGGGCAGCGGGGTGACGGGTCCAATCTTGCCTCG
CTTGTTCATCCTTGCCGCAAGCGCTCGGGAACCAATGCCTCCGTGCCTGCCCAATGGCTTCGCCTTGCTTTTCAC
GACATTGCCACTTACAATAATGACAACGGAACGGGTGGCTTGGATGGGTCCATAGTGTACGAACTTGGGAGGGAG
GAGAACCTTAGCATTGGATTCAATCAGAGTCTTACTGACTTTGAAGCATTCCCCAACAAATATGTCTCTCGTGCT
GACCTGATTGCCCTGGGTGCTATTTTCTCCGTTGCAACTTGTCAAGGGCCCACTATCCCATTCCGAGGCGGCCGG
ATTGACGCGTGGACGGCAGGAGATTTTGGGACTCCCTTACCCCAGGATGACATAACCACTCTGACGGACAGCTTC
AAGAGAATGGGATTTTCGCCTTCAGACATGGTTGGTCTGATTGCATGTGGCCACAGTATCGGTGGTGTCACCAGC
GCCGATGAACCTGATATTGTGCCCCCGGGGAACGATCCGTCCAAACCAACCATTGTCGACTTTGATTCGACTGGT
AATTTTGATAATAAAGTTGTCACAGAATATCTTGATGGATCGACTCAAAATCCCCTCGTTGTAACGTCAAACCAA
ACTCTGGCTTCCGATCTCAAAATTTTTATCAGTGATGCCAACCAGACTATCCGCAGTTTCGCCGATCCGAATCAA
TATAATAGTCAATGTCAGACCTTGTTGGAACGAATGATCAACACTGTTGCACATGGCGTTTCGCTAACAGATGAA
ATCACCATGATTCCGGCAAAAGTGCATGACGTGCAACTGACAATAGAACGCAATCAGCTAGTTTTCAAGTCCAGT
CTTCGACTTCCTCAACCCATGGGCCAGAAACTCAACACTCAAAGGACAGTGACAATGTTTTGGTGTGACAGGTAC
GGAGATTCGGCCGATTGTCAAGGAAATACAAAGTCGGCACAGTCTGTTAAGACTACTCAAGATGATCCTAACAAC
TCGCCGATAACATTCAACATGGGGCTCTTCTTTGTACACTACCACTTCGTCGTACCCATAGACTCGAAAGTGTCG
ATTTCGAAGTTCTGGTTCGAAGTGGACGAGCACAACGGTACCAGCGCAGCTGTTTATAACAACGGTGGCGATGAC
TACGTCGTGCAGCAAGATCAGGTTATATTAGTGCCGACGCTCAGCTCATCAGTGATGCGGTCGAATGGATCATAT
ACACAGACGTACACCAATCGGGTCGGAGAATTTTTCACTAAGGTCTACAACATCACGGTTGCTGTTCGTGAGGGT
AGCAATCCTTCTCGGGTTTACGCTACCGCATACGATAGTGCCGTTGCCAATTTCACGTATGCCGTAAACACCACT
TTTGATTTTACCAGGAATTCTTCCATGTCTCCTGTTGGAGGCTATGAGTTCTACTCTGGATCGGTTGAAGATAGT
GGACACCAGATGACGTTGGATACTTTTGCCGATGTGGACGGCACGACTTACACAGATGACTTCAGACAGACGACG
TTCCTGGACAATTCTCCCTACAATGCTCCTTCGGACGTGGCCACGAAAACATCAACGTCGTCGTCTCCCATTTCA
TTTGTGATATCGGCGCCCAGTCTGATTTTCGGCCTACTGTTAATACTTTTACCGCTTCATGTGCTCTGA
Gene >Agabi119p4|054950
ATGCATTTAGTCAAGAAACTCGCTCCGTCTGCCTTGCTACTCCAAGCGCAGCTGTCTCTCGCAGCCTACCACTGG
CCATCTCCGCAGTACGATGCCCTGGAGACTTTCATGTACGAGGGGCAGCGGGGTGACGGGTCCAATCTTGCCTCG
CTTGTTCATCCTTGCCGCAAGCGCTCGGGAACCAATGCCTCCGTGCCTGCCCAATGGCTTCGCCTTGTGGGTTTC
GATACACTTTCTCGTCATGCTTCGACTTATAACTGAGGACAGGCTTTTCACGACATTGCCACTTACAATAATGAC
AACGGAACGGGTGGCTTGGATGGGTCCATAGTGTACGAACTTGGGAGGGAGGAGGTTTGTGGTCACACCATGTGC
TTGCCATAAGAATTGCTAAATCCTTGCATCAGAACCTTAGCATTGGATTCAATCAGAGTCTTACTGACTTTGAAG
CATTCCCCAACAAATATGTCTCTCGTCAGTATTCGACTCACCAGGAATTCGGCTTTCCTGACTATATCAATAGGT
GCTGACCTGATTGCCCTGGGTGCTATTTTCTCCGTTGCAACTTGTCAAGGGCCCACTATCCCATTCCGAGGCGGC
CGGATTGACGCGTGGACGGCAGGAGATTTTGGGACTCCCTTACCCCAGGATGACATAACCACTCTGACGGACAGC
TTCAAGAGAATGGGATTTTCGCCTTCAGACATGGTTGGTCTGATTGCATGTGGCCACAGTATCGGTGGTGTCACC
AGCGCCGATGAACCTGATATTGTGCCCCCGGGGAACGATCCGTCCAAACCAACCATTGTCGACTTTGATTCGACT
GGTAATTTTGATAATAAAGTGTATGTCAGCGCTCTGGATCCGCGTTTTTATTTGCTGACCAGGAGCTACAGTGTC
ACAGAATATCTTGATGGATCGACTCAAAATCCCCTCGTTGTAACGTCAAACCAAACTCTGGCTTCCGATCTCAAA
ATTTTTATCAGTGATGCCAACCAGACTATCCGCAGGTGAGCAAGTTGACAGGTTTGTTTGTACTTGCCTAAATCC
TCTGCCAGTTTCGCCGATCCGAATCAATATAATAGTCAATGTCAGACCTTGTTGGAACGAATGATCAACACTGTT
GCACATGGCGTTTCGCTAACAGATGAAATCACCATGATTCCGGCAAAAGTGCATGACGTGCAACTGACAATAGAA
CGCAATCAGCTAGTTTTCAAGTCCAGTCTTCGAGTACGTCGGTTTTTGATCCTGGTCAGATTTCCACGCTGATGC
AAAAGTCAAGCTTCCTCAACCCATGGGCCAGAAACTCAACACTCAAAGGACAGTGACAATGTTTTGGTGTGACAG
GTACGGAGATTCGGCCGATTGTCAAGGAAATACAAAGTCGGCACAGTCTGTTAAGACTACTCAAGATGATCCTAA
CAACTCGCCGATAACATTCAACATGGGGCTCTTCTTTGTACACTACCACTTCGTCGTACCCATAGACTCGAAAGT
GTCGATTTCGAAGTTCTGGTTCGAAGTGGACGAGCACAACGGTACCAGCGCAGCTGTTTATAACAACGGTGGCGA
TGACTACGTCGTGCAGCAAGATCAGGTTATATTAGTGCCGACGCTCAGCTCATCAGTGATGCGGTCGAATGGATC
ATATACACAGACGTACACCAATCGGGTCGGAGAATTTTTCACTAAGGTCTACAACATCACGGTTGCTGTGAGTTA
GTCTCTTCACGTTTGCACGACATTATCAACTCAGTATTATCAGGTTCGTGAGGGTAGCAATCCTTCTCGGGTTTA
CGCTACCGCATACGATAGTGCCGTTGCCAATTTCACGTATGCCGTAAACACCACTTTTGATTTTACCAGGAATTC
TTCCATGTCTCCTGTTGGAGGCTATGAGTTCTACTCTGGATCGGTTGAAGATAGTGGACACCAGATGACGTTGGA
TACTTTTGCCGATGTGGACGGCACGACTTACACAGATGACTTCAGACAGACGACGTTCCTGGACAATTCTCCCTA
CAATGCTCCTTCGGACGTGGCCACGAAAACATCAACGTCGTCGTCTCCCATTTCATTTGTGATATCGGCGCCCAG
TCTGATTTTCGGCCTACTGTTAATACTTTTACCGCTTCATGTGCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail