© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|054860 |
| Gene name | |
| Location | scaffold_03a:591758..592980 |
| Strand | + |
| Gene length (bp) | 1222 |
| Transcript length (bp) | 936 |
| Coding sequence length (bp) | 936 |
| Protein length (aa) | 312 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00227 | Proteasome | Proteasome subunit | 2.6E-49 | 80 | 262 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P30656|PSB5_YEAST | Proteasome subunit beta type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE2 PE=1 SV=3 | 1 | 281 | 7.0E-121 |
| sp|P30655|PSB5_SCHPO | Probable proteasome subunit beta type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pts1 PE=3 SV=3 | 52 | 281 | 3.0E-108 |
| sp|Q54BC8|PSB5_DICDI | Proteasome subunit beta type-5 OS=Dictyostelium discoideum GN=psmB5 PE=1 SV=1 | 50 | 287 | 2.0E-99 |
| sp|P28063|PSB8_MOUSE | Proteasome subunit beta type-8 OS=Mus musculus GN=Psmb8 PE=1 SV=2 | 50 | 281 | 2.0E-97 |
| sp|Q32KL2|PSB5_BOVIN | Proteasome subunit beta type-5 OS=Bos taurus GN=PSMB5 PE=1 SV=1 | 77 | 279 | 7.0E-96 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P30656|PSB5_YEAST | Proteasome subunit beta type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE2 PE=1 SV=3 | 1 | 281 | 7.0E-121 |
| sp|P30655|PSB5_SCHPO | Probable proteasome subunit beta type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pts1 PE=3 SV=3 | 52 | 281 | 3.0E-108 |
| sp|Q54BC8|PSB5_DICDI | Proteasome subunit beta type-5 OS=Dictyostelium discoideum GN=psmB5 PE=1 SV=1 | 50 | 287 | 2.0E-99 |
| sp|P28063|PSB8_MOUSE | Proteasome subunit beta type-8 OS=Mus musculus GN=Psmb8 PE=1 SV=2 | 50 | 281 | 2.0E-97 |
| sp|Q32KL2|PSB5_BOVIN | Proteasome subunit beta type-5 OS=Bos taurus GN=PSMB5 PE=1 SV=1 | 77 | 279 | 7.0E-96 |
| sp|Q5R8S2|PSB5_PONAB | Proteasome subunit beta type-5 OS=Pongo abelii GN=PSMB5 PE=2 SV=3 | 78 | 287 | 1.0E-95 |
| sp|P28074|PSB5_HUMAN | Proteasome subunit beta type-5 OS=Homo sapiens GN=PSMB5 PE=1 SV=3 | 78 | 287 | 1.0E-95 |
| sp|P28075|PSB5_RAT | Proteasome subunit beta type-5 OS=Rattus norvegicus GN=Psmb5 PE=1 SV=3 | 77 | 287 | 2.0E-95 |
| sp|P28064|PSB8_RAT | Proteasome subunit beta type-8 OS=Rattus norvegicus GN=Psmb8 PE=1 SV=3 | 50 | 281 | 2.0E-95 |
| sp|O55234|PSB5_MOUSE | Proteasome subunit beta type-5 OS=Mus musculus GN=Psmb5 PE=1 SV=3 | 77 | 279 | 3.0E-95 |
| sp|Q5W416|PSB8_CANLF | Proteasome subunit beta type-8 OS=Canis lupus familiaris GN=PSMB8 PE=1 SV=1 | 50 | 281 | 9.0E-95 |
| sp|P28062|PSB8_HUMAN | Proteasome subunit beta type-8 OS=Homo sapiens GN=PSMB8 PE=1 SV=3 | 50 | 281 | 1.0E-92 |
| sp|O23717|PSB5A_ARATH | Proteasome subunit beta type-5-A OS=Arabidopsis thaliana GN=PBE1 PE=1 SV=1 | 36 | 280 | 7.0E-92 |
| sp|Q3T112|PSB8_BOVIN | Proteasome subunit beta type-8 OS=Bos taurus GN=PSMB8 PE=1 SV=2 | 50 | 281 | 1.0E-91 |
| sp|P34065|PSB5_CHICK | Proteasome subunit beta type-5 (Fragment) OS=Gallus gallus GN=PSMB5 PE=2 SV=2 | 74 | 279 | 1.0E-91 |
| sp|Q9LIP2|PSB5B_ARATH | Proteasome subunit beta type-5-B OS=Arabidopsis thaliana GN=PBE2 PE=1 SV=1 | 50 | 280 | 2.0E-89 |
| sp|O24361|PSB5_SPIOL | Proteasome subunit beta type-5 OS=Spinacia oleracea PE=2 SV=1 | 46 | 281 | 5.0E-87 |
| sp|A5LHX3|PSB11_HUMAN | Proteasome subunit beta type-11 OS=Homo sapiens GN=PSMB11 PE=2 SV=1 | 52 | 281 | 2.0E-65 |
| sp|Q8BG41|PSB11_MOUSE | Proteasome subunit beta type-11 OS=Mus musculus GN=Psmb11 PE=1 SV=1 | 52 | 281 | 4.0E-62 |
| sp|Q29576|PSB8_PIG | Proteasome subunit beta type-8 (Fragment) OS=Sus scrofa GN=PSMB8 PE=1 SV=1 | 147 | 250 | 3.0E-43 |
| sp|A2SS78|PSB_METLZ | Proteasome subunit beta OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=psmB PE=3 SV=1 | 68 | 270 | 6.0E-34 |
| sp|B8GG66|PSB_METPE | Proteasome subunit beta OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=psmB PE=3 SV=1 | 82 | 267 | 2.0E-33 |
| sp|D3E0A3|PSB_METRM | Proteasome subunit beta OS=Methanobrevibacter ruminantium (strain ATCC 35063 / DSM 1093 / JCM 13430 / OCM 146 / M1) GN=psmB PE=3 SV=1 | 82 | 275 | 5.0E-32 |
| sp|A3CUS9|PSB_METMJ | Proteasome subunit beta OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=psmB PE=3 SV=1 | 79 | 268 | 1.0E-31 |
| sp|D3RX66|PSB_FERPA | Proteasome subunit beta OS=Ferroglobus placidus (strain DSM 10642 / AEDII12DO) GN=psmB PE=3 SV=1 | 79 | 267 | 2.0E-31 |
| sp|Q2FQL8|PSB_METHJ | Proteasome subunit beta OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=psmB PE=3 SV=1 | 82 | 278 | 4.0E-31 |
| sp|A9A2U7|PSB2_NITMS | Proteasome subunit beta 2 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB2 PE=3 SV=1 | 75 | 270 | 8.0E-31 |
| sp|A7I841|PSB_METB6 | Proteasome subunit beta OS=Methanoregula boonei (strain 6A8) GN=psmB PE=3 SV=1 | 83 | 277 | 9.0E-31 |
| sp|D2RGT4|PSB_ARCPA | Proteasome subunit beta OS=Archaeoglobus profundus (strain DSM 5631 / JCM 9629 / NBRC 100127 / Av18) GN=psmB PE=3 SV=1 | 79 | 278 | 1.0E-30 |
| sp|Q18GX3|PSB_HALWD | Proteasome subunit beta OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmB PE=3 SV=1 | 67 | 278 | 1.0E-29 |
| sp|A2BN27|PSB2_HYPBU | Proteasome subunit beta 2 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB2 PE=3 SV=1 | 77 | 273 | 2.0E-29 |
| sp|A5UM14|PSB_METS3 | Proteasome subunit beta OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmB PE=3 SV=1 | 79 | 270 | 5.0E-29 |
| sp|B1L6S7|PSB1_KORCO | Proteasome subunit beta 1 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB1 PE=3 SV=1 | 80 | 281 | 6.0E-29 |
| sp|A0RXV1|PSB2_CENSY | Proteasome subunit beta 2 OS=Cenarchaeum symbiosum (strain A) GN=psmB2 PE=3 SV=2 | 75 | 270 | 2.0E-28 |
| sp|D5EAS6|PSB_METMS | Proteasome subunit beta OS=Methanohalophilus mahii (strain ATCC 35705 / DSM 5219 / SLP) GN=psmB PE=3 SV=1 | 82 | 278 | 2.0E-28 |
| sp|Q9P996|PSB_ARCFU | Proteasome subunit beta OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmB PE=1 SV=1 | 79 | 267 | 3.0E-28 |
| sp|A8AB58|PSB2_IGNH4 | Proteasome subunit beta 2 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB2 PE=3 SV=1 | 83 | 266 | 4.0E-28 |
| sp|Q9YER0|PSB2_AERPE | Proteasome subunit beta 2 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB2 PE=3 SV=2 | 80 | 268 | 7.0E-28 |
| sp|O27270|PSB_METTH | Proteasome subunit beta OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmB PE=3 SV=1 | 83 | 277 | 1.0E-27 |
| sp|A0B5B1|PSB_METTP | Proteasome subunit beta OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=psmB PE=3 SV=1 | 82 | 278 | 3.0E-27 |
| sp|Q46G14|PSB_METBF | Proteasome subunit beta OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmB PE=3 SV=1 | 79 | 267 | 5.0E-27 |
| sp|D4GYZ1|PSB_HALVD | Proteasome subunit beta OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmB PE=1 SV=1 | 67 | 269 | 7.0E-27 |
| sp|Q0W2D6|PSB_METAR | Proteasome subunit beta OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=psmB PE=3 SV=1 | 82 | 277 | 4.0E-26 |
| sp|C9REN7|PSB_METVM | Proteasome subunit beta OS=Methanocaldococcus vulcanius (strain ATCC 700851 / DSM 12094 / M7) GN=psmB PE=3 SV=1 | 81 | 278 | 4.0E-26 |
| sp|A7KE01|PB6LA_SALSA | Proteasome subunit beta type-6-A like protein OS=Salmo salar GN=psmb6l-a PE=3 SV=1 | 80 | 270 | 5.0E-26 |
| sp|Q2NI68|PSB_METST | Proteasome subunit beta OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=psmB PE=3 SV=1 | 82 | 278 | 6.0E-26 |
| sp|A3DN27|PSB2_STAMF | Proteasome subunit beta 2 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB2 PE=3 SV=1 | 79 | 259 | 8.0E-26 |
| sp|A4YIE0|PSB1_METS5 | Proteasome subunit beta 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB1 PE=3 SV=1 | 77 | 266 | 9.0E-26 |
| sp|D1Z199|PSB_METPS | Proteasome subunit beta OS=Methanocella paludicola (strain DSM 17711 / JCM 13418 / NBRC 101707 / SANAE) GN=psmB PE=3 SV=1 | 82 | 255 | 1.0E-25 |
| sp|Q975D1|PSB2_SULTO | Proteasome subunit beta 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB2 PE=3 SV=1 | 73 | 268 | 2.0E-25 |
| sp|A7KII6|PB6LB_SALSA | Proteasome subunit beta type-6-B like protein OS=Salmo salar GN=psmb6l-b PE=3 SV=1 | 80 | 270 | 2.0E-25 |
| sp|Q12YV7|PSB_METBU | Proteasome subunit beta OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=psmB PE=3 SV=1 | 83 | 268 | 2.0E-25 |
| sp|Q8PZ04|PSB_METMA | Proteasome subunit beta OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmB PE=3 SV=1 | 79 | 267 | 2.0E-25 |
| sp|Q8TJB5|PSB_METAC | Proteasome subunit beta OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmB PE=3 SV=1 | 79 | 267 | 4.0E-25 |
| sp|B1YDJ0|PSB2_PYRNV | Proteasome subunit beta 2 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB2 PE=3 SV=1 | 81 | 262 | 1.0E-24 |
| sp|Q9P992|PSB_METTE | Proteasome subunit beta OS=Methanosarcina thermophila GN=psmB PE=3 SV=1 | 79 | 267 | 1.0E-24 |
| sp|Q8ZST5|PSB2_PYRAE | Proteasome subunit beta 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB2 PE=3 SV=1 | 79 | 266 | 2.0E-24 |
| sp|A3DN21|PSB1_STAMF | Proteasome subunit beta 1 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=psmB1 PE=3 SV=1 | 85 | 269 | 2.0E-24 |
| sp|A2BN24|PSB1_HYPBU | Proteasome subunit beta 1 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=psmB1 PE=3 SV=1 | 83 | 265 | 2.0E-24 |
| sp|A3MS44|PSB1_PYRCJ | Proteasome subunit beta 1 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB1 PE=3 SV=1 | 84 | 267 | 3.0E-24 |
| sp|O43063|PSB1_SCHPO | Probable proteasome subunit beta type-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pre3 PE=3 SV=1 | 79 | 268 | 4.0E-24 |
| sp|A1RWY6|PSB1_THEPD | Proteasome subunit beta 1 OS=Thermofilum pendens (strain Hrk 5) GN=psmB1 PE=3 SV=1 | 75 | 266 | 4.0E-24 |
| sp|C7P6N4|PSB_METFA | Proteasome subunit beta OS=Methanocaldococcus fervens (strain DSM 4213 / JCM 157852 / AG86) GN=psmB PE=3 SV=1 | 80 | 281 | 4.0E-24 |
| sp|A1RTI7|PSB2_PYRIL | Proteasome subunit beta 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB2 PE=3 SV=1 | 84 | 267 | 7.0E-24 |
| sp|A4WH05|PSB1_PYRAR | Proteasome subunit beta 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB1 PE=3 SV=1 | 84 | 270 | 1.0E-23 |
| sp|Q8TW10|PSB_METKA | Proteasome subunit beta OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmB PE=3 SV=1 | 79 | 278 | 2.0E-23 |
| sp|B1L6X8|PSB2_KORCO | Proteasome subunit beta 2 OS=Korarchaeum cryptofilum (strain OPF8) GN=psmB2 PE=3 SV=1 | 85 | 270 | 3.0E-23 |
| sp|A1RSJ8|PSB1_PYRIL | Proteasome subunit beta 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=psmB1 PE=3 SV=1 | 79 | 266 | 3.0E-23 |
| sp|P28061|PSB_THEAC | Proteasome subunit beta OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmB PE=1 SV=1 | 80 | 267 | 3.0E-23 |
| sp|B9LTS6|PSB_HALLT | Proteasome subunit beta OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=psmB PE=3 SV=1 | 79 | 269 | 1.0E-22 |
| sp|Q97AZ7|PSB_THEVO | Proteasome subunit beta OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmB PE=3 SV=1 | 80 | 267 | 1.0E-22 |
| sp|A4WMZ0|PSB2_PYRAR | Proteasome subunit beta 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=psmB2 PE=3 SV=1 | 79 | 266 | 1.0E-22 |
| sp|D3S8M7|PSB_METSF | Proteasome subunit beta OS=Methanocaldococcus sp. (strain FS406-22) GN=psmB PE=3 SV=1 | 80 | 279 | 1.0E-22 |
| sp|A9A4A1|PSB1_NITMS | Proteasome subunit beta 1 OS=Nitrosopumilus maritimus (strain SCM1) GN=psmB1 PE=3 SV=1 | 83 | 268 | 1.0E-22 |
| sp|Q58634|PSB_METJA | Proteasome subunit beta OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmB PE=1 SV=1 | 80 | 279 | 1.0E-22 |
| sp|Q8ZYF2|PSB1_PYRAE | Proteasome subunit beta 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=psmB1 PE=3 SV=1 | 84 | 267 | 2.0E-22 |
| sp|Q9UXF3|PSB2_SULSO | Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB2 PE=3 SV=2 | 79 | 278 | 2.0E-22 |
| sp|D0KTH0|PSB2_SULS9 | Proteasome subunit beta 2 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB2 PE=3 SV=2 | 79 | 278 | 2.0E-22 |
| sp|A4FYA5|PSB_METM5 | Proteasome subunit beta OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmB PE=3 SV=1 | 83 | 275 | 3.0E-22 |
| sp|Q4JAY3|PSB1_SULAC | Proteasome subunit beta 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB1 PE=3 SV=1 | 85 | 270 | 3.0E-22 |
| sp|Q4JAA8|PSB2_SULAC | Proteasome subunit beta 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=psmB2 PE=3 SV=1 | 75 | 268 | 5.0E-22 |
| sp|Q980L4|PSB1_SULSO | Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmB1 PE=3 SV=1 | 85 | 266 | 7.0E-22 |
| sp|D0KRX1|PSB1_SULS9 | Proteasome subunit beta 1 OS=Sulfolobus solfataricus (strain 98/2) GN=psmB1 PE=3 SV=1 | 85 | 266 | 7.0E-22 |
| sp|D3SSQ6|PSB_NATMM | Proteasome subunit beta OS=Natrialba magadii (strain ATCC 43099 / DSM 3394 / NCIMB 2190 / MS3) GN=psmB PE=3 SV=1 | 94 | 278 | 7.0E-22 |
| sp|A8AA46|PSB1_IGNH4 | Proteasome subunit beta 1 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=psmB1 PE=3 SV=1 | 83 | 262 | 8.0E-22 |
| sp|Q8U4C9|PSB1_PYRFU | Proteasome subunit beta 1 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB1 PE=3 SV=1 | 81 | 255 | 1.0E-21 |
| sp|Q60692|PSB6_MOUSE | Proteasome subunit beta type-6 OS=Mus musculus GN=Psmb6 PE=1 SV=3 | 79 | 268 | 1.0E-21 |
| sp|A6VK02|PSB_METM7 | Proteasome subunit beta OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmB PE=3 SV=1 | 83 | 275 | 1.0E-21 |
| sp|A9A788|PSB_METM6 | Proteasome subunit beta OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmB PE=3 SV=1 | 83 | 275 | 1.0E-21 |
| sp|A6UT20|PSB_META3 | Proteasome subunit beta OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=psmB PE=3 SV=1 | 83 | 278 | 1.0E-21 |
| sp|Q9PT26|PSB9_ONCMY | Proteasome subunit beta type-9 OS=Oncorhynchus mykiss GN=psmb9 PE=2 SV=1 | 79 | 272 | 1.0E-21 |
| sp|A3MXQ6|PSB2_PYRCJ | Proteasome subunit beta 2 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=psmB2 PE=3 SV=1 | 79 | 266 | 2.0E-21 |
| sp|C3NHF1|PSB2_SULIN | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB2 PE=3 SV=1 | 79 | 268 | 2.0E-21 |
| sp|Q9DD33|PSB9_SALSA | Proteasome subunit beta type-9 OS=Salmo salar GN=psmb9-a PE=2 SV=1 | 79 | 272 | 2.0E-21 |
| sp|C3NE98|PSB1_SULIY | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB1 PE=3 SV=1 | 79 | 268 | 3.0E-21 |
| sp|C3MVD5|PSB1_SULIM | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB1 PE=3 SV=1 | 79 | 268 | 3.0E-21 |
| sp|C3MQ16|PSB1_SULIL | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB1 PE=3 SV=1 | 79 | 268 | 3.0E-21 |
| sp|C4KHB0|PSB1_SULIK | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB1 PE=3 SV=1 | 79 | 268 | 3.0E-21 |
| sp|D2PK63|PSB1_SULID | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB1 PE=3 SV=1 | 79 | 268 | 3.0E-21 |
| sp|C3N5N4|PSB1_SULIA | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB1 PE=3 SV=1 | 79 | 268 | 3.0E-21 |
| sp|Q6L181|PSB_PICTO | Proteasome subunit beta OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=psmB PE=3 SV=1 | 80 | 259 | 3.0E-21 |
| sp|Q3MHN0|PSB6_BOVIN | Proteasome subunit beta type-6 OS=Bos taurus GN=PSMB6 PE=1 SV=1 | 79 | 266 | 3.0E-21 |
| sp|Q8LD27|PSB6_ARATH | Proteasome subunit beta type-6 OS=Arabidopsis thaliana GN=PBA1 PE=1 SV=2 | 73 | 285 | 4.0E-21 |
| sp|P28073|PSB6_RAT | Proteasome subunit beta type-6 OS=Rattus norvegicus GN=Psmb6 PE=1 SV=3 | 79 | 268 | 4.0E-21 |
| sp|B1YA36|PSB1_PYRNV | Proteasome subunit beta 1 OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=psmB1 PE=3 SV=1 | 84 | 267 | 4.0E-21 |
| sp|P28072|PSB6_HUMAN | Proteasome subunit beta type-6 OS=Homo sapiens GN=PSMB6 PE=1 SV=4 | 79 | 266 | 5.0E-21 |
| sp|B5IEE5|PSB_ACIB4 | Proteasome subunit beta OS=Aciduliprofundum boonei (strain DSM 19572 / T469) GN=psmB PE=3 SV=1 | 92 | 277 | 5.0E-21 |
| sp|Q975U8|PSB1_SULTO | Proteasome subunit beta 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=psmB1 PE=3 SV=1 | 85 | 270 | 7.0E-21 |
| sp|B6YSW2|PSB1_THEON | Proteasome subunit beta 1 OS=Thermococcus onnurineus (strain NA1) GN=psmB1 PE=3 SV=1 | 82 | 278 | 8.0E-21 |
| sp|A0RU86|PSB1_CENSY | Proteasome subunit beta 1 OS=Cenarchaeum symbiosum (strain A) GN=psmB1 PE=3 SV=1 | 83 | 266 | 9.0E-21 |
| sp|D2RQX3|PSB1_HALTV | Proteasome subunit beta 1 OS=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) GN=psmB1 PE=3 SV=1 | 94 | 278 | 1.0E-20 |
| sp|Q55GJ6|PSB6_DICDI | Proteasome subunit beta type-6 OS=Dictyostelium discoideum GN=psmB6 PE=1 SV=1 | 80 | 266 | 1.0E-20 |
| sp|Q5V1D5|PSB2_HALMA | Proteasome subunit beta 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmB2 PE=3 SV=1 | 80 | 269 | 1.0E-20 |
| sp|Q5V4S6|PSB1_HALMA | Proteasome subunit beta 1 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmB1 PE=3 SV=1 | 94 | 278 | 1.0E-20 |
| sp|Q5JDJ9|PSB1_THEKO | Proteasome subunit beta 1 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB1 PE=3 SV=1 | 82 | 267 | 1.0E-20 |
| sp|A4YJ04|PSB2_METS5 | Proteasome subunit beta 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=psmB2 PE=3 SV=1 | 84 | 266 | 1.0E-20 |
| sp|Q3IPX1|PSB_NATPD | Proteasome subunit beta OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=psmB PE=3 SV=1 | 94 | 278 | 2.0E-20 |
| sp|A8M8R5|PSB2_CALMQ | Proteasome subunit beta 2 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB2 PE=3 SV=1 | 85 | 267 | 2.0E-20 |
| sp|Q6LZD4|PSB_METMP | Proteasome subunit beta OS=Methanococcus maripaludis (strain S2 / LL) GN=psmB PE=3 SV=1 | 83 | 275 | 2.0E-20 |
| sp|Q3SZC2|PSB9_BOVIN | Proteasome subunit beta type-9 OS=Bos taurus GN=PSMB9 PE=1 SV=1 | 79 | 268 | 2.0E-20 |
| sp|A6USJ3|PSB_METVS | Proteasome subunit beta OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmB PE=3 SV=1 | 83 | 278 | 2.0E-20 |
| sp|C3N7K2|PSB2_SULIY | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmB2 PE=3 SV=1 | 85 | 266 | 3.0E-20 |
| sp|C3MY41|PSB2_SULIM | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmB2 PE=3 SV=1 | 85 | 266 | 3.0E-20 |
| sp|C3MRE5|PSB2_SULIL | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmB2 PE=3 SV=1 | 85 | 266 | 3.0E-20 |
| sp|C4KIR0|PSB2_SULIK | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmB2 PE=3 SV=1 | 85 | 266 | 3.0E-20 |
| sp|D2PDG6|PSB2_SULID | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain L.D.8.5 / Lassen #2) GN=psmB2 PE=3 SV=1 | 85 | 266 | 3.0E-20 |
| sp|C3MZI0|PSB2_SULIA | Proteasome subunit beta 2 OS=Sulfolobus islandicus (strain M.16.27) GN=psmB2 PE=3 SV=1 | 85 | 266 | 3.0E-20 |
| sp|C3NFX2|PSB1_SULIN | Proteasome subunit beta 1 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmB1 PE=3 SV=1 | 85 | 266 | 3.0E-20 |
| sp|Q09841|PSB2_SCHPO | Probable proteasome subunit beta type-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup1 PE=2 SV=1 | 83 | 265 | 3.0E-20 |
| sp|Q8UW64|PSB9_ORYLA | Proteasome subunit beta type-9 OS=Oryzias latipes GN=psmb9 PE=3 SV=1 | 79 | 272 | 3.0E-20 |
| sp|C7NQ99|PSB_HALUD | Proteasome subunit beta OS=Halorhabdus utahensis (strain DSM 12940 / JCM 11049 / AX-2) GN=psmB PE=3 SV=1 | 94 | 269 | 8.0E-20 |
| sp|P28065|PSB9_HUMAN | Proteasome subunit beta type-9 OS=Homo sapiens GN=PSMB9 PE=1 SV=2 | 79 | 281 | 1.0E-19 |
| sp|P25043|PSB2_YEAST | Proteasome subunit beta type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP1 PE=1 SV=1 | 66 | 273 | 2.0E-19 |
| sp|C5A2D5|PSB2_THEGJ | Proteasome subunit beta 2 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB2 PE=3 SV=1 | 81 | 255 | 2.0E-19 |
| sp|Q9HR36|PSB_HALSA | Proteasome subunit beta OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=psmB PE=3 SV=2 | 83 | 278 | 3.0E-19 |
| sp|B0R4C8|PSB_HALS3 | Proteasome subunit beta OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=psmB PE=3 SV=1 | 83 | 278 | 3.0E-19 |
| sp|Q9JHW0|PSB7_RAT | Proteasome subunit beta type-7 OS=Rattus norvegicus GN=Psmb7 PE=1 SV=1 | 81 | 275 | 4.0E-19 |
| sp|D2RUI0|PSB2_HALTV | Proteasome subunit beta 2 OS=Haloterrigena turkmenica (strain ATCC 51198 / DSM 5511 / NCIMB 13204 / VKM B-1734) GN=psmB2 PE=3 SV=1 | 94 | 274 | 4.0E-19 |
| sp|Q2TBP0|PSB7_BOVIN | Proteasome subunit beta type-7 OS=Bos taurus GN=PSMB7 PE=1 SV=1 | 81 | 275 | 6.0E-19 |
| sp|Q99436|PSB7_HUMAN | Proteasome subunit beta type-7 OS=Homo sapiens GN=PSMB7 PE=1 SV=1 | 81 | 275 | 7.0E-19 |
| sp|Q5JHL8|PSB2_THEKO | Proteasome subunit beta 2 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmB2 PE=3 SV=1 | 81 | 255 | 7.0E-19 |
| sp|Q9V247|PSB1_PYRAB | Proteasome subunit beta 1 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB1 PE=3 SV=1 | 81 | 255 | 8.0E-19 |
| sp|P93395|PSB6_TOBAC | Proteasome subunit beta type-6 OS=Nicotiana tabacum PE=2 SV=1 | 83 | 266 | 9.0E-19 |
| sp|P70195|PSB7_MOUSE | Proteasome subunit beta type-7 OS=Mus musculus GN=Psmb7 PE=1 SV=1 | 81 | 275 | 9.0E-19 |
| sp|A1XQU1|PSB7_PIG | Proteasome subunit beta type-7 OS=Sus scrofa GN=PSMB7 PE=2 SV=2 | 81 | 275 | 1.0E-18 |
| sp|B8D673|PSB1_DESK1 | Proteasome subunit beta 1 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB1 PE=3 SV=1 | 85 | 268 | 2.0E-18 |
| sp|O57983|PSB1_PYRHO | Proteasome subunit beta 1 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB1 PE=3 SV=1 | 81 | 266 | 1.0E-17 |
| sp|A1RX71|PSB2_THEPD | Proteasome subunit beta 2 OS=Thermofilum pendens (strain Hrk 5) GN=psmB2 PE=3 SV=1 | 85 | 266 | 1.0E-17 |
| sp|B8D683|PSB2_DESK1 | Proteasome subunit beta 2 OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=psmB2 PE=3 SV=1 | 84 | 259 | 1.0E-17 |
| sp|Q9YES4|PSB1_AERPE | Proteasome subunit beta 1 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=psmB1 PE=3 SV=2 | 83 | 266 | 1.0E-17 |
| sp|Q74MP5|PSB_NANEQ | Proteasome subunit beta OS=Nanoarchaeum equitans (strain Kin4-M) GN=psmB PE=3 SV=1 | 84 | 268 | 2.0E-17 |
| sp|Q9V0N9|PSB2_PYRAB | Proteasome subunit beta 2 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmB2 PE=3 SV=1 | 82 | 272 | 2.0E-17 |
| sp|C6A3R1|PSB2_THESM | Proteasome subunit beta 2 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB2 PE=3 SV=1 | 81 | 269 | 2.0E-17 |
| sp|Q8SR11|PSB1_ENCCU | Probable proteasome subunit beta type-1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PRE3 PE=1 SV=1 | 79 | 285 | 2.0E-17 |
| sp|B6YXV3|PSB2_THEON | Proteasome subunit beta 2 OS=Thermococcus onnurineus (strain NA1) GN=psmB2 PE=3 SV=1 | 89 | 266 | 3.0E-17 |
| sp|A8MBW0|PSB1_CALMQ | Proteasome subunit beta 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=psmB1 PE=3 SV=1 | 92 | 266 | 4.0E-17 |
| sp|O50110|PSB2_PYRHO | Proteasome subunit beta 2 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=psmB2 PE=3 SV=1 | 82 | 276 | 6.0E-17 |
| sp|P28077|PSB9_RAT | Proteasome subunit beta type-9 OS=Rattus norvegicus GN=Psmb9 PE=1 SV=2 | 79 | 281 | 2.0E-16 |
| sp|O35522|PSB9_MUSMB | Proteasome subunit beta type-9 OS=Mus musculus bactrianus GN=Psmb9 PE=1 SV=1 | 79 | 281 | 6.0E-16 |
| sp|P28076|PSB9_MOUSE | Proteasome subunit beta type-9 OS=Mus musculus GN=Psmb9 PE=1 SV=1 | 79 | 281 | 9.0E-16 |
| sp|O35524|PSB9_MUSSI | Proteasome subunit beta type-9 OS=Mus spicilegus GN=Psmb9 PE=1 SV=1 | 79 | 268 | 1.0E-15 |
| sp|O35521|PSB9_MUSTR | Proteasome subunit beta type-9 OS=Mus terricolor GN=Psmb9 PE=1 SV=1 | 79 | 268 | 1.0E-15 |
| sp|O23710|PSB7A_ARATH | Proteasome subunit beta type-7-A OS=Arabidopsis thaliana GN=PBB1 PE=1 SV=2 | 80 | 273 | 2.0E-15 |
| sp|O35523|PSB9_MUSPL | Proteasome subunit beta type-9 OS=Mus platythrix GN=Psmb9 PE=1 SV=1 | 79 | 268 | 2.0E-15 |
| sp|C6A2V9|PSB1_THESM | Proteasome subunit beta 1 OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmB1 PE=3 SV=1 | 82 | 278 | 3.0E-15 |
| sp|C5A7L1|PSB1_THEGJ | Proteasome subunit beta 1 OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmB1 PE=3 SV=1 | 81 | 267 | 3.0E-15 |
| sp|Q7AKQ5|PSB_STRCO | Proteasome subunit beta OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=prcB PE=1 SV=1 | 78 | 254 | 6.0E-15 |
| sp|Q7DLS1|PSB7B_ARATH | Proteasome subunit beta type-7-B OS=Arabidopsis thaliana GN=PBB2 PE=1 SV=2 | 80 | 273 | 8.0E-15 |
| sp|Q3T0T1|PSB10_BOVIN | Proteasome subunit beta type-10 OS=Bos taurus GN=PSMB10 PE=1 SV=1 | 83 | 287 | 9.0E-15 |
| sp|Q8TYB7|PSA_METKA | Proteasome subunit alpha OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=psmA PE=3 SV=1 | 76 | 279 | 1.0E-14 |
| sp|Q4KM35|PSB10_RAT | Proteasome subunit beta type-10 OS=Rattus norvegicus GN=Psmb10 PE=2 SV=1 | 70 | 258 | 1.0E-14 |
| sp|P38624|PSB1_YEAST | Proteasome subunit beta type-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE3 PE=1 SV=2 | 79 | 259 | 2.0E-14 |
| sp|Q8U125|PSB2_PYRFU | Proteasome subunit beta 2 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=psmB2 PE=3 SV=1 | 83 | 278 | 2.0E-14 |
| sp|O35955|PSB10_MOUSE | Proteasome subunit beta type-10 OS=Mus musculus GN=Psmb10 PE=1 SV=1 | 70 | 254 | 5.0E-14 |
| sp|P40306|PSB10_HUMAN | Proteasome subunit beta type-10 OS=Homo sapiens GN=PSMB10 PE=1 SV=1 | 78 | 270 | 8.0E-14 |
| sp|C7NVQ4|PSB_HALMD | Proteasome subunit beta OS=Halomicrobium mukohataei (strain ATCC 700874 / DSM 12286 / JCM 9738 / NCIMB 13541) GN=psmB PE=3 SV=1 | 95 | 274 | 9.0E-14 |
| sp|Q9LSU1|PSA5_ORYSJ | Proteasome subunit alpha type-5 OS=Oryza sativa subsp. japonica GN=PAE1 PE=2 SV=1 | 80 | 262 | 2.0E-13 |
| sp|Q828I8|PSB2_STRAW | Proteasome subunit beta 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prcB2 PE=3 SV=1 | 78 | 254 | 2.0E-13 |
| sp|Q9M4T8|PSA5_SOYBN | Proteasome subunit alpha type-5 OS=Glycine max GN=PAE1 PE=2 SV=1 | 80 | 262 | 3.0E-13 |
| sp|C9Z4D0|PSB_STRSW | Proteasome subunit beta OS=Streptomyces scabiei (strain 87.22) GN=prcB PE=3 SV=1 | 78 | 254 | 3.0E-13 |
| sp|B1W306|PSB_STRGG | Proteasome subunit beta OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=prcB PE=3 SV=1 | 78 | 254 | 3.0E-13 |
| sp|C7PVV2|PSB_CATAD | Proteasome subunit beta OS=Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC 102108 / JCM 14897) GN=prcB PE=3 SV=1 | 32 | 278 | 4.0E-13 |
| sp|A1SK13|PSB_NOCSJ | Proteasome subunit beta OS=Nocardioides sp. (strain BAA-499 / JS614) GN=prcB PE=3 SV=1 | 82 | 254 | 5.0E-13 |
| sp|Q42134|PSA5B_ARATH | Proteasome subunit alpha type-5-B OS=Arabidopsis thaliana GN=PAE2 PE=1 SV=2 | 80 | 262 | 6.0E-13 |
| sp|Q55DY7|PSB2_DICDI | Proteasome subunit beta type-2 OS=Dictyostelium discoideum GN=psmB2 PE=3 SV=1 | 85 | 270 | 6.0E-13 |
| sp|A4FZT6|PSA_METM5 | Proteasome subunit alpha OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=psmA PE=3 SV=1 | 65 | 239 | 7.0E-13 |
| sp|O81149|PSA5A_ARATH | Proteasome subunit alpha type-5-A OS=Arabidopsis thaliana GN=PAE1 PE=1 SV=1 | 80 | 262 | 8.0E-13 |
| sp|Q54QR2|PSB7_DICDI | Proteasome subunit beta type-7 OS=Dictyostelium discoideum GN=psmB7 PE=3 SV=1 | 80 | 273 | 1.0E-12 |
| sp|C7LYP7|PSB_ACIFD | Proteasome subunit beta OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=prcB PE=3 SV=1 | 79 | 281 | 2.0E-12 |
| sp|Q60177|PSA_METJA | Proteasome subunit alpha OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=psmA PE=1 SV=1 | 65 | 248 | 3.0E-12 |
| sp|D2Q4H4|PSB_KRIFD | Proteasome subunit beta OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) GN=prcB PE=3 SV=1 | 80 | 254 | 3.0E-12 |
| sp|A6VIP0|PSA_METM7 | Proteasome subunit alpha OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=psmA PE=3 SV=1 | 65 | 239 | 5.0E-12 |
| sp|D1A2S9|PSB1_THECD | Proteasome subunit beta 1 OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081) GN=prcB1 PE=3 SV=1 | 78 | 290 | 6.0E-12 |
| sp|Q6M0L9|PSA_METMP | Proteasome subunit alpha OS=Methanococcus maripaludis (strain S2 / LL) GN=psmA PE=3 SV=1 | 65 | 239 | 9.0E-12 |
| sp|C6WID8|PSB_ACTMD | Proteasome subunit beta OS=Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / NBRC 14064 / IMRU 3971) GN=prcB PE=3 SV=1 | 50 | 254 | 1.0E-11 |
| sp|Q8SQN7|PSB2_ENCCU | Probable proteasome subunit beta type-2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=PUP1 PE=1 SV=1 | 83 | 273 | 1.0E-11 |
| sp|P99026|PSB4_MOUSE | Proteasome subunit beta type-4 OS=Mus musculus GN=Psmb4 PE=1 SV=1 | 33 | 278 | 2.0E-11 |
| sp|Q2J9Q3|PSB_FRASC | Proteasome subunit beta OS=Frankia sp. (strain CcI3) GN=prcB PE=3 SV=2 | 74 | 254 | 2.0E-11 |
| sp|D1BHT9|PSB_SANKS | Proteasome subunit beta OS=Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74) GN=prcB PE=3 SV=1 | 51 | 254 | 2.0E-11 |
| sp|D0LDT1|PSB_GORB4 | Proteasome subunit beta OS=Gordonia bronchialis (strain ATCC 25592 / DSM 43247 / JCM 3198 / NCTC 10667) GN=prcB PE=3 SV=1 | 61 | 254 | 2.0E-11 |
| sp|Q0RLT7|PSB_FRAAA | Proteasome subunit beta OS=Frankia alni (strain ACN14a) GN=prcB PE=3 SV=2 | 49 | 254 | 2.0E-11 |
| sp|A6URN9|PSA_METVS | Proteasome subunit alpha OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=psmA PE=3 SV=1 | 65 | 278 | 4.0E-11 |
| sp|A0LU50|PSB_ACIC1 | Proteasome subunit beta OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=prcB PE=3 SV=1 | 52 | 254 | 5.0E-11 |
| sp|P28070|PSB4_HUMAN | Proteasome subunit beta type-4 OS=Homo sapiens GN=PSMB4 PE=1 SV=4 | 33 | 278 | 6.0E-11 |
| sp|Q3T108|PSB4_BOVIN | Proteasome subunit beta type-4 OS=Bos taurus GN=PSMB4 PE=1 SV=1 | 83 | 278 | 1.0E-10 |
| sp|B8H8L6|PSB_ARTCA | Proteasome subunit beta OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=prcB PE=3 SV=1 | 78 | 254 | 1.0E-10 |
| sp|A9A846|PSA_METM6 | Proteasome subunit alpha OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=psmA PE=3 SV=1 | 65 | 239 | 2.0E-10 |
| sp|D1A3V2|PSB2_THECD | Proteasome subunit beta 2 OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081) GN=prcB2 PE=3 SV=1 | 65 | 235 | 2.0E-10 |
| sp|A6W970|PSB_KINRD | Proteasome subunit beta OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=prcB PE=3 SV=1 | 82 | 271 | 3.0E-10 |
| sp|A8LH54|PSB_FRASN | Proteasome subunit beta OS=Frankia sp. (strain EAN1pec) GN=prcB PE=3 SV=1 | 49 | 254 | 4.0E-10 |
| sp|O24633|PSB2B_ARATH | Proteasome subunit beta type-2-B OS=Arabidopsis thaliana GN=PBD2 PE=1 SV=1 | 93 | 249 | 9.0E-10 |
| sp|A1R6Q7|PSB_ARTAT | Proteasome subunit beta OS=Arthrobacter aurescens (strain TC1) GN=prcB PE=3 SV=2 | 82 | 254 | 2.0E-09 |
| sp|A9WSI1|PSB_RENSM | Proteasome subunit beta OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=prcB PE=3 SV=1 | 82 | 254 | 2.0E-09 |
| sp|Q95083|PSA5_DROME | Proteasome subunit alpha type-5 OS=Drosophila melanogaster GN=Prosalpha5 PE=2 SV=2 | 80 | 277 | 2.0E-09 |
| sp|Q94561|PSA5_ENTHI | Proteasome subunit alpha type-5 OS=Entamoeba histolytica PE=3 SV=2 | 80 | 270 | 3.0E-09 |
| sp|Q9XZG5|PSA5_TRYBB | Proteasome subunit alpha type-5 OS=Trypanosoma brucei brucei PE=3 SV=1 | 80 | 238 | 3.0E-09 |
| sp|Q47NZ4|PSB_THEFY | Proteasome subunit beta OS=Thermobifida fusca (strain YX) GN=prcB PE=3 SV=1 | 82 | 254 | 4.0E-09 |
| sp|C5BVA2|PSB_BEUC1 | Proteasome subunit beta OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=prcB PE=3 SV=1 | 51 | 281 | 4.0E-09 |
| sp|Q9Z2U1|PSA5_MOUSE | Proteasome subunit alpha type-5 OS=Mus musculus GN=Psma5 PE=1 SV=1 | 80 | 235 | 4.0E-09 |
| sp|P28066|PSA5_HUMAN | Proteasome subunit alpha type-5 OS=Homo sapiens GN=PSMA5 PE=1 SV=3 | 80 | 235 | 4.0E-09 |
| sp|Q5E987|PSA5_BOVIN | Proteasome subunit alpha type-5 OS=Bos taurus GN=PSMA5 PE=1 SV=1 | 80 | 235 | 4.0E-09 |
| sp|O23714|PSB2A_ARATH | Proteasome subunit beta type-2-A OS=Arabidopsis thaliana GN=PBD1 PE=1 SV=1 | 93 | 249 | 8.0E-09 |
| sp|A4X744|PSB2_SALTO | Proteasome subunit beta 2 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=prcB2 PE=3 SV=2 | 82 | 262 | 9.0E-09 |
| sp|Q8TPX5|PSA_METAC | Proteasome subunit alpha OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=psmA PE=3 SV=1 | 76 | 248 | 1.0E-08 |
| sp|Q8PTU1|PSA_METMA | Proteasome subunit alpha OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=psmA PE=3 SV=1 | 76 | 248 | 1.0E-08 |
| sp|C1ASP7|PSB_RHOOB | Proteasome subunit beta OS=Rhodococcus opacus (strain B4) GN=prcB PE=3 SV=1 | 82 | 254 | 1.0E-08 |
| sp|Q53079|PSB1_RHOER | Proteasome subunit beta 1 OS=Rhodococcus erythropolis GN=prcB1 PE=1 SV=1 | 82 | 254 | 1.0E-08 |
| sp|Q0SIF9|PSB_RHOJR | Proteasome subunit beta OS=Rhodococcus jostii (strain RHA1) GN=prcB PE=3 SV=2 | 82 | 254 | 1.0E-08 |
| sp|Q59565|PSA_METTE | Proteasome subunit alpha OS=Methanosarcina thermophila GN=psmA PE=3 SV=1 | 76 | 248 | 2.0E-08 |
| sp|P22141|PSB4_YEAST | Proteasome subunit beta type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE1 PE=1 SV=2 | 87 | 273 | 2.0E-08 |
| sp|Q1B797|PSB_MYCSS | Proteasome subunit beta OS=Mycobacterium sp. (strain MCS) GN=prcB PE=3 SV=1 | 80 | 254 | 2.0E-08 |
| sp|A1UHS7|PSB_MYCSK | Proteasome subunit beta OS=Mycobacterium sp. (strain KMS) GN=prcB PE=3 SV=1 | 80 | 254 | 2.0E-08 |
| sp|A3Q193|PSB_MYCSJ | Proteasome subunit beta OS=Mycobacterium sp. (strain JLS) GN=prcB PE=3 SV=1 | 80 | 254 | 2.0E-08 |
| sp|A5UJS2|PSA_METS3 | Proteasome subunit alpha OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=psmA PE=3 SV=1 | 77 | 256 | 2.0E-08 |
| sp|C6A459|PSA_THESM | Proteasome subunit alpha OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=psmA PE=3 SV=1 | 77 | 282 | 2.0E-08 |
| sp|D3Q557|PSB_STANL | Proteasome subunit beta OS=Stackebrandtia nassauensis (strain DSM 44728 / NRRL B-16338 / NBRC 102104 / LLR-40K-21) GN=prcB PE=3 SV=1 | 82 | 254 | 3.0E-08 |
| sp|Q55G04|PSA5_DICDI | Proteasome subunit alpha type-5 OS=Dictyostelium discoideum GN=psmA5 PE=3 SV=1 | 94 | 243 | 3.0E-08 |
| sp|D2ATV1|PSB_STRRD | Proteasome subunit beta OS=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) GN=prcB PE=3 SV=1 | 79 | 254 | 3.0E-08 |
| sp|Q469M6|PSA_METBF | Proteasome subunit alpha OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=psmA PE=3 SV=1 | 76 | 248 | 3.0E-08 |
| sp|P34064|PSA5_RAT | Proteasome subunit alpha type-5 OS=Rattus norvegicus GN=Psma5 PE=1 SV=1 | 83 | 235 | 4.0E-08 |
| sp|A0JWY6|PSB_ARTS2 | Proteasome subunit beta OS=Arthrobacter sp. (strain FB24) GN=prcB PE=3 SV=1 | 78 | 278 | 5.0E-08 |
| sp|P34067|PSB4_RAT | Proteasome subunit beta type-4 OS=Rattus norvegicus GN=Psmb4 PE=1 SV=2 | 33 | 278 | 6.0E-08 |
| sp|C0ZZU7|PSB_RHOE4 | Proteasome subunit beta OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=prcB PE=3 SV=1 | 63 | 254 | 7.0E-08 |
| sp|Q53083|PSB2_RHOER | Proteasome subunit beta 2 OS=Rhodococcus erythropolis GN=prcB2 PE=1 SV=1 | 63 | 254 | 7.0E-08 |
| sp|C7R403|PSB_JONDD | Proteasome subunit beta OS=Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / CIP 55134) GN=prcB PE=3 SV=1 | 82 | 230 | 1.0E-07 |
| sp|O26782|PSA_METTH | Proteasome subunit alpha OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=psmA PE=3 SV=1 | 76 | 246 | 1.0E-07 |
| sp|B1MAI2|PSB_MYCA9 | Proteasome subunit beta OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=prcB PE=3 SV=1 | 79 | 227 | 1.0E-07 |
| sp|P28024|PSB4_XENLA | Proteasome subunit beta type-4 (Fragment) OS=Xenopus laevis GN=psmb4 PE=2 SV=2 | 83 | 278 | 1.0E-07 |
| sp|A4TB64|PSB_MYCGI | Proteasome subunit beta OS=Mycobacterium gilvum (strain PYR-GCK) GN=prcB PE=3 SV=1 | 80 | 254 | 1.0E-07 |
| sp|A4FBY1|PSB_SACEN | Proteasome subunit beta OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=prcB PE=3 SV=1 | 51 | 254 | 1.0E-07 |
| sp|A7I9C7|PSA_METB6 | Proteasome subunit alpha OS=Methanoregula boonei (strain 6A8) GN=psmA PE=3 SV=1 | 65 | 246 | 2.0E-07 |
| sp|C3NEC6|PSA_SULIY | Proteasome subunit alpha OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=psmA PE=3 SV=1 | 80 | 259 | 2.0E-07 |
| sp|C3NHC6|PSA_SULIN | Proteasome subunit alpha OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=psmA PE=3 SV=1 | 80 | 259 | 2.0E-07 |
| sp|C3MVG1|PSA_SULIM | Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=psmA PE=3 SV=1 | 80 | 259 | 2.0E-07 |
| sp|C3MQ43|PSA_SULIL | Proteasome subunit alpha OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=psmA PE=3 SV=1 | 80 | 259 | 2.0E-07 |
| sp|C4KHD9|PSA_SULIK | Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=psmA PE=3 SV=1 | 80 | 259 | 2.0E-07 |
| sp|C3N5R0|PSA_SULIA | Proteasome subunit alpha OS=Sulfolobus islandicus (strain M.16.27) GN=psmA PE=3 SV=1 | 80 | 259 | 2.0E-07 |
| sp|Q9UT97|PSA5_SCHPO | Probable proteasome subunit alpha type-5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pup2 PE=1 SV=1 | 80 | 272 | 2.0E-07 |
| sp|Q73YW8|PSB_MYCPA | Proteasome subunit beta OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=prcB PE=3 SV=1 | 79 | 254 | 3.0E-07 |
| sp|Q55D66|PSB3_DICDI | Proteasome subunit beta type-3 OS=Dictyostelium discoideum GN=psmB3 PE=3 SV=1 | 92 | 254 | 3.0E-07 |
| sp|Q9XYN7|PSB3_DROME | Proteasome subunit beta type-3 OS=Drosophila melanogaster GN=Prosbeta3 PE=1 SV=1 | 82 | 265 | 3.0E-07 |
| sp|Q9UXC6|PSA_SULSO | Proteasome subunit alpha OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=psmA PE=3 SV=1 | 80 | 259 | 3.0E-07 |
| sp|P57697|PSA_HALSA | Proteasome subunit alpha OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=psmA PE=3 SV=1 | 76 | 255 | 4.0E-07 |
| sp|B0R2T2|PSA_HALS3 | Proteasome subunit alpha OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=psmA PE=3 SV=1 | 76 | 255 | 4.0E-07 |
| sp|Q23237|PSB3_CAEEL | Proteasome subunit beta type-3 OS=Caenorhabditis elegans GN=pbs-3 PE=1 SV=1 | 83 | 254 | 5.0E-07 |
| sp|O29760|PSA_ARCFU | Proteasome subunit alpha OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=psmA PE=1 SV=1 | 77 | 239 | 5.0E-07 |
| sp|Q9V122|PSA_PYRAB | Proteasome subunit alpha OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=psmA PE=3 SV=1 | 76 | 277 | 6.0E-07 |
| sp|P25156|PSA_THEAC | Proteasome subunit alpha OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=psmA PE=1 SV=2 | 76 | 243 | 7.0E-07 |
| sp|O24733|PSA_THEK1 | Proteasome subunit alpha OS=Thermococcus sp. (strain JCM 11816 / KS-1) GN=psmA PE=3 SV=1 | 76 | 281 | 8.0E-07 |
| sp|Q5JIU9|PSA_THEKO | Proteasome subunit alpha OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=psmA PE=3 SV=1 | 76 | 281 | 8.0E-07 |
| sp|A0QFB5|PSB_MYCA1 | Proteasome subunit beta OS=Mycobacterium avium (strain 104) GN=prcB PE=3 SV=1 | 79 | 254 | 9.0E-07 |
| sp|Q5V1D4|PSA2_HALMA | Proteasome subunit alpha 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=psmA2 PE=3 SV=1 | 76 | 277 | 9.0E-07 |
| sp|C8XAQ4|PSB_NAKMY | Proteasome subunit beta OS=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / JCM 9543 / Y-104) GN=prcB PE=3 SV=1 | 82 | 226 | 1.0E-06 |
| sp|Q9V2V6|PSA1_HALVD | Proteasome subunit alpha 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=psmA1 PE=1 SV=2 | 76 | 243 | 1.0E-06 |
| sp|Q18K08|PSA_HALWD | Proteasome subunit alpha OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=psmA PE=3 SV=1 | 76 | 270 | 1.0E-06 |
| sp|Q97BZ8|PSA_THEVO | Proteasome subunit alpha OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=psmA PE=3 SV=2 | 76 | 246 | 1.0E-06 |
| sp|A1TAP4|PSB_MYCVP | Proteasome subunit beta OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=prcB PE=3 SV=1 | 80 | 254 | 1.0E-06 |
| sp|P32379|PSA5_YEAST | Proteasome subunit alpha type-5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP2 PE=1 SV=2 | 80 | 281 | 2.0E-06 |
| sp|C5A2C2|PSA_THEGJ | Proteasome subunit alpha OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=psmA PE=3 SV=1 | 76 | 277 | 3.0E-06 |
| sp|Q9LST6|PSB2_ORYSJ | Proteasome subunit beta type-2 OS=Oryza sativa subsp. japonica GN=PBD1 PE=2 SV=2 | 96 | 266 | 4.0E-06 |
| sp|B5FBL7|HSLV_VIBFM | ATP-dependent protease subunit HslV OS=Vibrio fischeri (strain MJ11) GN=hslV PE=3 SV=1 | 84 | 265 | 4.0E-06 |
| sp|Q82JE3|PSB1_STRAW | Proteasome subunit beta 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=prcB1 PE=3 SV=1 | 79 | 234 | 4.0E-06 |
| sp|O73817|PSB3_ONCMY | Proteasome subunit beta type-3 OS=Oncorhynchus mykiss GN=psmb3 PE=2 SV=1 | 82 | 254 | 5.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0051603 | proteolysis involved in protein catabolic process | Yes |
| GO:0005839 | proteasome core complex | Yes |
| GO:0043170 | macromolecule metabolic process | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0032991 | protein-containing complex | No |
| GO:0019538 | protein metabolic process | No |
| GO:0006508 | proteolysis | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0044238 | primary metabolic process | No |
| GO:0008150 | biological_process | No |
| GO:0008152 | metabolic process | No |
| GO:0005575 | cellular_component | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 52 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|054860 MNSFVDQFSTHSPTAQLKRAQKLIAAEDDDYSDAVWGSQAGFGGMIKGIPAFKVPAVADPTAFLRLHTDDHADPN CRIKIQHGTTTLAFRFKGGVIVAVDSRATAGSYVASGTVKKVIEINPYLLGTMAGGAADCQFWETYLGMHCRLHE LRNRERISVSAASKYLSNLVYSYKGMGLSMGTMICGWDKTGPAVFYVDSDGTRLKGDLFSVGSGSTFAYGVLDQG YRWDLTDEEAQELGRRSIFAAGHRDAMSGNTCNLYHVKEEGWDFIGNYDISKMYYEGPGDVPGAPGGGYGYAIRT EGRSAANPPPS* |
| Coding | >Agabi119p4|054860 ATGAACTCTTTCGTCGACCAGTTCTCGACACACAGCCCAACAGCTCAGCTCAAGCGGGCACAGAAACTCATTGCT GCAGAGGATGATGACTACTCAGATGCTGTATGGGGCTCGCAGGCTGGTTTTGGCGGCATGATCAAAGGTATACCT GCCTTCAAAGTTCCTGCTGTTGCAGATCCTACTGCTTTCCTTCGACTGCACACGGACGACCACGCCGATCCCAAT TGCAGAATCAAGATCCAGCACGGTACAACGACCTTGGCCTTCAGGTTCAAAGGTGGCGTTATCGTTGCCGTAGAT TCTCGAGCGACGGCTGGAAGCTACGTCGCTTCGGGAACGGTAAAGAAAGTTATTGAAATCAACCCATATCTTCTC GGAACGATGGCTGGTGGTGCAGCCGACTGCCAGTTCTGGGAGACCTATCTTGGTATGCACTGTCGGTTACACGAA CTCCGCAATCGCGAACGAATCTCTGTCTCGGCTGCCAGCAAATACCTCAGTAACTTGGTCTATAGCTACAAGGGA ATGGGTCTGAGTATGGGAACCATGATCTGTGGTTGGGACAAGACCGGGCCAGCTGTCTTTTACGTAGACTCGGAT GGCACGCGCCTCAAAGGCGACCTTTTCTCTGTGGGATCTGGTAGCACGTTCGCCTACGGTGTCTTGGATCAGGGC TATCGTTGGGATCTCACGGATGAGGAGGCACAGGAACTCGGCAGGCGTAGTATCTTCGCCGCTGGTCATCGTGAT GCTATGTCGGGTAACACATGTAACTTGTATCATGTCAAGGAAGAGGGTTGGGACTTTATTGGCAATTATGATATC TCAAAAATGTACTACGAAGGACCTGGAGACGTTCCCGGAGCTCCTGGCGGCGGATACGGATACGCTATTCGCACA GAGGGTCGCAGTGCTGCTAATCCACCTCCTTCATAA |
| Transcript | >Agabi119p4|054860 ATGAACTCTTTCGTCGACCAGTTCTCGACACACAGCCCAACAGCTCAGCTCAAGCGGGCACAGAAACTCATTGCT GCAGAGGATGATGACTACTCAGATGCTGTATGGGGCTCGCAGGCTGGTTTTGGCGGCATGATCAAAGGTATACCT GCCTTCAAAGTTCCTGCTGTTGCAGATCCTACTGCTTTCCTTCGACTGCACACGGACGACCACGCCGATCCCAAT TGCAGAATCAAGATCCAGCACGGTACAACGACCTTGGCCTTCAGGTTCAAAGGTGGCGTTATCGTTGCCGTAGAT TCTCGAGCGACGGCTGGAAGCTACGTCGCTTCGGGAACGGTAAAGAAAGTTATTGAAATCAACCCATATCTTCTC GGAACGATGGCTGGTGGTGCAGCCGACTGCCAGTTCTGGGAGACCTATCTTGGTATGCACTGTCGGTTACACGAA CTCCGCAATCGCGAACGAATCTCTGTCTCGGCTGCCAGCAAATACCTCAGTAACTTGGTCTATAGCTACAAGGGA ATGGGTCTGAGTATGGGAACCATGATCTGTGGTTGGGACAAGACCGGGCCAGCTGTCTTTTACGTAGACTCGGAT GGCACGCGCCTCAAAGGCGACCTTTTCTCTGTGGGATCTGGTAGCACGTTCGCCTACGGTGTCTTGGATCAGGGC TATCGTTGGGATCTCACGGATGAGGAGGCACAGGAACTCGGCAGGCGTAGTATCTTCGCCGCTGGTCATCGTGAT GCTATGTCGGGTAACACATGTAACTTGTATCATGTCAAGGAAGAGGGTTGGGACTTTATTGGCAATTATGATATC TCAAAAATGTACTACGAAGGACCTGGAGACGTTCCCGGAGCTCCTGGCGGCGGATACGGATACGCTATTCGCACA GAGGGTCGCAGTGCTGCTAATCCACCTCCTTCATAA |
| Gene | >Agabi119p4|054860 ATGAACTCTTTCGTCGACCAGTTCTCGACACACAGCCCAACAGCTCAGCTCAAGCGGGCACAGAAACTCATTGCT GCAGAGGATGATGACTACTCAGATGCTGTATGGGGCTCGCAGGCTGGTTTTGGCGGCATGATCAAAGGTATACCT GCCTTCAAAGTTCCTGCTGTTGCAGATGTGCGTTTTCAAAAGTTCTTTGCAAGTTAATCACACTAAAATACTGAT TTTGAATTCCAGCCTACTGCTTTCCTTCGACTGCACACGGACGACCACGCCGATCCCAATTGCAGAATCAAGATC CAGCACGGTACAACGACCTTGGCCTTCAGGTTCAAAGGTGGCGTTATCGTTGCCGTAGATTCTCGAGCGACGGCT GGAAGCTACGTCGGTAATTCATTTGACTCTGATCTCACTGGTCAATCCTGACTGATCACGTTCAAAGCTTCGGGA ACGGTAAAGAAAGTTATTGAAATCAACCCATATCTTCTCGGAACGATGGCTGGTGGTGCAGGTAAGTACACAGGA CATATGCGAGTTATAATACGATACTTAGTTATTCTTCTCCTCAGCCGACTGCCAGTTCTGGGAGACCTATCTTGG TATGCACTGTCGGTTACACGAACTCCGCAATCGCGAACGAATCTCTGTCTCGGCTGCCAGCAAATACCTCAGTAA CTTGGTCTATAGCTACAAGGGAATGGGTCTGAGTATGGTATGTCATTGTATACGGAAGCTTGCGCGTTTTGATTC TTTACTTTCTTCTATCAAGGGAACCATGATCTGTGGTTGGGACAAGACCGGGCCAGCTGTCTTTTACGTAGACTC GGATGGCACGCGCCTCAAAGGCGACCTTTTCTCTGTGGGATCTGGTAGCACGTTCGCCTACGGTGTCTTGGATCA GGGCTATCGTTGGGATCTCACGGATGAGGAGGCACAGGAACTCGGCAGGCGTAGTATCTTCGCCGCTGGTCATCG TGATGCTATGTCGGGTAACACATGTAACTTGTATCATGTCAAGGAAGAGGGTTGGGACTTTATTGGTGCGTCATC CTTTTTTCTTTCATGCTTCATCCGTTCCTCATTCGTCGCATCGCTAGGCAATTATGATATCTCAAAAATGTACTA CGAAGGACCTGGAGACGTTCCCGGAGCTCCTGGCGGCGGATACGGATACGCTATTCGCACAGAGGGTCGCAGTGC TGCTAATCCACCTCCTTCATAA |