Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|054730
Gene name
Locationscaffold_03a:568557..569849
Strand+
Gene length (bp)1292
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XX2|MP65_CANAL Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MP65 PE=1 SV=2 36 281 6.0E-31
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 50 281 2.0E-28
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 36 244 1.0E-24
sp|A1C499|BTGE_ASPCL Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=btgE PE=3 SV=1 36 284 4.0E-22
sp|A1DBG6|BTGE_NEOFI Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgE PE=3 SV=1 31 285 9.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q59XX2|MP65_CANAL Cell surface mannoprotein MP65 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MP65 PE=1 SV=2 36 281 6.0E-31
sp|P53334|SCW4_YEAST Probable family 17 glucosidase SCW4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW4 PE=1 SV=1 50 281 2.0E-28
sp|Q04951|SCW10_YEAST Probable family 17 glucosidase SCW10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW10 PE=1 SV=1 36 244 1.0E-24
sp|A1C499|BTGE_ASPCL Probable beta-glucosidase btgE OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=btgE PE=3 SV=1 36 284 4.0E-22
sp|A1DBG6|BTGE_NEOFI Probable beta-glucosidase btgE OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgE PE=3 SV=1 31 285 9.0E-21
sp|Q4WC60|BTGE_ASPFU Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgE PE=3 SV=2 36 285 1.0E-20
sp|B0Y9Q9|BTGE_ASPFC Probable beta-glucosidase btgE OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgE PE=3 SV=2 36 285 1.0E-20
sp|P53189|SCW11_YEAST Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW11 PE=1 SV=1 36 284 8.0E-20
sp|Q0CEX9|BTGE_ASPTN Probable beta-glucosidase btgE OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=btgE PE=3 SV=1 36 284 3.0E-18
sp|Q2US39|BTGE_ASPOR Probable beta-glucosidase btgE OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=btgE PE=3 SV=1 36 285 8.0E-17
sp|B8MXP5|BTGE_ASPFN Probable beta-glucosidase btgE OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=btgE PE=3 SV=1 36 285 8.0E-17
sp|Q5BD29|BTGE_EMENI Probable beta-glucosidase btgE OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=btgE PE=1 SV=1 54 270 5.0E-16
sp|A2QH21|EGLC_ASPNC Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=eglC PE=3 SV=2 36 249 2.0E-14
sp|Q5AUT0|EGLC_EMENI Probable glucan endo-1,3-beta-glucosidase eglC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=eglC PE=1 SV=1 2 249 2.0E-13
sp|Q2UUZ1|EGLC_ASPOR Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=eglC PE=3 SV=1 35 249 6.0E-13
sp|Q0C7P6|EGLC_ASPTN Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=eglC PE=3 SV=1 34 249 1.0E-12
sp|A1CD22|EGLC_ASPCL Probable glucan endo-1,3-beta-glucosidase eglC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=eglC PE=3 SV=1 35 249 4.0E-11
sp|Q4WG16|EGLC_ASPFU Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=eglC PE=3 SV=1 35 249 7.0E-11
sp|B0XXF8|EGLC_ASPFC Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=eglC PE=3 SV=1 35 249 7.0E-11
sp|A1DJ47|EGLC_NEOFI Probable glucan endo-1,3-beta-glucosidase eglC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=eglC PE=3 SV=1 43 249 8.0E-11
sp|A2QN74|BTGC_ASPNC Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=btgC PE=3 SV=2 60 291 6.0E-10
sp|P15703|BGL2_YEAST Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BGL2 PE=1 SV=1 39 286 9.0E-09
sp|A1DEV5|BTGC_NEOFI Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=btgC PE=3 SV=1 61 270 2.0E-08
sp|O13990|BGL2_SCHPO Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bgl2 PE=2 SV=4 67 279 3.0E-08
sp|Q4WUK5|BTGC_ASPFU Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=btgC PE=3 SV=1 61 291 5.0E-08
sp|B0Y429|BTGC_ASPFC Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=btgC PE=3 SV=1 61 291 6.0E-08
sp|Q5AMT2|BGL2_CANAL Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BGL2 PE=1 SV=1 67 281 2.0E-06
sp|P43070|BGL2_CANAX Glucan 1,3-beta-glucosidase OS=Candida albicans GN=BGL2 PE=3 SV=1 67 281 4.0E-06
sp|Q5B430|BTGC_EMENI Glucan endo-1,3-beta-glucosidase btgC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=btgC PE=2 SV=1 60 270 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|054730
MMLTTNIILSLAFLSVTFAANNFVGLTASNAIGGRSPYTCRTQAQWNDLANTARNSGFKTIRILGFDCGALNMAS
NAAAAANLQVLAGIFFDGSVAGANGQIDNEVRSFQSAVQQFGASRYVGLTIGNENSDDPNNIINKVNQVRNTLRS
AGINTPVSTVHSWFNIINARVLCNGDFVGANAHAFFDPNTAAGNSGNFLTQTVIPALRNACGNKKIMITETGWPS
RGGSNGAGVASLDNERAALAALNCASGSIPDVSVFAFEYDDQTWKGNDNERSFGIFPKFNNGVPSC*
Coding >Agabi119p4|054730
ATGATGCTGACCACCAACATCATTCTCTCTCTTGCATTCCTCTCTGTGACTTTCGCAGCCAACAATTTCGTAGGC
CTTACGGCCTCGAATGCGATTGGGGGCAGGTCTCCGTACACTTGCCGTACCCAGGCTCAGTGGAACGACCTTGCC
AATACTGCAAGGAATTCTGGATTCAAAACTATCAGGATCCTCGGTTTCGACTGTGGAGCCCTCAACATGGCTTCT
AACGCTGCTGCAGCGGCGAATTTGCAAGTGCTTGCCGGAATATTTTTCGATGGTTCTGTCGCCGGTGCAAATGGT
CAGATCGATAACGAAGTTCGCTCATTCCAAAGTGCTGTCCAACAATTTGGTGCCTCGCGTTATGTAGGGCTTACC
ATTGGCAACGAGAATTCGGACGATCCGAACAACATTATTAATAAAGTCAATCAAGTTCGAAACACTCTGAGATCT
GCCGGGATCAATACTCCAGTTTCTACTGTTCATTCCTGGTTCAATATTATCAATGCCAGAGTACTCTGTAATGGC
GATTTTGTAGGCGCCAATGCACACGCTTTCTTCGACCCTAACACAGCTGCGGGAAATTCTGGTAACTTTTTGACG
CAAACGGTAATCCCTGCGCTGCGAAATGCATGCGGTAACAAGAAAATTATGATTACGGAAACTGGTTGGCCTTCC
CGTGGAGGTTCCAACGGTGCTGGAGTTGCCTCCCTAGATAACGAACGCGCGGCGCTTGCTGCATTGAACTGCGCC
AGTGGTAGTATTCCCGACGTTTCGGTCTTTGCTTTCGAGTACGATGATCAAACCTGGAAAGGTAACGATAATGAA
CGGAGTTTTGGTATCTTCCCCAAGTTTAACAATGGGGTTCCGTCTTGTTGA
Transcript >Agabi119p4|054730
ATGATGCTGACCACCAACATCATTCTCTCTCTTGCATTCCTCTCTGTGACTTTCGCAGCCAACAATTTCGTAGGC
CTTACGGCCTCGAATGCGATTGGGGGCAGGTCTCCGTACACTTGCCGTACCCAGGCTCAGTGGAACGACCTTGCC
AATACTGCAAGGAATTCTGGATTCAAAACTATCAGGATCCTCGGTTTCGACTGTGGAGCCCTCAACATGGCTTCT
AACGCTGCTGCAGCGGCGAATTTGCAAGTGCTTGCCGGAATATTTTTCGATGGTTCTGTCGCCGGTGCAAATGGT
CAGATCGATAACGAAGTTCGCTCATTCCAAAGTGCTGTCCAACAATTTGGTGCCTCGCGTTATGTAGGGCTTACC
ATTGGCAACGAGAATTCGGACGATCCGAACAACATTATTAATAAAGTCAATCAAGTTCGAAACACTCTGAGATCT
GCCGGGATCAATACTCCAGTTTCTACTGTTCATTCCTGGTTCAATATTATCAATGCCAGAGTACTCTGTAATGGC
GATTTTGTAGGCGCCAATGCACACGCTTTCTTCGACCCTAACACAGCTGCGGGAAATTCTGGTAACTTTTTGACG
CAAACGGTAATCCCTGCGCTGCGAAATGCATGCGGTAACAAGAAAATTATGATTACGGAAACTGGTTGGCCTTCC
CGTGGAGGTTCCAACGGTGCTGGAGTTGCCTCCCTAGATAACGAACGCGCGGCGCTTGCTGCATTGAACTGCGCC
AGTGGTAGTATTCCCGACGTTTCGGTCTTTGCTTTCGAGTACGATGATCAAACCTGGAAAGGTAACGATAATGAA
CGGAGTTTTGGTATCTTCCCCAAGTTTAACAATGGGGTTCCGTCTTGTTGA
Gene >Agabi119p4|054730
ATGATGCTGACCACCAACATCATTCTCTCTCTTGCATTCCTCTCTGTGACTTTCGCAGCCAACAATTTCGTAGGC
CTTACGGCCTCGAATGCGATTGGGGGCAGGTCTCCGTACACTTGCCGTACCCAGGCTCAGGTGAATTTCACTGCA
TCATTCCTTAGAAGCGCTCATGATCACTGATAACCTACTCGCGCCGATCATGTGTCAATGATAGTGGAACGACCT
TGCCAATACTGCAAGGAATTCTGGATTCAAAACTATCAGGATCCTCGGTTTCGACTGTGGAGCCCTCAACATGGC
TTCTAACGCTGCTGCAGCGGCGAATTTGCAAGTGCTTGCCGGAATATTTTTCGATGTAGATACTTTTATTTCTCC
CGGCTATATGCGATATTGAACTATGATTTTAGGGTTCTGTCGCCGGTGCAAATGGTCAGATCGAGTAAGTCACAC
TGCTACTTAGTTTCTGTTATCTGGCAGGTTTACTGAGTGATCAATAGTAACGAAGTTCGCTCATTCCAAAGTGCT
GTCCAACAATTTGGTGCCTCGCGTTATGTAGGGCTTACCATTGGCAACGAGGCAAGACCCATTTCACCTTGAACA
CTTCCAAATCATACTCACGAAATGTCGAACCTAGAATTCGGACGATCCGAACAACATTATTAATAAAGTCAATCA
AGTTCGAAGTAGGTGACATTTGTGCTTTAGTCGGGTATATATGCCAATCGCTCTTTCCTGTTTCTAGACACTCTG
AGATCTGCCGGGATCAATACTCCAGTTTCTACTGTTCATTCCTGGTTCAATATTATCAATGCCAGAGTACTCTGT
AATGGCGATTTTGTAGGCGCCAATGCACAGTAAGCATTACTCCATCAATACGGCGTTTCATGCTCACGTCGTGGA
TAATGCACAGCGCTTTCTTCGACCCTAACACAGCTGCGGGAAATTCTGGTAACTTTTTGACGCAAACGGTAATCC
CTGCGCTGCGAAATGCATGCGGTAACAAGAAAATTATGATTACGGAGTACGTATCTTTCTACTCAACTTGCATAT
GCATAATCAAACTTCAATACTATAGAACTGGTTGGCCTTCCCGTGGAGGTTCCAACGGTGCTGGAGTTGCCTCCC
TAGATAACGAACGCGCGGCGCTTGCTGCATTGAACTGCGCCAGTGGTAGTATTCCCGACGTTTCGGTCTTTGCTT
TCGAGTACGATGATCAAACCTGGAAAGGTAACGATAATGAACGGAGTTTTGGTATCTTCCCCAAGTTTAACAATG
GGGTTCCGTCTTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail