© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Agabi119p4|053530 |
| Gene name | |
| Location | scaffold_03a:259083..260572 |
| Strand | + |
| Gene length (bp) | 1489 |
| Transcript length (bp) | 1188 |
| Coding sequence length (bp) | 1188 |
| Protein length (aa) | 396 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF03054 | tRNA_Me_trans | tRNA methyl transferase HUP domain | 3.6E-71 | 27 | 231 |
| PF20259 | tRNA_Me_trans_M | tRNA methyl transferase PRC-barrel domain | 1.8E-16 | 237 | 298 |
| PF20258 | tRNA_Me_trans_C | Aminomethyltransferase beta-barrel domain | 2.9E-15 | 313 | 391 |
| PF02540 | NAD_synthase | NAD synthase | 1.8E-05 | 21 | 100 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A1STI9|MNMA_PSYIN | tRNA-specific 2-thiouridylase MnmA OS=Psychromonas ingrahamii (strain 37) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-95 |
| sp|Q5QYZ7|MNMA_IDILO | tRNA-specific 2-thiouridylase MnmA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mnmA PE=3 SV=1 | 27 | 393 | 1.0E-94 |
| sp|B4EVG2|MNMA_PROMH | tRNA-specific 2-thiouridylase MnmA OS=Proteus mirabilis (strain HI4320) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-94 |
| sp|Q5KWT8|MNMA2_GEOKA | tRNA-specific 2-thiouridylase MnmA 2 OS=Geobacillus kaustophilus (strain HTA426) GN=mnmA2 PE=3 SV=1 | 27 | 394 | 2.0E-94 |
| sp|C5B8B9|MNMA_EDWI9 | tRNA-specific 2-thiouridylase MnmA OS=Edwardsiella ictaluri (strain 93-146) GN=mnmA PE=3 SV=1 | 27 | 392 | 7.0E-94 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|A1STI9|MNMA_PSYIN | tRNA-specific 2-thiouridylase MnmA OS=Psychromonas ingrahamii (strain 37) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-95 |
| sp|Q5QYZ7|MNMA_IDILO | tRNA-specific 2-thiouridylase MnmA OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mnmA PE=3 SV=1 | 27 | 393 | 1.0E-94 |
| sp|B4EVG2|MNMA_PROMH | tRNA-specific 2-thiouridylase MnmA OS=Proteus mirabilis (strain HI4320) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-94 |
| sp|Q5KWT8|MNMA2_GEOKA | tRNA-specific 2-thiouridylase MnmA 2 OS=Geobacillus kaustophilus (strain HTA426) GN=mnmA2 PE=3 SV=1 | 27 | 394 | 2.0E-94 |
| sp|C5B8B9|MNMA_EDWI9 | tRNA-specific 2-thiouridylase MnmA OS=Edwardsiella ictaluri (strain 93-146) GN=mnmA PE=3 SV=1 | 27 | 392 | 7.0E-94 |
| sp|A0KI53|MNMA_AERHH | tRNA-specific 2-thiouridylase MnmA OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-93 |
| sp|B8CLH4|MNMA_SHEPW | tRNA-specific 2-thiouridylase MnmA OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=mnmA PE=3 SV=1 | 25 | 392 | 4.0E-93 |
| sp|A4IR87|MNMA_GEOTN | tRNA-specific 2-thiouridylase MnmA OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mnmA PE=3 SV=1 | 27 | 394 | 8.0E-93 |
| sp|B0TW32|MNMA_FRAP2 | tRNA-specific 2-thiouridylase MnmA OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=mnmA PE=3 SV=1 | 24 | 391 | 8.0E-93 |
| sp|A4SKS0|MNMA_AERS4 | tRNA-specific 2-thiouridylase MnmA OS=Aeromonas salmonicida (strain A449) GN=mnmA PE=3 SV=1 | 27 | 393 | 1.0E-92 |
| sp|A8GDD5|MNMA_SERP5 | tRNA-specific 2-thiouridylase MnmA OS=Serratia proteamaculans (strain 568) GN=mnmA PE=3 SV=1 | 27 | 393 | 1.0E-92 |
| sp|Q03EZ6|MNMA_PEDPA | tRNA-specific 2-thiouridylase MnmA OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-92 |
| sp|B2G6L9|MNMA_LACRJ | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus reuteri (strain JCM 1112) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-92 |
| sp|A5VJ48|MNMA_LACRD | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus reuteri (strain DSM 20016) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-92 |
| sp|Q15T93|MNMA_PSEA6 | tRNA-specific 2-thiouridylase MnmA OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=mnmA PE=3 SV=1 | 14 | 392 | 3.0E-92 |
| sp|C4L952|MNMA_TOLAT | tRNA-specific 2-thiouridylase MnmA OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=mnmA PE=3 SV=1 | 27 | 393 | 7.0E-92 |
| sp|Q9KDF2|MNMA_BACHD | tRNA-specific 2-thiouridylase MnmA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-91 |
| sp|B1YJE9|MNMA_EXIS2 | tRNA-specific 2-thiouridylase MnmA OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=mnmA PE=3 SV=1 | 28 | 392 | 3.0E-91 |
| sp|B0S3R4|MNMA_FINM2 | tRNA-specific 2-thiouridylase MnmA OS=Finegoldia magna (strain ATCC 29328) GN=mnmA PE=3 SV=1 | 27 | 394 | 4.0E-91 |
| sp|C6DFW7|MNMA_PECCP | tRNA-specific 2-thiouridylase MnmA OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mnmA PE=3 SV=1 | 27 | 393 | 6.0E-91 |
| sp|Q1QUR7|MNMA_CHRSD | tRNA-specific 2-thiouridylase MnmA OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mnmA PE=3 SV=1 | 27 | 394 | 8.0E-91 |
| sp|Q3KA70|MNMA_PSEPF | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas fluorescens (strain Pf0-1) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-90 |
| sp|Q5E3W7|MNMA_VIBF1 | tRNA-specific 2-thiouridylase MnmA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-90 |
| sp|Q9KSX8|MNMA_VIBCH | tRNA-specific 2-thiouridylase MnmA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-90 |
| sp|A5F2F2|MNMA_VIBC3 | tRNA-specific 2-thiouridylase MnmA OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-90 |
| sp|B5FG83|MNMA_VIBFM | tRNA-specific 2-thiouridylase MnmA OS=Vibrio fischeri (strain MJ11) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-90 |
| sp|A0Q454|MNMA_FRATN | tRNA-specific 2-thiouridylase MnmA OS=Francisella tularensis subsp. novicida (strain U112) GN=mnmA PE=3 SV=1 | 27 | 391 | 3.0E-90 |
| sp|B2UC85|MNMA_RALPJ | tRNA-specific 2-thiouridylase MnmA OS=Ralstonia pickettii (strain 12J) GN=mnmA PE=3 SV=1 | 27 | 391 | 3.0E-90 |
| sp|Q480B8|MNMA_COLP3 | tRNA-specific 2-thiouridylase MnmA OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=mnmA PE=3 SV=1 | 27 | 392 | 4.0E-90 |
| sp|Q0BP64|MNMA_FRATO | tRNA-specific 2-thiouridylase MnmA OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=mnmA PE=3 SV=2 | 27 | 391 | 4.0E-90 |
| sp|Q2A5X5|MNMA_FRATH | tRNA-specific 2-thiouridylase MnmA OS=Francisella tularensis subsp. holarctica (strain LVS) GN=mnmA PE=3 SV=1 | 27 | 391 | 4.0E-90 |
| sp|A7N9A5|MNMA_FRATF | tRNA-specific 2-thiouridylase MnmA OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=mnmA PE=3 SV=1 | 27 | 391 | 4.0E-90 |
| sp|A4J081|MNMA_FRATW | tRNA-specific 2-thiouridylase MnmA OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=mnmA PE=3 SV=1 | 27 | 391 | 4.0E-90 |
| sp|Q1WTT7|MNMA_LACS1 | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus salivarius (strain UCC118) GN=mnmA PE=3 SV=1 | 27 | 392 | 4.0E-90 |
| sp|A1JLK6|MNMA_YERE8 | tRNA-specific 2-thiouridylase MnmA OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mnmA PE=3 SV=1 | 27 | 393 | 4.0E-90 |
| sp|Q03QJ0|MNMA_LACBA | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mnmA PE=3 SV=1 | 20 | 392 | 5.0E-90 |
| sp|Q5NEF9|MNMA_FRATT | tRNA-specific 2-thiouridylase MnmA OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=mnmA PE=3 SV=2 | 27 | 391 | 5.0E-90 |
| sp|B2SEJ7|MNMA_FRATM | tRNA-specific 2-thiouridylase MnmA OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=mnmA PE=3 SV=1 | 27 | 391 | 5.0E-90 |
| sp|Q14FW2|MNMA_FRAT1 | tRNA-specific 2-thiouridylase MnmA OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=mnmA PE=3 SV=2 | 27 | 391 | 5.0E-90 |
| sp|Q081F9|MNMA_SHEFN | tRNA-specific 2-thiouridylase MnmA OS=Shewanella frigidimarina (strain NCIMB 400) GN=mnmA PE=3 SV=1 | 25 | 392 | 6.0E-90 |
| sp|Q6LT18|MNMA_PHOPR | tRNA-specific 2-thiouridylase MnmA OS=Photobacterium profundum GN=mnmA PE=3 SV=1 | 27 | 393 | 9.0E-90 |
| sp|Q7MLT4|MNMA_VIBVY | tRNA-specific 2-thiouridylase MnmA OS=Vibrio vulnificus (strain YJ016) GN=mnmA PE=3 SV=1 | 27 | 393 | 1.0E-89 |
| sp|B0TQ02|MNMA_SHEHH | tRNA-specific 2-thiouridylase MnmA OS=Shewanella halifaxensis (strain HAW-EB4) GN=mnmA PE=3 SV=1 | 25 | 392 | 1.0E-89 |
| sp|B0UWF2|MNMA_HISS2 | tRNA-specific 2-thiouridylase MnmA OS=Histophilus somni (strain 2336) GN=mnmA PE=3 SV=1 | 13 | 393 | 2.0E-89 |
| sp|Q8CWJ6|MNMA_VIBVU | tRNA-specific 2-thiouridylase MnmA OS=Vibrio vulnificus (strain CMCP6) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-89 |
| sp|Q0I5Y6|MNMA_HAES1 | tRNA-specific 2-thiouridylase MnmA OS=Haemophilus somnus (strain 129Pt) GN=mnmA PE=3 SV=1 | 13 | 393 | 2.0E-89 |
| sp|A6V4G0|MNMA_PSEA7 | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas aeruginosa (strain PA7) GN=mnmA PE=3 SV=1 | 22 | 392 | 2.0E-89 |
| sp|Q6D4E9|MNMA_PECAS | tRNA-specific 2-thiouridylase MnmA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-89 |
| sp|A8H5M1|MNMA_SHEPA | tRNA-specific 2-thiouridylase MnmA OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=mnmA PE=3 SV=2 | 25 | 392 | 3.0E-89 |
| sp|Q039P7|MNMA_LACC3 | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus casei (strain ATCC 334) GN=mnmA PE=3 SV=1 | 27 | 392 | 3.0E-89 |
| sp|Q8CXC7|MNMA_OCEIH | tRNA-specific 2-thiouridylase MnmA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=mnmA PE=3 SV=1 | 20 | 392 | 4.0E-89 |
| sp|B1KID0|MNMA_SHEWM | tRNA-specific 2-thiouridylase MnmA OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=mnmA PE=3 SV=1 | 20 | 392 | 5.0E-89 |
| sp|B1JI67|MNMA_YERPY | tRNA-specific 2-thiouridylase MnmA OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mnmA PE=3 SV=1 | 27 | 393 | 8.0E-89 |
| sp|Q669Q4|MNMA_YERPS | tRNA-specific 2-thiouridylase MnmA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mnmA PE=3 SV=1 | 27 | 393 | 8.0E-89 |
| sp|A4TLN3|MNMA_YERPP | tRNA-specific 2-thiouridylase MnmA OS=Yersinia pestis (strain Pestoides F) GN=mnmA PE=3 SV=1 | 27 | 393 | 8.0E-89 |
| sp|Q1CI58|MNMA_YERPN | tRNA-specific 2-thiouridylase MnmA OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mnmA PE=3 SV=1 | 27 | 393 | 8.0E-89 |
| sp|A9R0L5|MNMA_YERPG | tRNA-specific 2-thiouridylase MnmA OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mnmA PE=3 SV=1 | 27 | 393 | 8.0E-89 |
| sp|Q8ZFQ5|MNMA_YERPE | tRNA-specific 2-thiouridylase MnmA OS=Yersinia pestis GN=mnmA PE=3 SV=1 | 27 | 393 | 8.0E-89 |
| sp|B2K711|MNMA_YERPB | tRNA-specific 2-thiouridylase MnmA OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mnmA PE=3 SV=1 | 27 | 393 | 8.0E-89 |
| sp|Q1C6S0|MNMA_YERPA | tRNA-specific 2-thiouridylase MnmA OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mnmA PE=3 SV=1 | 27 | 393 | 8.0E-89 |
| sp|A7FH61|MNMA_YERP3 | tRNA-specific 2-thiouridylase MnmA OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mnmA PE=3 SV=1 | 27 | 393 | 8.0E-89 |
| sp|A7MFV2|MNMA_CROS8 | tRNA-specific 2-thiouridylase MnmA OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mnmA PE=3 SV=1 | 27 | 393 | 1.0E-88 |
| sp|Q8Y714|MNMA_LISMO | tRNA-specific 2-thiouridylase MnmA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-88 |
| sp|Q87QL9|MNMA_VIBPA | tRNA-specific 2-thiouridylase MnmA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mnmA PE=3 SV=2 | 27 | 393 | 1.0E-88 |
| sp|A6TUB2|MNMA_ALKMQ | tRNA-specific 2-thiouridylase MnmA OS=Alkaliphilus metalliredigens (strain QYMF) GN=mnmA PE=3 SV=1 | 24 | 394 | 1.0E-88 |
| sp|A0AIW1|MNMA_LISW6 | tRNA-specific 2-thiouridylase MnmA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-88 |
| sp|A5WE20|MNMA_PSYWF | tRNA-specific 2-thiouridylase MnmA OS=Psychrobacter sp. (strain PRwf-1) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-88 |
| sp|Q7MB22|MNMA_PHOLL | tRNA-specific 2-thiouridylase MnmA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-88 |
| sp|A8MEV9|MNMA_ALKOO | tRNA-specific 2-thiouridylase MnmA OS=Alkaliphilus oremlandii (strain OhILAs) GN=mnmA PE=3 SV=1 | 24 | 393 | 2.0E-88 |
| sp|Q88V96|MNMA_LACPL | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-88 |
| sp|A1S7B1|MNMA_SHEAM | tRNA-specific 2-thiouridylase MnmA OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mnmA PE=3 SV=1 | 12 | 392 | 3.0E-88 |
| sp|Q0HJT7|MNMA_SHESM | tRNA-specific 2-thiouridylase MnmA OS=Shewanella sp. (strain MR-4) GN=mnmA PE=3 SV=1 | 25 | 393 | 3.0E-88 |
| sp|A3QD79|MNMA_SHELP | tRNA-specific 2-thiouridylase MnmA OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=mnmA PE=3 SV=1 | 25 | 392 | 4.0E-88 |
| sp|Q12N64|MNMA_SHEDO | tRNA-specific 2-thiouridylase MnmA OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=mnmA PE=3 SV=2 | 25 | 392 | 5.0E-88 |
| sp|B8DDZ8|MNMA_LISMH | tRNA-specific 2-thiouridylase MnmA OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=mnmA PE=3 SV=1 | 27 | 392 | 6.0E-88 |
| sp|Q71ZF8|MNMA_LISMF | tRNA-specific 2-thiouridylase MnmA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mnmA PE=3 SV=1 | 27 | 392 | 6.0E-88 |
| sp|C1KVF9|MNMA_LISMC | tRNA-specific 2-thiouridylase MnmA OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=mnmA PE=3 SV=1 | 27 | 392 | 6.0E-88 |
| sp|B2TZ86|MNMA_SHIB3 | tRNA-specific 2-thiouridylase MnmA OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mnmA PE=3 SV=1 | 27 | 393 | 6.0E-88 |
| sp|A0KW11|MNMA_SHESA | tRNA-specific 2-thiouridylase MnmA OS=Shewanella sp. (strain ANA-3) GN=mnmA PE=3 SV=1 | 25 | 393 | 8.0E-88 |
| sp|Q83LF7|MNMA_SHIFL | tRNA-specific 2-thiouridylase MnmA OS=Shigella flexneri GN=mnmA PE=3 SV=2 | 27 | 393 | 8.0E-88 |
| sp|Q0T5N9|MNMA_SHIF8 | tRNA-specific 2-thiouridylase MnmA OS=Shigella flexneri serotype 5b (strain 8401) GN=mnmA PE=3 SV=1 | 27 | 393 | 8.0E-88 |
| sp|A4XUY9|MNMA_PSEMY | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas mendocina (strain ymp) GN=mnmA PE=3 SV=1 | 20 | 392 | 9.0E-88 |
| sp|Q3IH16|MNMA_PSEHT | tRNA-specific 2-thiouridylase MnmA OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-87 |
| sp|Q2YT57|MNMA_STAAB | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-87 |
| sp|Q042R4|MNMA_LACGA | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mnmA PE=3 SV=2 | 27 | 394 | 1.0E-87 |
| sp|Q0HW33|MNMA_SHESR | tRNA-specific 2-thiouridylase MnmA OS=Shewanella sp. (strain MR-7) GN=mnmA PE=3 SV=1 | 25 | 393 | 1.0E-87 |
| sp|Q4ZRK0|MNMA_PSEU2 | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas syringae pv. syringae (strain B728a) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-87 |
| sp|O35020|MNMA_BACSU | tRNA-specific 2-thiouridylase MnmA OS=Bacillus subtilis (strain 168) GN=mnmA PE=3 SV=4 | 27 | 392 | 2.0E-87 |
| sp|Q9I0L2|MNMA_PSEAE | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mnmA PE=3 SV=1 | 22 | 392 | 2.0E-87 |
| sp|Q02NB8|MNMA_PSEAB | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mnmA PE=3 SV=1 | 22 | 392 | 2.0E-87 |
| sp|A8FUG9|MNMA_SHESH | tRNA-specific 2-thiouridylase MnmA OS=Shewanella sediminis (strain HAW-EB3) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-87 |
| sp|Q92BK1|MNMA_LISIN | tRNA-specific 2-thiouridylase MnmA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-87 |
| sp|Q74JW9|MNMA_LACJO | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-87 |
| sp|Q38XI3|MNMA_LACSS | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-87 |
| sp|A1U1H5|MNMA_MARHV | tRNA-specific 2-thiouridylase MnmA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-87 |
| sp|Q820U1|MNMA_ENTFA | tRNA-specific 2-thiouridylase MnmA OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-87 |
| sp|A7GT74|MNMA_BACCN | tRNA-specific 2-thiouridylase MnmA OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-87 |
| sp|Q31ZK9|MNMA_SHIBS | tRNA-specific 2-thiouridylase MnmA OS=Shigella boydii serotype 4 (strain Sb227) GN=mnmA PE=3 SV=2 | 27 | 393 | 2.0E-87 |
| sp|Q1RD20|MNMA_ECOUT | tRNA-specific 2-thiouridylase MnmA OS=Escherichia coli (strain UTI89 / UPEC) GN=mnmA PE=3 SV=2 | 27 | 393 | 2.0E-87 |
| sp|Q0TIU0|MNMA_ECOL5 | tRNA-specific 2-thiouridylase MnmA OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-87 |
| sp|A1AA27|MNMA_ECOK1 | tRNA-specific 2-thiouridylase MnmA OS=Escherichia coli O1:K1 / APEC GN=mnmA PE=3 SV=2 | 27 | 393 | 2.0E-87 |
| sp|B1LI10|MNMA_ECOSM | tRNA-specific 2-thiouridylase MnmA OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-87 |
| sp|Q8X735|MNMA_ECO57 | tRNA-specific 2-thiouridylase MnmA OS=Escherichia coli O157:H7 GN=mnmA PE=3 SV=2 | 27 | 393 | 3.0E-87 |
| sp|Q8CX40|MNMA_SHEON | tRNA-specific 2-thiouridylase MnmA OS=Shewanella oneidensis (strain MR-1) GN=mnmA PE=3 SV=1 | 25 | 393 | 3.0E-87 |
| sp|P25745|MNMA_ECOLI | tRNA-specific 2-thiouridylase MnmA OS=Escherichia coli (strain K12) GN=mnmA PE=1 SV=4 | 27 | 393 | 3.0E-87 |
| sp|B1IUD4|MNMA_ECOLC | tRNA-specific 2-thiouridylase MnmA OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mnmA PE=3 SV=1 | 27 | 393 | 3.0E-87 |
| sp|A7ZZ88|MNMA_ECOHS | tRNA-specific 2-thiouridylase MnmA OS=Escherichia coli O9:H4 (strain HS) GN=mnmA PE=3 SV=1 | 27 | 393 | 3.0E-87 |
| sp|B1XA43|MNMA_ECODH | tRNA-specific 2-thiouridylase MnmA OS=Escherichia coli (strain K12 / DH10B) GN=mnmA PE=3 SV=1 | 27 | 393 | 3.0E-87 |
| sp|A7ZKS3|MNMA_ECO24 | tRNA-specific 2-thiouridylase MnmA OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mnmA PE=3 SV=1 | 27 | 393 | 3.0E-87 |
| sp|Q21K42|MNMA_SACD2 | tRNA-specific 2-thiouridylase MnmA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=mnmA PE=3 SV=1 | 22 | 394 | 3.0E-87 |
| sp|Q7U342|MNMA_HAEDU | tRNA-specific 2-thiouridylase MnmA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=mnmA PE=3 SV=1 | 8 | 392 | 4.0E-87 |
| sp|Q8CSA5|MNMA_STAES | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mnmA PE=3 SV=1 | 27 | 392 | 4.0E-87 |
| sp|Q5HNS9|MNMA_STAEQ | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mnmA PE=3 SV=1 | 27 | 392 | 4.0E-87 |
| sp|Q5L186|MNMA1_GEOKA | tRNA-specific 2-thiouridylase MnmA 1 OS=Geobacillus kaustophilus (strain HTA426) GN=mnmA1 PE=3 SV=1 | 24 | 394 | 5.0E-87 |
| sp|Q48H61|MNMA_PSE14 | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mnmA PE=3 SV=1 | 27 | 392 | 5.0E-87 |
| sp|A8Z4F9|MNMA_STAAT | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=mnmA PE=3 SV=1 | 27 | 392 | 5.0E-87 |
| sp|Q6GG82|MNMA_STAAR | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain MRSA252) GN=mnmA PE=3 SV=1 | 27 | 392 | 5.0E-87 |
| sp|Q99TM8|MNMA_STAAN | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain N315) GN=mnmA PE=1 SV=1 | 27 | 392 | 5.0E-87 |
| sp|A6QHG3|MNMA_STAAE | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain Newman) GN=mnmA PE=3 SV=1 | 27 | 392 | 5.0E-87 |
| sp|Q5HFE1|MNMA_STAAC | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain COL) GN=mnmA PE=3 SV=1 | 27 | 392 | 5.0E-87 |
| sp|A5ITE6|MNMA_STAA9 | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain JH9) GN=mnmA PE=3 SV=1 | 27 | 392 | 5.0E-87 |
| sp|Q2FXV6|MNMA_STAA8 | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain NCTC 8325) GN=mnmA PE=3 SV=2 | 27 | 392 | 5.0E-87 |
| sp|Q2FGA5|MNMA_STAA3 | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain USA300) GN=mnmA PE=3 SV=2 | 27 | 392 | 5.0E-87 |
| sp|A6U290|MNMA_STAA2 | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain JH1) GN=mnmA PE=3 SV=1 | 27 | 392 | 5.0E-87 |
| sp|Q931Q6|MNMA_STAAM | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mnmA PE=3 SV=1 | 27 | 392 | 5.0E-87 |
| sp|A7X333|MNMA_STAA1 | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mnmA PE=3 SV=1 | 27 | 392 | 5.0E-87 |
| sp|Q3Z2Y6|MNMA_SHISS | tRNA-specific 2-thiouridylase MnmA OS=Shigella sonnei (strain Ss046) GN=mnmA PE=3 SV=2 | 27 | 393 | 6.0E-87 |
| sp|C3JY68|MNMA_PSEFS | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas fluorescens (strain SBW25) GN=mnmA PE=3 SV=1 | 27 | 392 | 6.0E-87 |
| sp|B1HUL3|MNMA_LYSSC | tRNA-specific 2-thiouridylase MnmA OS=Lysinibacillus sphaericus (strain C3-41) GN=mnmA PE=3 SV=1 | 27 | 394 | 7.0E-87 |
| sp|Q6HDD0|MNMA_BACHK | tRNA-specific 2-thiouridylase MnmA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mnmA PE=3 SV=1 | 27 | 394 | 8.0E-87 |
| sp|Q634E9|MNMA_BACCZ | tRNA-specific 2-thiouridylase MnmA OS=Bacillus cereus (strain ZK / E33L) GN=mnmA PE=3 SV=1 | 27 | 394 | 8.0E-87 |
| sp|B9IYG1|MNMA_BACCQ | tRNA-specific 2-thiouridylase MnmA OS=Bacillus cereus (strain Q1) GN=mnmA PE=3 SV=1 | 27 | 394 | 8.0E-87 |
| sp|A0RJ05|MNMA_BACAH | tRNA-specific 2-thiouridylase MnmA OS=Bacillus thuringiensis (strain Al Hakam) GN=mnmA PE=3 SV=2 | 27 | 394 | 8.0E-87 |
| sp|Q81JE5|MNMA_BACAN | tRNA-specific 2-thiouridylase MnmA OS=Bacillus anthracis GN=mnmA PE=3 SV=1 | 27 | 394 | 8.0E-87 |
| sp|B7UV15|MNMA_PSEA8 | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas aeruginosa (strain LESB58) GN=mnmA PE=3 SV=1 | 22 | 392 | 9.0E-87 |
| sp|Q8CXZ8|MNMA_ECOL6 | tRNA-specific 2-thiouridylase MnmA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mnmA PE=3 SV=2 | 27 | 393 | 1.0E-86 |
| sp|Q8NW84|MNMA_STAAW | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain MW2) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-86 |
| sp|Q6G8U8|MNMA_STAAS | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus aureus (strain MSSA476) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-86 |
| sp|Q46XF1|MNMA_CUPPJ | tRNA-specific 2-thiouridylase MnmA OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mnmA PE=3 SV=1 | 25 | 392 | 1.0E-86 |
| sp|Q32EZ1|MNMA_SHIDS | tRNA-specific 2-thiouridylase MnmA OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mnmA PE=3 SV=2 | 27 | 393 | 1.0E-86 |
| sp|Q87ZR6|MNMA_PSESM | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-86 |
| sp|Q730D7|MNMA_BACC1 | tRNA-specific 2-thiouridylase MnmA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-86 |
| sp|Q9CHA1|MNMA_LACLA | tRNA-specific 2-thiouridylase MnmA OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-86 |
| sp|Q812R6|MNMA_BACCR | tRNA-specific 2-thiouridylase MnmA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mnmA PE=3 SV=2 | 27 | 394 | 3.0E-86 |
| sp|A8AHK2|MNMA_CITK8 | tRNA-specific 2-thiouridylase MnmA OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mnmA PE=3 SV=2 | 27 | 393 | 3.0E-86 |
| sp|B2HVN5|MNMA_ACIBC | tRNA-specific 2-thiouridylase MnmA OS=Acinetobacter baumannii (strain ACICU) GN=mnmA PE=3 SV=1 | 27 | 395 | 4.0E-86 |
| sp|B2SX74|MNMA_BURPP | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=mnmA PE=3 SV=1 | 27 | 392 | 4.0E-86 |
| sp|A7MSW1|MNMA_VIBCB | tRNA-specific 2-thiouridylase MnmA OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=mnmA PE=3 SV=1 | 27 | 393 | 4.0E-86 |
| sp|Q57QC0|MNMA_SALCH | tRNA-specific 2-thiouridylase MnmA OS=Salmonella choleraesuis (strain SC-B67) GN=mnmA PE=3 SV=2 | 27 | 393 | 5.0E-86 |
| sp|B0VBY5|MNMA_ACIBY | tRNA-specific 2-thiouridylase MnmA OS=Acinetobacter baumannii (strain AYE) GN=mnmA PE=3 SV=1 | 27 | 395 | 6.0E-86 |
| sp|A3M7G3|MNMA_ACIBT | tRNA-specific 2-thiouridylase MnmA OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=mnmA PE=3 SV=2 | 27 | 395 | 6.0E-86 |
| sp|B7I4K8|MNMA_ACIB5 | tRNA-specific 2-thiouridylase MnmA OS=Acinetobacter baumannii (strain AB0057) GN=mnmA PE=3 SV=1 | 27 | 395 | 6.0E-86 |
| sp|B7GZ21|MNMA_ACIB3 | tRNA-specific 2-thiouridylase MnmA OS=Acinetobacter baumannii (strain AB307-0294) GN=mnmA PE=3 SV=1 | 27 | 395 | 6.0E-86 |
| sp|Q8Z7G9|MNMA_SALTI | tRNA-specific 2-thiouridylase MnmA OS=Salmonella typhi GN=mnmA PE=3 SV=1 | 27 | 393 | 7.0E-86 |
| sp|A9N4K8|MNMA_SALPB | tRNA-specific 2-thiouridylase MnmA OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mnmA PE=3 SV=1 | 27 | 393 | 7.0E-86 |
| sp|Q5PMJ4|MNMA_SALPA | tRNA-specific 2-thiouridylase MnmA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mnmA PE=3 SV=1 | 27 | 393 | 7.0E-86 |
| sp|Q4K9U2|MNMA_PSEF5 | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mnmA PE=3 SV=1 | 27 | 392 | 8.0E-86 |
| sp|A2RLX1|MNMA_LACLM | tRNA-specific 2-thiouridylase MnmA OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=mnmA PE=3 SV=2 | 27 | 392 | 9.0E-86 |
| sp|Q8ZPZ4|MNMA_SALTY | tRNA-specific 2-thiouridylase MnmA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mnmA PE=3 SV=2 | 27 | 393 | 9.0E-86 |
| sp|A8FFP0|MNMA_BACP2 | tRNA-specific 2-thiouridylase MnmA OS=Bacillus pumilus (strain SAFR-032) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-85 |
| sp|B0VUD6|MNMA_ACIBS | tRNA-specific 2-thiouridylase MnmA OS=Acinetobacter baumannii (strain SDF) GN=mnmA PE=3 SV=1 | 27 | 395 | 1.0E-85 |
| sp|A4W9E5|MNMA_ENT38 | tRNA-specific 2-thiouridylase MnmA OS=Enterobacter sp. (strain 638) GN=mnmA PE=3 SV=1 | 27 | 393 | 1.0E-85 |
| sp|Q030C8|MNMA_LACLS | tRNA-specific 2-thiouridylase MnmA OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=mnmA PE=3 SV=2 | 27 | 392 | 1.0E-85 |
| sp|Q88FR9|MNMA_PSEPK | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas putida (strain KT2440) GN=mnmA PE=3 SV=1 | 18 | 392 | 1.0E-85 |
| sp|Q1QBM4|MNMA_PSYCK | tRNA-specific 2-thiouridylase MnmA OS=Psychrobacter cryohalolentis (strain K5) GN=mnmA PE=3 SV=1 | 28 | 391 | 1.0E-85 |
| sp|A4SZU5|MNMA_POLSQ | tRNA-specific 2-thiouridylase MnmA OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=mnmA PE=3 SV=1 | 27 | 391 | 1.0E-85 |
| sp|A9MG80|MNMA_SALAR | tRNA-specific 2-thiouridylase MnmA OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mnmA PE=3 SV=2 | 27 | 393 | 2.0E-85 |
| sp|C1CAE7|MNMA_STRP7 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pneumoniae (strain 70585) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-85 |
| sp|Q4L6W8|MNMA_STAHJ | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-85 |
| sp|A6WP69|MNMA_SHEB8 | tRNA-specific 2-thiouridylase MnmA OS=Shewanella baltica (strain OS185) GN=mnmA PE=3 SV=2 | 25 | 393 | 2.0E-85 |
| sp|A6T7K3|MNMA_KLEP7 | tRNA-specific 2-thiouridylase MnmA OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mnmA PE=3 SV=2 | 27 | 393 | 2.0E-85 |
| sp|B4U0P1|MNMA_STREM | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-85 |
| sp|B5XSN3|MNMA_KLEP3 | tRNA-specific 2-thiouridylase MnmA OS=Klebsiella pneumoniae (strain 342) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-85 |
| sp|Q5FKU0|MNMA_LACAC | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-85 |
| sp|A9L4G9|MNMA_SHEB9 | tRNA-specific 2-thiouridylase MnmA OS=Shewanella baltica (strain OS195) GN=mnmA PE=3 SV=2 | 25 | 393 | 3.0E-85 |
| sp|Q65GR9|MNMA_BACLD | tRNA-specific 2-thiouridylase MnmA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mnmA PE=3 SV=1 | 27 | 392 | 3.0E-85 |
| sp|A5W1G2|MNMA_PSEP1 | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=mnmA PE=3 SV=1 | 18 | 392 | 3.0E-85 |
| sp|C0MGQ2|MNMA_STRS7 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=mnmA PE=3 SV=1 | 27 | 392 | 3.0E-85 |
| sp|A8YUQ2|MNMA_LACH4 | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus helveticus (strain DPC 4571) GN=mnmA PE=3 SV=1 | 27 | 392 | 3.0E-85 |
| sp|B2GB92|MNMA_LACF3 | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=mnmA PE=3 SV=1 | 27 | 393 | 4.0E-85 |
| sp|A1RIW8|MNMA_SHESW | tRNA-specific 2-thiouridylase MnmA OS=Shewanella sp. (strain W3-18-1) GN=mnmA PE=3 SV=1 | 25 | 393 | 4.0E-85 |
| sp|B9DNH6|MNMA_STACT | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus carnosus (strain TM300) GN=mnmA PE=3 SV=1 | 27 | 392 | 4.0E-85 |
| sp|Q1IBE4|MNMA_PSEE4 | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas entomophila (strain L48) GN=mnmA PE=3 SV=1 | 18 | 392 | 5.0E-85 |
| sp|A3D5F8|MNMA_SHEB5 | tRNA-specific 2-thiouridylase MnmA OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=mnmA PE=3 SV=2 | 25 | 393 | 5.0E-85 |
| sp|B8E945|MNMA_SHEB2 | tRNA-specific 2-thiouridylase MnmA OS=Shewanella baltica (strain OS223) GN=mnmA PE=3 SV=1 | 25 | 393 | 5.0E-85 |
| sp|B2IRK2|MNMA_STRPS | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pneumoniae (strain CGSP14) GN=mnmA PE=3 SV=2 | 27 | 392 | 7.0E-85 |
| sp|Q9CLA3|MNMA_PASMU | tRNA-specific 2-thiouridylase MnmA OS=Pasteurella multocida (strain Pm70) GN=mnmA PE=3 SV=1 | 15 | 392 | 9.0E-85 |
| sp|A4Y7M1|MNMA_SHEPC | tRNA-specific 2-thiouridylase MnmA OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=mnmA PE=3 SV=1 | 25 | 393 | 9.0E-85 |
| sp|A7Z745|MNMA_BACMF | tRNA-specific 2-thiouridylase MnmA OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-84 |
| sp|C0MB53|MNMA_STRE4 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus equi subsp. equi (strain 4047) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-84 |
| sp|A9VIM2|MNMA_BACWK | tRNA-specific 2-thiouridylase MnmA OS=Bacillus weihenstephanensis (strain KBAB4) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-84 |
| sp|Q5WHN4|MNMA_BACSK | tRNA-specific 2-thiouridylase MnmA OS=Bacillus clausii (strain KSM-K16) GN=mnmA PE=3 SV=1 | 20 | 393 | 2.0E-84 |
| sp|Q8CWW0|MNMA_STRR6 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=mnmA PE=3 SV=2 | 27 | 392 | 2.0E-84 |
| sp|Q04MV1|MNMA_STRP2 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-84 |
| sp|Q8XVV4|MNMA_RALSO | tRNA-specific 2-thiouridylase MnmA OS=Ralstonia solanacearum (strain GMI1000) GN=mnmA PE=3 SV=1 | 25 | 394 | 2.0E-84 |
| sp|Q6FCW2|MNMA_ACIAD | tRNA-specific 2-thiouridylase MnmA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-84 |
| sp|B0KMQ6|MNMA_PSEPG | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas putida (strain GB-1) GN=mnmA PE=3 SV=1 | 18 | 392 | 2.0E-84 |
| sp|B9DWD3|MNMA_STRU0 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=mnmA PE=3 SV=1 | 27 | 392 | 3.0E-84 |
| sp|Q31GM9|MNMA_THICR | tRNA-specific 2-thiouridylase MnmA OS=Thiomicrospira crunogena (strain XCL-2) GN=mnmA PE=3 SV=1 | 27 | 391 | 3.0E-84 |
| sp|Q145K0|MNMA_BURXL | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia xenovorans (strain LB400) GN=mnmA PE=3 SV=1 | 27 | 392 | 3.0E-84 |
| sp|C1CI29|MNMA_STRZP | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pneumoniae (strain P1031) GN=mnmA PE=3 SV=1 | 27 | 392 | 4.0E-84 |
| sp|B8ZK04|MNMA_STRPJ | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=mnmA PE=3 SV=1 | 27 | 392 | 5.0E-84 |
| sp|B5XJA6|MNMA_STRPZ | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=mnmA PE=3 SV=1 | 27 | 392 | 6.0E-84 |
| sp|Q1LJ45|MNMA_CUPMC | tRNA-specific 2-thiouridylase MnmA OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=mnmA PE=3 SV=1 | 25 | 392 | 9.0E-84 |
| sp|Q1JED4|MNMA_STRPD | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=mnmA PE=3 SV=2 | 27 | 392 | 1.0E-83 |
| sp|Q2NU15|MNMA_SODGM | tRNA-specific 2-thiouridylase MnmA OS=Sodalis glossinidius (strain morsitans) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-83 |
| sp|A8AU84|MNMA_STRGC | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-83 |
| sp|A6W0E1|MNMA_MARMS | tRNA-specific 2-thiouridylase MnmA OS=Marinomonas sp. (strain MWYL1) GN=mnmA PE=3 SV=1 | 16 | 391 | 1.0E-83 |
| sp|A2RH05|MNMA_STRPG | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-83 |
| sp|Q1J455|MNMA_STRPF | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=mnmA PE=3 SV=2 | 27 | 392 | 1.0E-83 |
| sp|Q5X9C1|MNMA_STRP6 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=mnmA PE=3 SV=2 | 27 | 392 | 1.0E-83 |
| sp|C1CBU0|MNMA_STRZJ | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pneumoniae (strain JJA) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-83 |
| sp|Q0ADM9|MNMA_NITEC | tRNA-specific 2-thiouridylase MnmA OS=Nitrosomonas eutropha (strain C91) GN=mnmA PE=3 SV=1 | 27 | 391 | 1.0E-83 |
| sp|B5E605|MNMA_STRP4 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-83 |
| sp|Q1JJD5|MNMA_STRPC | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=mnmA PE=3 SV=2 | 27 | 392 | 2.0E-83 |
| sp|Q1J988|MNMA_STRPB | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=mnmA PE=3 SV=2 | 27 | 392 | 2.0E-83 |
| sp|A4VLW2|MNMA_PSEU5 | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas stutzeri (strain A1501) GN=mnmA PE=3 SV=1 | 15 | 394 | 2.0E-83 |
| sp|Q21RZ7|MNMA_RHOFT | tRNA-specific 2-thiouridylase MnmA OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=mnmA PE=3 SV=1 | 25 | 391 | 2.0E-83 |
| sp|P58075|MNMA_STRP1 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pyogenes serotype M1 GN=mnmA PE=3 SV=1 | 27 | 392 | 3.0E-83 |
| sp|A4G213|MNMA_HERAR | tRNA-specific 2-thiouridylase MnmA OS=Herminiimonas arsenicoxydans GN=mnmA PE=3 SV=1 | 27 | 395 | 3.0E-83 |
| sp|B1I833|MNMA_STRPI | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=mnmA PE=3 SV=1 | 27 | 392 | 3.0E-83 |
| sp|B1JBJ1|MNMA_PSEPW | tRNA-specific 2-thiouridylase MnmA OS=Pseudomonas putida (strain W619) GN=mnmA PE=3 SV=1 | 18 | 392 | 4.0E-83 |
| sp|Q63QY5|MNMA_BURPS | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia pseudomallei (strain K96243) GN=mnmA PE=3 SV=1 | 27 | 395 | 4.0E-83 |
| sp|A3NDE4|MNMA_BURP6 | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia pseudomallei (strain 668) GN=mnmA PE=3 SV=1 | 27 | 395 | 4.0E-83 |
| sp|C1CP03|MNMA_STRZT | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=mnmA PE=3 SV=1 | 27 | 392 | 4.0E-83 |
| sp|Q97T38|MNMA_STRPN | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=mnmA PE=1 SV=1 | 27 | 392 | 4.0E-83 |
| sp|Q4FSB4|MNMA_PSYA2 | tRNA-specific 2-thiouridylase MnmA OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=mnmA PE=3 SV=1 | 28 | 391 | 4.0E-83 |
| sp|A3CRB2|MNMA_STRSV | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus sanguinis (strain SK36) GN=mnmA PE=3 SV=1 | 27 | 394 | 4.0E-83 |
| sp|Q8NZ00|MNMA_STRP8 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=mnmA PE=3 SV=2 | 27 | 392 | 6.0E-83 |
| sp|Q49Y59|MNMA_STAS1 | tRNA-specific 2-thiouridylase MnmA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mnmA PE=3 SV=1 | 24 | 392 | 6.0E-83 |
| sp|A1V076|MNMA_BURMS | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia mallei (strain SAVP1) GN=mnmA PE=3 SV=1 | 27 | 395 | 6.0E-83 |
| sp|Q62H98|MNMA_BURMA | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia mallei (strain ATCC 23344) GN=mnmA PE=3 SV=1 | 27 | 395 | 6.0E-83 |
| sp|A2S5A6|MNMA_BURM9 | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia mallei (strain NCTC 10229) GN=mnmA PE=3 SV=1 | 27 | 395 | 6.0E-83 |
| sp|A3MP84|MNMA_BURM7 | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia mallei (strain NCTC 10247) GN=mnmA PE=3 SV=1 | 27 | 395 | 6.0E-83 |
| sp|Q0BI73|MNMA_BURCM | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=mnmA PE=3 SV=1 | 27 | 392 | 7.0E-83 |
| sp|Q6MA75|MNMA_PARUW | tRNA-specific 2-thiouridylase MnmA OS=Protochlamydia amoebophila (strain UWE25) GN=mnmA PE=3 SV=1 | 28 | 393 | 8.0E-83 |
| sp|Q3JYG1|MNMA_STRA1 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=mnmA PE=3 SV=1 | 27 | 394 | 9.0E-83 |
| sp|Q48QM8|MNMA_STRPM | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=mnmA PE=3 SV=2 | 27 | 392 | 9.0E-83 |
| sp|P66979|MNMA_STRA5 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=mnmA PE=3 SV=1 | 27 | 394 | 1.0E-82 |
| sp|P66978|MNMA_STRA3 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus agalactiae serotype III (strain NEM316) GN=mnmA PE=3 SV=1 | 27 | 394 | 1.0E-82 |
| sp|Q1GAS1|MNMA_LACDA | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-82 |
| sp|Q1GZF5|MNMA_METFK | tRNA-specific 2-thiouridylase MnmA OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=mnmA PE=3 SV=1 | 27 | 391 | 1.0E-82 |
| sp|Q8DRS4|MNMA_STRMU | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-82 |
| sp|Q04B58|MNMA_LACDB | tRNA-specific 2-thiouridylase MnmA OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-82 |
| sp|Q3JNT6|MNMA_BURP1 | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia pseudomallei (strain 1710b) GN=mnmA PE=3 SV=1 | 27 | 395 | 2.0E-82 |
| sp|A3NZ55|MNMA_BURP0 | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia pseudomallei (strain 1106a) GN=mnmA PE=3 SV=1 | 27 | 395 | 2.0E-82 |
| sp|Q7MBE1|MNMA_CHRVO | tRNA-specific 2-thiouridylase MnmA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=mnmA PE=3 SV=1 | 7 | 392 | 2.0E-82 |
| sp|B2JGI9|MNMA_BURP8 | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=mnmA PE=3 SV=1 | 27 | 395 | 2.0E-82 |
| sp|Q0K720|MNMA_CUPNH | tRNA-specific 2-thiouridylase MnmA OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=mnmA PE=3 SV=1 | 25 | 392 | 2.0E-82 |
| sp|Q6F152|MNMA_MESFL | tRNA-specific 2-thiouridylase MnmA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=mnmA PE=3 SV=1 | 27 | 392 | 5.0E-82 |
| sp|A5EVB4|MNMA_DICNV | tRNA-specific 2-thiouridylase MnmA OS=Dichelobacter nodosus (strain VCS1703A) GN=mnmA PE=3 SV=1 | 20 | 392 | 5.0E-82 |
| sp|B1YTE9|MNMA_BURA4 | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia ambifaria (strain MC40-6) GN=mnmA PE=3 SV=1 | 27 | 392 | 6.0E-82 |
| sp|Q5M249|MNMA_STRT2 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=mnmA PE=3 SV=1 | 27 | 394 | 6.0E-82 |
| sp|Q5LXJ9|MNMA_STRT1 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus thermophilus (strain CNRZ 1066) GN=mnmA PE=3 SV=1 | 27 | 394 | 6.0E-82 |
| sp|Q2SJL8|MNMA_HAHCH | tRNA-specific 2-thiouridylase MnmA OS=Hahella chejuensis (strain KCTC 2396) GN=mnmA PE=3 SV=1 | 20 | 392 | 7.0E-82 |
| sp|Q607H5|MNMA_METCA | tRNA-specific 2-thiouridylase MnmA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mnmA PE=3 SV=1 | 28 | 394 | 7.0E-82 |
| sp|A9AH63|MNMA_BURM1 | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=mnmA PE=3 SV=1 | 27 | 392 | 8.0E-82 |
| sp|B3R6Q0|MNMA_CUPTR | tRNA-specific 2-thiouridylase MnmA OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-81 |
| sp|Q03I88|MNMA_STRTD | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=mnmA PE=3 SV=1 | 27 | 394 | 1.0E-81 |
| sp|Q12093|MTU1_YEAST | Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLM3 PE=1 SV=1 | 12 | 395 | 1.0E-81 |
| sp|B5ZBP8|MNMA_UREU1 | tRNA-specific 2-thiouridylase MnmA OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=mnmA PE=3 SV=1 | 27 | 395 | 2.0E-81 |
| sp|P44551|MNMA_HAEIN | tRNA-specific 2-thiouridylase MnmA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mnmA PE=3 SV=2 | 16 | 391 | 2.0E-81 |
| sp|A4VYE7|MNMA_STRSY | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus suis (strain 05ZYH33) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-81 |
| sp|A4W4N7|MNMA_STRS2 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus suis (strain 98HAH33) GN=mnmA PE=3 SV=2 | 27 | 392 | 2.0E-81 |
| sp|Q5P7R7|MNMA_AROAE | tRNA-specific 2-thiouridylase MnmA OS=Aromatoleum aromaticum (strain EbN1) GN=mnmA PE=3 SV=1 | 25 | 391 | 3.0E-81 |
| sp|A1TWB8|MNMA_ACIAC | tRNA-specific 2-thiouridylase MnmA OS=Acidovorax citrulli (strain AAC00-1) GN=mnmA PE=3 SV=1 | 27 | 391 | 3.0E-81 |
| sp|A1WEN1|MNMA_VEREI | tRNA-specific 2-thiouridylase MnmA OS=Verminephrobacter eiseniae (strain EF01-2) GN=mnmA PE=3 SV=1 | 27 | 391 | 3.0E-81 |
| sp|B4SIN4|MNMA_STRM5 | tRNA-specific 2-thiouridylase MnmA OS=Stenotrophomonas maltophilia (strain R551-3) GN=mnmA PE=3 SV=1 | 27 | 394 | 4.0E-81 |
| sp|P59460|MNMA_BUCBP | tRNA-specific 2-thiouridylase MnmA OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mnmA PE=3 SV=1 | 27 | 393 | 4.0E-81 |
| sp|Q5ZVQ1|MNMA_LEGPH | tRNA-specific 2-thiouridylase MnmA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=mnmA PE=3 SV=1 | 27 | 393 | 5.0E-81 |
| sp|P0DC35|MNMA_STRPQ | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=mnmA PE=3 SV=1 | 28 | 392 | 6.0E-81 |
| sp|P0DC34|MNMA_STRP3 | tRNA-specific 2-thiouridylase MnmA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=mnmA PE=3 SV=1 | 28 | 392 | 6.0E-81 |
| sp|Q5WWV9|MNMA_LEGPL | tRNA-specific 2-thiouridylase MnmA OS=Legionella pneumophila (strain Lens) GN=mnmA PE=3 SV=1 | 27 | 393 | 8.0E-81 |
| sp|Q5X5H6|MNMA_LEGPA | tRNA-specific 2-thiouridylase MnmA OS=Legionella pneumophila (strain Paris) GN=mnmA PE=3 SV=1 | 27 | 393 | 1.0E-80 |
| sp|A5IBN1|MNMA_LEGPC | tRNA-specific 2-thiouridylase MnmA OS=Legionella pneumophila (strain Corby) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-80 |
| sp|Q0VQ25|MNMA_ALCBS | tRNA-specific 2-thiouridylase MnmA OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mnmA PE=3 SV=1 | 27 | 395 | 2.0E-80 |
| sp|Q4QP16|MNMA_HAEI8 | tRNA-specific 2-thiouridylase MnmA OS=Haemophilus influenzae (strain 86-028NP) GN=mnmA PE=3 SV=2 | 16 | 391 | 2.0E-80 |
| sp|Q8P9A1|MNMA_XANCP | tRNA-specific 2-thiouridylase MnmA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-80 |
| sp|B0RT32|MNMA_XANCB | tRNA-specific 2-thiouridylase MnmA OS=Xanthomonas campestris pv. campestris (strain B100) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-80 |
| sp|Q4UUJ7|MNMA_XANC8 | tRNA-specific 2-thiouridylase MnmA OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-80 |
| sp|Q65VV2|MNMA_MANSM | tRNA-specific 2-thiouridylase MnmA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=mnmA PE=3 SV=2 | 1 | 392 | 2.0E-80 |
| sp|Q9Z8A5|MNMA_CHLPN | tRNA-specific 2-thiouridylase MnmA OS=Chlamydia pneumoniae GN=mnmA PE=3 SV=1 | 28 | 392 | 3.0E-80 |
| sp|Q82VV0|MNMA_NITEU | tRNA-specific 2-thiouridylase MnmA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=mnmA PE=3 SV=1 | 27 | 391 | 4.0E-80 |
| sp|B2FQX2|MNMA_STRMK | tRNA-specific 2-thiouridylase MnmA OS=Stenotrophomonas maltophilia (strain K279a) GN=mnmA PE=3 SV=1 | 27 | 394 | 4.0E-80 |
| sp|Q7U375|MNMA_BORPA | tRNA-specific 2-thiouridylase MnmA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mnmA PE=3 SV=1 | 22 | 391 | 5.0E-80 |
| sp|Q2SZ45|MNMA_BURTA | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=mnmA PE=3 SV=1 | 27 | 395 | 6.0E-80 |
| sp|Q2Y6T6|MNMA_NITMU | tRNA-specific 2-thiouridylase MnmA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=mnmA PE=3 SV=1 | 27 | 394 | 7.0E-80 |
| sp|Q3SKH7|MNMA_THIDA | tRNA-specific 2-thiouridylase MnmA OS=Thiobacillus denitrificans (strain ATCC 25259) GN=mnmA PE=3 SV=1 | 27 | 391 | 7.0E-80 |
| sp|A8ES36|MNMA2_ARCB4 | tRNA-specific 2-thiouridylase MnmA 2 OS=Arcobacter butzleri (strain RM4018) GN=mnmA2 PE=3 SV=1 | 24 | 391 | 8.0E-80 |
| sp|Q7U359|MNMA_BORPE | tRNA-specific 2-thiouridylase MnmA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mnmA PE=3 SV=1 | 22 | 391 | 8.0E-80 |
| sp|Q7U387|MNMA_BORBR | tRNA-specific 2-thiouridylase MnmA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mnmA PE=3 SV=1 | 22 | 391 | 8.0E-80 |
| sp|A9IQK6|MNMA_BORPD | tRNA-specific 2-thiouridylase MnmA OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=mnmA PE=3 SV=1 | 14 | 391 | 9.0E-80 |
| sp|Q5ZKW0|MTU1_CHICK | Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Gallus gallus GN=TRMU PE=2 SV=1 | 25 | 393 | 1.0E-79 |
| sp|Q2SRW8|MNMA_MYCCT | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=mnmA PE=3 SV=1 | 27 | 394 | 1.0E-79 |
| sp|B0BS63|MNMA_ACTPJ | tRNA-specific 2-thiouridylase MnmA OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=mnmA PE=3 SV=1 | 15 | 393 | 1.0E-79 |
| sp|Q2KZ71|MNMA_BORA1 | tRNA-specific 2-thiouridylase MnmA OS=Bordetella avium (strain 197N) GN=mnmA PE=3 SV=1 | 23 | 391 | 2.0E-79 |
| sp|A3MYN0|MNMA_ACTP2 | tRNA-specific 2-thiouridylase MnmA OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=mnmA PE=3 SV=1 | 15 | 393 | 2.0E-79 |
| sp|A1K983|MNMA_AZOSB | tRNA-specific 2-thiouridylase MnmA OS=Azoarcus sp. (strain BH72) GN=mnmA PE=3 SV=1 | 27 | 391 | 2.0E-79 |
| sp|B1JVW3|MNMA_BURCC | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia cenocepacia (strain MC0-3) GN=mnmA PE=3 SV=1 | 27 | 395 | 2.0E-79 |
| sp|Q9PKA7|MNMA_CHLMU | tRNA-specific 2-thiouridylase MnmA OS=Chlamydia muridarum (strain MoPn / Nigg) GN=mnmA PE=3 SV=2 | 28 | 391 | 2.0E-79 |
| sp|A6SUW6|MNMA_JANMA | tRNA-specific 2-thiouridylase MnmA OS=Janthinobacterium sp. (strain Marseille) GN=mnmA PE=3 SV=1 | 27 | 395 | 2.0E-79 |
| sp|Q5GZR1|MNMA_XANOR | tRNA-specific 2-thiouridylase MnmA OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mnmA PE=3 SV=1 | 28 | 394 | 3.0E-79 |
| sp|B2SMD7|MNMA_XANOP | tRNA-specific 2-thiouridylase MnmA OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=mnmA1 PE=3 SV=1 | 28 | 394 | 3.0E-79 |
| sp|P57349|MNMA_BUCAI | tRNA-specific 2-thiouridylase MnmA OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mnmA PE=3 SV=1 | 30 | 392 | 7.0E-79 |
| sp|Q492R5|MNMA_BLOPB | tRNA-specific 2-thiouridylase MnmA OS=Blochmannia pennsylvanicus (strain BPEN) GN=mnmA PE=3 SV=1 | 27 | 393 | 9.0E-79 |
| sp|A6VLY4|MNMA_ACTSZ | tRNA-specific 2-thiouridylase MnmA OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-78 |
| sp|A5UFX6|MNMA_HAEIG | tRNA-specific 2-thiouridylase MnmA OS=Haemophilus influenzae (strain PittGG) GN=mnmA PE=3 SV=1 | 16 | 391 | 1.0E-78 |
| sp|Q98Q11|MNMA_MYCPU | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma pulmonis (strain UAB CTIP) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-78 |
| sp|Q3BTY6|MNMA_XANC5 | tRNA-specific 2-thiouridylase MnmA OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-78 |
| sp|A1AX17|MNMA_RUTMC | tRNA-specific 2-thiouridylase MnmA OS=Ruthia magnifica subsp. Calyptogena magnifica GN=mnmA PE=3 SV=1 | 24 | 392 | 2.0E-78 |
| sp|Q39JI1|MNMA_BURL3 | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-78 |
| sp|A0K4M4|MNMA_BURCH | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia cenocepacia (strain HI2424) GN=mnmA PE=3 SV=1 | 27 | 395 | 2.0E-78 |
| sp|Q1BZ27|MNMA_BURCA | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia cenocepacia (strain AU 1054) GN=mnmA PE=3 SV=1 | 27 | 395 | 2.0E-78 |
| sp|B4EE50|MNMA_BURCJ | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=mnmA PE=3 SV=1 | 27 | 395 | 3.0E-78 |
| sp|Q8K9Q8|MNMA_BUCAP | tRNA-specific 2-thiouridylase MnmA OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=mnmA PE=3 SV=1 | 23 | 392 | 3.0E-78 |
| sp|Q5F7G4|MNMA_NEIG1 | tRNA-specific 2-thiouridylase MnmA OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=mnmA PE=3 SV=2 | 28 | 394 | 4.0E-78 |
| sp|B9MIA2|MNMA_ACIET | tRNA-specific 2-thiouridylase MnmA OS=Acidovorax ebreus (strain TPSY) GN=mnmA PE=3 SV=1 | 27 | 391 | 5.0E-78 |
| sp|Q8PL08|MNMA_XANAC | tRNA-specific 2-thiouridylase MnmA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mnmA PE=3 SV=1 | 27 | 394 | 5.0E-78 |
| sp|Q6MTG1|MNMA_MYCMS | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=mnmA PE=3 SV=1 | 27 | 394 | 6.0E-78 |
| sp|Q5L6D1|MNMA_CHLAB | tRNA-specific 2-thiouridylase MnmA OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=mnmA PE=3 SV=1 | 28 | 392 | 7.0E-78 |
| sp|Q9JTJ9|MNMA_NEIMA | tRNA-specific 2-thiouridylase MnmA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=mnmA PE=3 SV=2 | 28 | 394 | 1.0E-77 |
| sp|O84289|MNMA_CHLTR | tRNA-specific 2-thiouridylase MnmA OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=mnmA PE=3 SV=1 | 28 | 392 | 1.0E-77 |
| sp|A5IYK6|MNMA_MYCAP | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma agalactiae (strain PG2) GN=mnmA PE=3 SV=1 | 27 | 393 | 1.0E-77 |
| sp|A5CW80|MNMA_VESOH | tRNA-specific 2-thiouridylase MnmA OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=mnmA PE=3 SV=1 | 24 | 392 | 1.0E-77 |
| sp|B0BBR8|MNMA_CHLTB | tRNA-specific 2-thiouridylase MnmA OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=mnmA PE=3 SV=1 | 28 | 392 | 2.0E-77 |
| sp|B0B7K3|MNMA_CHLT2 | tRNA-specific 2-thiouridylase MnmA OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=mnmA PE=3 SV=1 | 28 | 392 | 2.0E-77 |
| sp|Q3KM75|MNMA_CHLTA | tRNA-specific 2-thiouridylase MnmA OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=mnmA PE=3 SV=1 | 28 | 392 | 2.0E-77 |
| sp|A4JBM2|MNMA_BURVG | tRNA-specific 2-thiouridylase MnmA OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mnmA PE=3 SV=1 | 27 | 392 | 3.0E-77 |
| sp|A1WD47|MNMA_ACISJ | tRNA-specific 2-thiouridylase MnmA OS=Acidovorax sp. (strain JS42) GN=mnmA PE=3 SV=1 | 24 | 391 | 3.0E-77 |
| sp|A9NFP7|MNMA_ACHLI | tRNA-specific 2-thiouridylase MnmA OS=Acholeplasma laidlawii (strain PG-8A) GN=mnmA PE=3 SV=1 | 27 | 391 | 3.0E-77 |
| sp|Q9PDD9|MNMA_XYLFA | tRNA-specific 2-thiouridylase MnmA OS=Xylella fastidiosa (strain 9a5c) GN=mnmA PE=3 SV=1 | 27 | 394 | 5.0E-77 |
| sp|Q820E9|MNMA_CHLCV | tRNA-specific 2-thiouridylase MnmA OS=Chlamydophila caviae (strain GPIC) GN=mnmA PE=3 SV=1 | 28 | 392 | 5.0E-77 |
| sp|Q6KHK4|MNMA_MYCMO | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=mnmA PE=3 SV=1 | 27 | 394 | 1.0E-76 |
| sp|B1XX60|MNMA_LEPCP | tRNA-specific 2-thiouridylase MnmA OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=mnmA PE=3 SV=1 | 19 | 391 | 2.0E-76 |
| sp|A1KUY0|MNMA_NEIMF | tRNA-specific 2-thiouridylase MnmA OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=mnmA PE=3 SV=1 | 28 | 394 | 2.0E-76 |
| sp|A9M0Y5|MNMA_NEIM0 | tRNA-specific 2-thiouridylase MnmA OS=Neisseria meningitidis serogroup C (strain 053442) GN=mnmA PE=3 SV=2 | 28 | 394 | 3.0E-76 |
| sp|Q3J9J6|MNMA_NITOC | tRNA-specific 2-thiouridylase MnmA OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mnmA PE=3 SV=2 | 27 | 394 | 3.0E-76 |
| sp|Q9JYJ6|MNMA_NEIMB | tRNA-specific 2-thiouridylase MnmA OS=Neisseria meningitidis serogroup B (strain MC58) GN=mnmA PE=3 SV=1 | 28 | 394 | 3.0E-76 |
| sp|Q1LT51|MNMA_BAUCH | tRNA-specific 2-thiouridylase MnmA OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=mnmA PE=3 SV=1 | 27 | 392 | 4.0E-76 |
| sp|A9NDN1|MNMA_COXBR | tRNA-specific 2-thiouridylase MnmA OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=mnmA PE=3 SV=1 | 28 | 391 | 4.0E-76 |
| sp|Q2P2Q7|MNMA_XANOM | tRNA-specific 2-thiouridylase MnmA OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=mnmA PE=3 SV=1 | 28 | 394 | 9.0E-76 |
| sp|Q87DM0|MNMA_XYLFT | tRNA-specific 2-thiouridylase MnmA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mnmA PE=3 SV=1 | 27 | 394 | 1.0E-75 |
| sp|B2I9X8|MNMA_XYLF2 | tRNA-specific 2-thiouridylase MnmA OS=Xylella fastidiosa (strain M23) GN=mnmA PE=3 SV=1 | 27 | 394 | 1.0E-75 |
| sp|Q820W2|MNMA_COXBU | tRNA-specific 2-thiouridylase MnmA OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mnmA PE=3 SV=1 | 28 | 391 | 1.0E-75 |
| sp|A2SLT0|MNMA_METPP | tRNA-specific 2-thiouridylase MnmA OS=Methylibium petroleiphilum (strain PM1) GN=mnmA PE=3 SV=1 | 24 | 391 | 1.0E-75 |
| sp|B6IZW5|MNMA_COXB2 | tRNA-specific 2-thiouridylase MnmA OS=Coxiella burnetii (strain CbuG_Q212) GN=mnmA PE=3 SV=1 | 28 | 391 | 1.0E-75 |
| sp|A9KE87|MNMA_COXBN | tRNA-specific 2-thiouridylase MnmA OS=Coxiella burnetii (strain Dugway 5J108-111) GN=mnmA PE=3 SV=1 | 28 | 391 | 4.0E-75 |
| sp|B0U6Q7|MNMA_XYLFM | tRNA-specific 2-thiouridylase MnmA OS=Xylella fastidiosa (strain M12) GN=mnmA PE=3 SV=1 | 27 | 394 | 5.0E-75 |
| sp|B6J7H5|MNMA_COXB1 | tRNA-specific 2-thiouridylase MnmA OS=Coxiella burnetii (strain CbuK_Q154) GN=mnmA PE=3 SV=1 | 28 | 391 | 6.0E-75 |
| sp|Q47AW0|MNMA_DECAR | tRNA-specific 2-thiouridylase MnmA OS=Dechloromonas aromatica (strain RCB) GN=mnmA PE=3 SV=1 | 28 | 391 | 8.0E-75 |
| sp|Q9PQ88|MNMA_UREPA | tRNA-specific 2-thiouridylase MnmA OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=mnmA PE=3 SV=1 | 31 | 395 | 1.0E-74 |
| sp|B1AJ41|MNMA_UREP2 | tRNA-specific 2-thiouridylase MnmA OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=mnmA PE=3 SV=1 | 31 | 395 | 1.0E-74 |
| sp|Q122U9|MNMA_POLSJ | tRNA-specific 2-thiouridylase MnmA OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=mnmA PE=3 SV=2 | 27 | 391 | 2.0E-74 |
| sp|Q7U353|MNMA_BLOFL | tRNA-specific 2-thiouridylase MnmA OS=Blochmannia floridanus GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-74 |
| sp|Q0A8N7|MNMA_ALKEH | tRNA-specific 2-thiouridylase MnmA OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mnmA PE=3 SV=1 | 24 | 392 | 4.0E-74 |
| sp|A1VTY5|MNMA_POLNA | tRNA-specific 2-thiouridylase MnmA OS=Polaromonas naphthalenivorans (strain CJ2) GN=mnmA PE=3 SV=1 | 27 | 395 | 6.0E-74 |
| sp|A1WWV9|MNMA_HALHL | tRNA-specific 2-thiouridylase MnmA OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=mnmA PE=3 SV=1 | 27 | 392 | 7.0E-74 |
| sp|Q503J2|MTU1_DANRE | Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Danio rerio GN=trmu PE=2 SV=1 | 28 | 393 | 2.0E-73 |
| sp|O75648|MTU1_HUMAN | Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Homo sapiens GN=TRMU PE=1 SV=2 | 28 | 393 | 2.0E-73 |
| sp|Q8D397|MNMA_WIGBR | tRNA-specific 2-thiouridylase MnmA OS=Wigglesworthia glossinidia brevipalpis GN=mnmA PE=3 SV=1 | 24 | 392 | 2.0E-73 |
| sp|Q8CXQ3|MNMA_MYCPE | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma penetrans (strain HF-2) GN=mnmA PE=3 SV=1 | 27 | 392 | 3.0E-73 |
| sp|Q253W3|MNMA_CHLFF | tRNA-specific 2-thiouridylase MnmA OS=Chlamydophila felis (strain Fe/C-56) GN=mnmA PE=3 SV=1 | 28 | 392 | 5.0E-73 |
| sp|Q4A634|MNMA_MYCS5 | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma synoviae (strain 53) GN=mnmA PE=3 SV=1 | 28 | 392 | 8.0E-73 |
| sp|O13947|MTU1_SCHPO | Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H4.04 PE=3 SV=1 | 16 | 392 | 1.0E-72 |
| sp|A6H0G9|MNMA_FLAPJ | tRNA-specific 2-thiouridylase MnmA OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=mnmA PE=3 SV=1 | 27 | 391 | 2.0E-71 |
| sp|Q9W5B6|MTU1_DROME | Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Drosophila melanogaster GN=CG3021 PE=2 SV=3 | 37 | 391 | 3.0E-71 |
| sp|A5FHA9|MNMA_FLAJ1 | tRNA-specific 2-thiouridylase MnmA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=mnmA PE=3 SV=1 | 27 | 391 | 3.0E-71 |
| sp|Q4A9Q7|MNMA_MYCHJ | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=mnmA PE=3 SV=1 | 27 | 391 | 1.0E-70 |
| sp|Q600M2|MNMA_MYCH2 | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma hyopneumoniae (strain 232) GN=mnmA PE=3 SV=2 | 27 | 391 | 1.0E-70 |
| sp|Q5RB73|MTU1_PONAB | Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Pongo abelii GN=TRMU PE=2 SV=1 | 28 | 393 | 2.0E-70 |
| sp|Q4A7U1|MNMA_MYCH7 | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma hyopneumoniae (strain 7448) GN=mnmA PE=3 SV=1 | 27 | 391 | 3.0E-70 |
| sp|B3PM68|MNMA_MYCA5 | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma arthritidis (strain 158L3-1) GN=mnmA PE=3 SV=1 | 27 | 394 | 3.0E-70 |
| sp|A9BS40|MNMA_DELAS | tRNA-specific 2-thiouridylase MnmA OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=mnmA PE=3 SV=1 | 27 | 391 | 4.0E-70 |
| sp|Q9DAT5|MTU1_MOUSE | Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Mus musculus GN=Trmu PE=1 SV=1 | 28 | 393 | 4.0E-70 |
| sp|B1ZZ32|MNMA_OPITP | tRNA-specific 2-thiouridylase MnmA OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=mnmA PE=3 SV=1 | 26 | 390 | 6.0E-70 |
| sp|A0M3J2|MNMA_GRAFK | tRNA-specific 2-thiouridylase MnmA OS=Gramella forsetii (strain KT0803) GN=mnmA PE=3 SV=1 | 27 | 391 | 2.0E-69 |
| sp|B5RMM8|MNMA_BORDL | tRNA-specific 2-thiouridylase MnmA OS=Borrelia duttonii (strain Ly) GN=mnmA PE=3 SV=1 | 27 | 394 | 9.0E-69 |
| sp|B5RQ24|MNMA_BORRA | tRNA-specific 2-thiouridylase MnmA OS=Borrelia recurrentis (strain A1) GN=mnmA PE=3 SV=1 | 27 | 394 | 9.0E-69 |
| sp|Q2NIM9|MNMA_AYWBP | tRNA-specific 2-thiouridylase MnmA OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=mnmA PE=3 SV=1 | 27 | 394 | 1.0E-68 |
| sp|Q6YR90|MNMA_ONYPE | tRNA-specific 2-thiouridylase MnmA OS=Onion yellows phytoplasma (strain OY-M) GN=mnmA PE=3 SV=1 | 27 | 394 | 6.0E-68 |
| sp|B2UPK4|MNMA_AKKM8 | tRNA-specific 2-thiouridylase MnmA OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=mnmA PE=3 SV=1 | 27 | 381 | 7.0E-68 |
| sp|B1VAX7|MNMA_PHYAS | tRNA-specific 2-thiouridylase MnmA OS=Phytoplasma australiense GN=mnmA PE=3 SV=1 | 27 | 394 | 1.0E-67 |
| sp|P47537|MNMA_MYCGE | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=mnmA PE=3 SV=1 | 28 | 391 | 3.0E-67 |
| sp|Q17440|MTU1_CAEEL | Probable mitochondrial tRNA-specific 2-thiouridylase 1 OS=Caenorhabditis elegans GN=mttu-1 PE=3 SV=2 | 27 | 391 | 3.0E-66 |
| sp|A1R0A7|MNMA_BORT9 | tRNA-specific 2-thiouridylase MnmA OS=Borrelia turicatae (strain 91E135) GN=mnmA PE=3 SV=1 | 27 | 394 | 5.0E-66 |
| sp|B2S125|MNMA_BORHD | tRNA-specific 2-thiouridylase MnmA OS=Borrelia hermsii (strain HS1 / DAH) GN=mnmA PE=3 SV=2 | 27 | 394 | 1.0E-65 |
| sp|B7J2N7|MNMA_BORBZ | tRNA-specific 2-thiouridylase MnmA OS=Borrelia burgdorferi (strain ZS7) GN=mnmA PE=3 SV=1 | 27 | 387 | 2.0E-65 |
| sp|B1WC37|MTU1_RAT | Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Rattus norvegicus GN=Trmu PE=2 SV=1 | 28 | 393 | 2.0E-65 |
| sp|O51625|MNMA_BORBU | tRNA-specific 2-thiouridylase MnmA OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=mnmA PE=3 SV=1 | 27 | 387 | 2.0E-65 |
| sp|Q7NBZ0|MNMA_MYCGA | Trifunctional protein RibF/MnmA OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=ribF/mnmA PE=3 SV=1 | 27 | 393 | 4.0E-65 |
| sp|Q0SMH1|MNMA_BORAP | tRNA-specific 2-thiouridylase MnmA OS=Borrelia afzelii (strain PKo) GN=mnmA PE=3 SV=1 | 27 | 387 | 3.0E-64 |
| sp|Q660I8|MNMA_BORBP | tRNA-specific 2-thiouridylase MnmA OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=mnmA PE=3 SV=1 | 27 | 387 | 1.0E-63 |
| sp|P75365|MNMA_MYCPN | tRNA-specific 2-thiouridylase MnmA OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=mnmA PE=3 SV=1 | 28 | 391 | 2.0E-63 |
| sp|Q67LS2|MNMA_SYMTH | tRNA-specific 2-thiouridylase MnmA OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mnmA PE=3 SV=1 | 27 | 394 | 2.0E-62 |
| sp|A8Z5W4|MNMA_SULMW | tRNA-specific 2-thiouridylase MnmA OS=Sulcia muelleri (strain GWSS) GN=mnmA PE=3 SV=1 | 24 | 391 | 4.0E-62 |
| sp|B2J5L9|MNMA_NOSP7 | tRNA-specific 2-thiouridylase MnmA OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=mnmA PE=3 SV=1 | 27 | 395 | 1.0E-61 |
| sp|Q8YX56|MNMA_NOSS1 | tRNA-specific 2-thiouridylase MnmA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=mnmA PE=3 SV=1 | 27 | 395 | 2.0E-61 |
| sp|Q3M5R7|MNMA_ANAVT | tRNA-specific 2-thiouridylase MnmA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mnmA PE=3 SV=1 | 27 | 395 | 2.0E-61 |
| sp|Q5SLN5|MNMA_THET8 | tRNA-specific 2-thiouridylase MnmA OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-61 |
| sp|Q72GX1|MNMA_THET2 | tRNA-specific 2-thiouridylase MnmA OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-61 |
| sp|B5ENY8|MNMA_ACIF5 | tRNA-specific 2-thiouridylase MnmA OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=mnmA PE=3 SV=1 | 27 | 394 | 1.0E-60 |
| sp|B7J5X6|MNMA_ACIF2 | tRNA-specific 2-thiouridylase MnmA OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=mnmA PE=3 SV=1 | 27 | 394 | 1.0E-60 |
| sp|Q3AA24|MNMA_CARHZ | tRNA-specific 2-thiouridylase MnmA OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-60 |
| sp|A5GE36|MNMA_GEOUR | tRNA-specific 2-thiouridylase MnmA OS=Geobacter uraniireducens (strain Rf4) GN=mnmA PE=3 SV=1 | 20 | 392 | 2.0E-60 |
| sp|Q54I63|MTU1_DICDI | Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Dictyostelium discoideum GN=trmu PE=3 SV=1 | 12 | 394 | 4.0E-60 |
| sp|B0K0P8|MNMA2_THEPX | tRNA-specific 2-thiouridylase MnmA 2 OS=Thermoanaerobacter sp. (strain X514) GN=mnmA2 PE=3 SV=2 | 26 | 393 | 6.0E-60 |
| sp|B0K991|MNMA2_THEP3 | tRNA-specific 2-thiouridylase MnmA 2 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=mnmA2 PE=3 SV=1 | 26 | 393 | 6.0E-60 |
| sp|Q18BE2|MNMA_PEPD6 | tRNA-specific 2-thiouridylase MnmA OS=Peptoclostridium difficile (strain 630) GN=mnmA PE=3 SV=1 | 27 | 394 | 1.0E-59 |
| sp|Q057R1|MNMA_BUCCC | tRNA-specific 2-thiouridylase MnmA OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=mnmA PE=3 SV=1 | 31 | 394 | 2.0E-59 |
| sp|B0JVR4|MNMA_MICAN | tRNA-specific 2-thiouridylase MnmA OS=Microcystis aeruginosa (strain NIES-843) GN=mnmA PE=3 SV=1 | 27 | 391 | 2.0E-59 |
| sp|A5UV64|MNMA_ROSS1 | tRNA-specific 2-thiouridylase MnmA OS=Roseiflexus sp. (strain RS-1) GN=mnmA PE=3 SV=1 | 27 | 393 | 7.0E-59 |
| sp|Q8RAH7|MNMA1_CALS4 | tRNA-specific 2-thiouridylase MnmA 1 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mnmA1 PE=3 SV=1 | 26 | 393 | 3.0E-58 |
| sp|Q2LWA6|MNMA1_SYNAS | tRNA-specific 2-thiouridylase MnmA 1 OS=Syntrophus aciditrophicus (strain SB) GN=mnmA1 PE=3 SV=1 | 27 | 394 | 3.0E-58 |
| sp|A6LIF1|MNMA_PARD8 | tRNA-specific 2-thiouridylase MnmA OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mnmA PE=3 SV=1 | 32 | 391 | 4.0E-58 |
| sp|Q5PBB1|MNMA_ANAMM | tRNA-specific 2-thiouridylase MnmA OS=Anaplasma marginale (strain St. Maries) GN=mnmA PE=3 SV=1 | 1 | 389 | 4.0E-58 |
| sp|Q5MZ36|MNMA_SYNP6 | tRNA-specific 2-thiouridylase MnmA OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=mnmA PE=3 SV=1 | 26 | 394 | 4.0E-58 |
| sp|Q31N30|MNMA_SYNE7 | tRNA-specific 2-thiouridylase MnmA OS=Synechococcus elongatus (strain PCC 7942) GN=mnmA PE=3 SV=1 | 26 | 394 | 4.0E-58 |
| sp|B0K584|MNMA1_THEPX | tRNA-specific 2-thiouridylase MnmA 1 OS=Thermoanaerobacter sp. (strain X514) GN=mnmA1 PE=3 SV=2 | 23 | 393 | 6.0E-58 |
| sp|Q74A22|MNMA_GEOSL | tRNA-specific 2-thiouridylase MnmA OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mnmA PE=3 SV=1 | 27 | 392 | 1.0E-57 |
| sp|A9AYA7|MNMA_HERA2 | tRNA-specific 2-thiouridylase MnmA OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=mnmA PE=3 SV=1 | 27 | 391 | 1.0E-57 |
| sp|B0KC14|MNMA1_THEP3 | tRNA-specific 2-thiouridylase MnmA 1 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=mnmA1 PE=3 SV=2 | 23 | 393 | 2.0E-57 |
| sp|Q8R7F0|MNMA2_CALS4 | tRNA-specific 2-thiouridylase MnmA 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mnmA2 PE=3 SV=1 | 23 | 393 | 4.0E-57 |
| sp|B0TFA7|MNMA_HELMI | tRNA-specific 2-thiouridylase MnmA OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=mnmA PE=3 SV=1 | 26 | 394 | 5.0E-57 |
| sp|B7K1G5|MNMA_CYAP8 | tRNA-specific 2-thiouridylase MnmA OS=Cyanothece sp. (strain PCC 8801) GN=mnmA PE=3 SV=1 | 26 | 392 | 8.0E-57 |
| sp|Q73PV6|MNMA_TREDE | tRNA-specific 2-thiouridylase MnmA OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=mnmA PE=3 SV=1 | 27 | 384 | 2.0E-56 |
| sp|B2RHP0|MNMA_PORG3 | tRNA-specific 2-thiouridylase MnmA OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=mnmA PE=3 SV=1 | 28 | 393 | 2.0E-56 |
| sp|A5GUP6|MNMA_SYNR3 | tRNA-specific 2-thiouridylase MnmA OS=Synechococcus sp. (strain RCC307) GN=mnmA PE=3 SV=1 | 17 | 392 | 2.0E-56 |
| sp|B7KHE5|MNMA_CYAP7 | tRNA-specific 2-thiouridylase MnmA OS=Cyanothece sp. (strain PCC 7424) GN=mnmA PE=3 SV=1 | 26 | 393 | 4.0E-56 |
| sp|Q7MAW9|MNMA_PORGI | tRNA-specific 2-thiouridylase MnmA OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=mnmA PE=3 SV=1 | 28 | 393 | 5.0E-56 |
| sp|A6LSF2|MNMA_CLOB8 | tRNA-specific 2-thiouridylase MnmA OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=mnmA PE=3 SV=1 | 27 | 392 | 9.0E-56 |
| sp|Q7MBC9|MNMA_GLOVI | tRNA-specific 2-thiouridylase MnmA OS=Gloeobacter violaceus (strain PCC 7421) GN=mnmA PE=3 SV=1 | 27 | 391 | 1.0E-55 |
| sp|Q3Z8D8|MNMA_DEHM1 | tRNA-specific 2-thiouridylase MnmA OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=mnmA PE=3 SV=1 | 28 | 392 | 1.0E-55 |
| sp|Q1D6N0|MNMA_MYXXD | tRNA-specific 2-thiouridylase MnmA OS=Myxococcus xanthus (strain DK 1622) GN=mnmA PE=3 SV=1 | 27 | 389 | 3.0E-55 |
| sp|P73755|MNMA_SYNY3 | tRNA-specific 2-thiouridylase MnmA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mnmA PE=3 SV=1 | 27 | 391 | 3.0E-55 |
| sp|B1X0U7|MNMA_CYAA5 | tRNA-specific 2-thiouridylase MnmA OS=Cyanothece sp. (strain ATCC 51142) GN=mnmA PE=3 SV=2 | 27 | 391 | 3.0E-55 |
| sp|Q8XJH3|MNMA_CLOPE | tRNA-specific 2-thiouridylase MnmA OS=Clostridium perfringens (strain 13 / Type A) GN=mnmA PE=3 SV=2 | 27 | 392 | 9.0E-55 |
| sp|Q0TPH2|MNMA_CLOP1 | tRNA-specific 2-thiouridylase MnmA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=mnmA PE=3 SV=1 | 27 | 392 | 9.0E-55 |
| sp|Q3A3F8|MNMA_PELCD | tRNA-specific 2-thiouridylase MnmA OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mnmA PE=3 SV=1 | 24 | 389 | 1.0E-54 |
| sp|Q02BG1|MNMA_SOLUE | tRNA-specific 2-thiouridylase MnmA OS=Solibacter usitatus (strain Ellin6076) GN=mnmA PE=3 SV=1 | 28 | 392 | 1.0E-54 |
| sp|A3DDC8|MNMA_CLOTH | tRNA-specific 2-thiouridylase MnmA OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-54 |
| sp|Q2RHY7|MNMA_MOOTA | tRNA-specific 2-thiouridylase MnmA OS=Moorella thermoacetica (strain ATCC 39073) GN=mnmA PE=3 SV=1 | 29 | 395 | 3.0E-54 |
| sp|B1XM11|MNMA_SYNP2 | tRNA-specific 2-thiouridylase MnmA OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=mnmA PE=3 SV=2 | 27 | 392 | 3.0E-54 |
| sp|A9KPI9|MNMA_CLOPH | tRNA-specific 2-thiouridylase MnmA OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=mnmA PE=3 SV=1 | 27 | 391 | 6.0E-54 |
| sp|B2A5K1|MNMA_NATTJ | tRNA-specific 2-thiouridylase MnmA OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=mnmA PE=3 SV=1 | 26 | 395 | 8.0E-54 |
| sp|A8F5H8|MNMA_PSELT | tRNA-specific 2-thiouridylase MnmA OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mnmA PE=3 SV=1 | 27 | 393 | 2.0E-53 |
| sp|Q2RSS1|MNMA_RHORT | tRNA-specific 2-thiouridylase MnmA OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mnmA PE=3 SV=1 | 16 | 389 | 2.0E-53 |
| sp|Q9RTK1|MNMA_DEIRA | tRNA-specific 2-thiouridylase MnmA OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=mnmA PE=3 SV=2 | 24 | 391 | 2.0E-53 |
| sp|A0Q152|MNMA_CLONN | tRNA-specific 2-thiouridylase MnmA OS=Clostridium novyi (strain NT) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-53 |
| sp|B8CWH7|MNMA_HALOH | tRNA-specific 2-thiouridylase MnmA OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mnmA PE=3 SV=1 | 26 | 394 | 2.0E-53 |
| sp|B2THM7|MNMA_CLOBB | tRNA-specific 2-thiouridylase MnmA OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-53 |
| sp|Q0SS39|MNMA_CLOPS | tRNA-specific 2-thiouridylase MnmA OS=Clostridium perfringens (strain SM101 / Type A) GN=mnmA PE=3 SV=1 | 27 | 392 | 2.0E-53 |
| sp|Q3AV73|MNMA_SYNS9 | tRNA-specific 2-thiouridylase MnmA OS=Synechococcus sp. (strain CC9902) GN=mnmA PE=3 SV=1 | 27 | 393 | 3.0E-53 |
| sp|Q39XA9|MNMA_GEOMG | tRNA-specific 2-thiouridylase MnmA OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mnmA PE=3 SV=1 | 27 | 392 | 5.0E-53 |
| sp|Q8ABF5|MNMA1_BACTN | tRNA-specific 2-thiouridylase MnmA 1 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=mnmA1 PE=3 SV=1 | 32 | 393 | 7.0E-53 |
| sp|A9EXM5|MNMA_SORC5 | tRNA-specific 2-thiouridylase MnmA OS=Sorangium cellulosum (strain So ce56) GN=mnmA PE=3 SV=1 | 18 | 392 | 7.0E-53 |
| sp|Q4UM73|MNMA_RICFE | tRNA-specific 2-thiouridylase MnmA OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mnmA PE=3 SV=1 | 25 | 393 | 9.0E-53 |
| sp|Q319J8|MNMA_PROM9 | tRNA-specific 2-thiouridylase MnmA OS=Prochlorococcus marinus (strain MIT 9312) GN=mnmA PE=3 SV=1 | 28 | 391 | 9.0E-53 |
| sp|Q1IPC9|MNMA_KORVE | tRNA-specific 2-thiouridylase MnmA OS=Koribacter versatilis (strain Ellin345) GN=mnmA PE=3 SV=1 | 24 | 391 | 2.0E-52 |
| sp|A8EZE8|MNMA_RICCK | tRNA-specific 2-thiouridylase MnmA OS=Rickettsia canadensis (strain McKiel) GN=mnmA PE=3 SV=1 | 25 | 393 | 3.0E-52 |
| sp|A7HNX2|MNMA_FERNB | tRNA-specific 2-thiouridylase MnmA OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=mnmA PE=3 SV=1 | 27 | 392 | 3.0E-52 |
| sp|Q97GY2|MNMA_CLOAB | tRNA-specific 2-thiouridylase MnmA OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mnmA PE=3 SV=1 | 27 | 392 | 3.0E-52 |
| sp|Q1RJ52|MNMA_RICBR | tRNA-specific 2-thiouridylase MnmA OS=Rickettsia bellii (strain RML369-C) GN=mnmA PE=3 SV=1 | 28 | 393 | 4.0E-52 |
| sp|A8GVU7|MNMA_RICB8 | tRNA-specific 2-thiouridylase MnmA OS=Rickettsia bellii (strain OSU 85-389) GN=mnmA PE=3 SV=1 | 28 | 393 | 4.0E-52 |
| sp|Q3AL87|MNMA_SYNSC | tRNA-specific 2-thiouridylase MnmA OS=Synechococcus sp. (strain CC9605) GN=mnmA PE=3 SV=1 | 27 | 393 | 4.0E-52 |
| sp|A5GMJ9|MNMA_SYNPW | tRNA-specific 2-thiouridylase MnmA OS=Synechococcus sp. (strain WH7803) GN=mnmA PE=3 SV=1 | 27 | 395 | 4.0E-52 |
| sp|A0L678|MNMA_MAGMM | tRNA-specific 2-thiouridylase MnmA OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mnmA PE=3 SV=1 | 27 | 391 | 5.0E-52 |
| sp|Q3B625|MNMA_CHLL7 | tRNA-specific 2-thiouridylase MnmA OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=mnmA PE=3 SV=1 | 23 | 392 | 7.0E-52 |
| sp|B8G5F1|MNMA_CHLAD | tRNA-specific 2-thiouridylase MnmA OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=mnmA PE=3 SV=1 | 27 | 393 | 8.0E-52 |
| sp|Q7TTQ1|MNMA_PROMP | tRNA-specific 2-thiouridylase MnmA OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=mnmA PE=3 SV=1 | 21 | 391 | 9.0E-52 |
| sp|Q8CWM0|MNMA_THEEB | tRNA-specific 2-thiouridylase MnmA OS=Thermosynechococcus elongatus (strain BP-1) GN=mnmA PE=3 SV=1 | 28 | 392 | 9.0E-52 |
| sp|Q3ZXD7|MNMA_DEHMC | tRNA-specific 2-thiouridylase MnmA OS=Dehalococcoides mccartyi (strain CBDB1) GN=mnmA PE=3 SV=1 | 28 | 392 | 1.0E-51 |
| sp|A5FR85|MNMA_DEHMB | tRNA-specific 2-thiouridylase MnmA OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=mnmA PE=3 SV=2 | 28 | 392 | 1.0E-51 |
| sp|Q1J090|MNMA_DEIGD | tRNA-specific 2-thiouridylase MnmA OS=Deinococcus geothermalis (strain DSM 11300) GN=mnmA PE=3 SV=1 | 21 | 391 | 2.0E-51 |
| sp|A7ICB9|MNMA_XANP2 | tRNA-specific 2-thiouridylase MnmA OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=mnmA PE=3 SV=2 | 27 | 394 | 2.0E-51 |
| sp|Q64WG8|MNMA2_BACFR | tRNA-specific 2-thiouridylase MnmA 2 OS=Bacteroides fragilis (strain YCH46) GN=mnmA2 PE=3 SV=1 | 32 | 391 | 2.0E-51 |
| sp|A6KXF7|MNMA1_BACV8 | tRNA-specific 2-thiouridylase MnmA 1 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=mnmA1 PE=3 SV=1 | 32 | 391 | 2.0E-51 |
| sp|A2C457|MNMA_PROM1 | tRNA-specific 2-thiouridylase MnmA OS=Prochlorococcus marinus (strain NATL1A) GN=mnmA PE=3 SV=1 | 17 | 393 | 2.0E-51 |
| sp|B2V3V9|MNMA_CLOBA | tRNA-specific 2-thiouridylase MnmA OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=mnmA PE=3 SV=1 | 27 | 381 | 2.0E-51 |
| sp|Q5LFN5|MNMA2_BACFN | tRNA-specific 2-thiouridylase MnmA 2 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=mnmA2 PE=3 SV=1 | 32 | 391 | 3.0E-51 |
| sp|A8F172|MNMA_RICM5 | tRNA-specific 2-thiouridylase MnmA OS=Rickettsia massiliae (strain Mtu5) GN=mnmA PE=3 SV=2 | 25 | 393 | 3.0E-51 |
| sp|Q2GJG8|MNMA_ANAPZ | tRNA-specific 2-thiouridylase MnmA OS=Anaplasma phagocytophilum (strain HZ) GN=mnmA PE=3 SV=1 | 17 | 389 | 3.0E-51 |
| sp|A3PEC4|MNMA_PROM0 | tRNA-specific 2-thiouridylase MnmA OS=Prochlorococcus marinus (strain MIT 9301) GN=mnmA PE=3 SV=1 | 28 | 391 | 4.0E-51 |
| sp|A2BSL2|MNMA_PROMS | tRNA-specific 2-thiouridylase MnmA OS=Prochlorococcus marinus (strain AS9601) GN=mnmA PE=3 SV=1 | 28 | 391 | 4.0E-51 |
| sp|A4J2K1|MNMA_DESRM | tRNA-specific 2-thiouridylase MnmA OS=Desulfotomaculum reducens (strain MI-1) GN=mnmA PE=3 SV=1 | 27 | 394 | 5.0E-51 |
| sp|A1BI85|MNMA_CHLPD | tRNA-specific 2-thiouridylase MnmA OS=Chlorobium phaeobacteroides (strain DSM 266) GN=mnmA PE=3 SV=1 | 26 | 391 | 5.0E-51 |
| sp|A8G6A1|MNMA_PROM2 | tRNA-specific 2-thiouridylase MnmA OS=Prochlorococcus marinus (strain MIT 9215) GN=mnmA PE=3 SV=1 | 2 | 391 | 6.0E-51 |
| sp|Q2JM78|MNMA_SYNJB | tRNA-specific 2-thiouridylase MnmA OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=mnmA PE=3 SV=1 | 27 | 380 | 7.0E-51 |
| sp|Q68X66|MNMA_RICTY | tRNA-specific 2-thiouridylase MnmA OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=mnmA PE=3 SV=1 | 28 | 394 | 8.0E-51 |
| sp|Q7TTR0|MNMA_PROMM | tRNA-specific 2-thiouridylase MnmA OS=Prochlorococcus marinus (strain MIT 9313) GN=mnmA PE=3 SV=2 | 1 | 395 | 8.0E-51 |
| sp|A5D3F0|MNMA_PELTS | tRNA-specific 2-thiouridylase MnmA OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mnmA PE=3 SV=1 | 27 | 394 | 9.0E-51 |
| sp|Q9ZDM1|MNMA_RICPR | tRNA-specific 2-thiouridylase MnmA OS=Rickettsia prowazekii (strain Madrid E) GN=mnmA PE=3 SV=1 | 28 | 389 | 9.0E-51 |
| sp|Q8F625|MNMA_LEPIN | tRNA-specific 2-thiouridylase MnmA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=mnmA PE=3 SV=1 | 27 | 395 | 9.0E-51 |
| sp|A4XLP5|MNMA_CALS8 | tRNA-specific 2-thiouridylase MnmA OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mnmA PE=3 SV=1 | 27 | 394 | 9.0E-51 |
| sp|Q72Q44|MNMA_LEPIC | tRNA-specific 2-thiouridylase MnmA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=mnmA PE=3 SV=2 | 27 | 395 | 1.0E-50 |
| sp|C3PFT7|MNMA_CORA7 | tRNA-specific 2-thiouridylase MnmA OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=mnmA PE=3 SV=1 | 27 | 380 | 1.0E-50 |
| sp|Q7VAT9|MNMA_PROMA | tRNA-specific 2-thiouridylase MnmA OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=mnmA PE=3 SV=1 | 17 | 392 | 1.0E-50 |
| sp|Q92IL0|MNMA_RICCN | tRNA-specific 2-thiouridylase MnmA OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mnmA PE=3 SV=1 | 25 | 393 | 1.0E-50 |
| sp|Q5GTC8|MNMA_WOLTR | tRNA-specific 2-thiouridylase MnmA OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=mnmA PE=3 SV=2 | 27 | 389 | 1.0E-50 |
| sp|Q73FR5|MNMA_WOLPM | tRNA-specific 2-thiouridylase MnmA OS=Wolbachia pipientis wMel GN=mnmA PE=3 SV=1 | 27 | 389 | 2.0E-50 |
| sp|C0R4S5|MNMA_WOLWR | tRNA-specific 2-thiouridylase MnmA OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=mnmA PE=3 SV=1 | 27 | 389 | 3.0E-50 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 12 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Agabi119p4|053530 MQHLARLRRCFSTSLHVPRLQPRKGDKVVVGMSGGVDSSVAAWLLANQDFDLSAVYMRNWDTRDESGTDKGCEWE NDWEDVQRVCKKLGIPCQMIDLSQEYWNKVFEPSLQVWESGATPNPDVWCNREIKFGSLLERLPTSSIGNTWFAT GHYARKLWVIGNGLPRPQLLRGRDPTKDQSYYLSSISESGLRQALFPIGHLRKPEVRALARKYGLPTSDRPESMG ICFVGEKSRFNRFLSSYIPPKPGPIIDQTTGKAIGEHSGLWNFTIGENARIPGMHTKMFVSRKDTMSNSIFVVPG TNHSMLYCNALHVPVFNWIWKDSPHPELNLGRSFRAQAMHRYRMRSVPCTVHRDRDTGHIKIEFDEGEKAVSPGQ AAVLYDDEWCLGCGIIERTS* |
| Coding | >Agabi119p4|053530 ATGCAGCACCTGGCAAGACTCCGGCGCTGCTTCTCCACGTCGCTTCATGTTCCAAGATTGCAGCCTCGGAAAGGG GACAAGGTTGTCGTCGGCATGTCCGGCGGAGTCGATTCCTCCGTAGCTGCATGGCTATTAGCAAACCAAGACTTT GATCTTTCCGCGGTGTATATGCGTAACTGGGATACCCGCGATGAATCAGGGACAGACAAAGGTTGCGAGTGGGAA AATGATTGGGAAGACGTTCAACGAGTCTGTAAAAAGCTTGGGATACCGTGTCAAATGATCGACTTGTCACAGGAA TATTGGAACAAAGTTTTCGAGCCTTCACTGCAGGTCTGGGAGTCAGGCGCAACGCCAAATCCCGATGTATGGTGC AACAGAGAAATCAAGTTTGGTTCCCTCTTGGAAAGGCTTCCCACAAGTTCCATCGGGAATACTTGGTTTGCAACG GGCCATTACGCCCGCAAACTTTGGGTAATTGGCAACGGACTTCCTCGCCCACAACTTCTTCGTGGTAGGGATCCC ACCAAGGATCAATCATACTACCTATCTTCAATATCTGAGAGTGGTTTGCGACAAGCCCTCTTTCCAATAGGCCAC TTGCGCAAGCCAGAAGTACGGGCGCTTGCCAGAAAGTATGGTCTCCCCACCTCTGACCGCCCCGAAAGTATGGGT ATCTGCTTCGTTGGCGAAAAATCCCGATTCAATAGATTTCTCTCTTCATATATCCCCCCAAAACCTGGTCCAATT ATCGATCAGACAACAGGCAAAGCGATCGGCGAGCACTCTGGCCTTTGGAATTTCACTATTGGCGAGAATGCGCGG ATACCAGGAATGCACACAAAAATGTTCGTCTCCCGGAAGGATACAATGTCTAATTCCATCTTTGTTGTACCGGGA ACAAACCATTCCATGTTGTATTGCAATGCTCTCCACGTTCCCGTATTCAATTGGATATGGAAAGATTCGCCACAC CCAGAACTTAACCTTGGGAGAAGTTTTCGCGCGCAGGCGATGCATCGCTACCGCATGAGAAGCGTGCCTTGCACC GTTCATAGAGATCGAGATACTGGTCACATCAAAATAGAATTTGACGAAGGAGAAAAAGCTGTATCTCCAGGTCAA GCTGCCGTTCTCTACGACGATGAGTGGTGCTTAGGTTGTGGTATCATAGAGCGAACCTCATAA |
| Transcript | >Agabi119p4|053530 ATGCAGCACCTGGCAAGACTCCGGCGCTGCTTCTCCACGTCGCTTCATGTTCCAAGATTGCAGCCTCGGAAAGGG GACAAGGTTGTCGTCGGCATGTCCGGCGGAGTCGATTCCTCCGTAGCTGCATGGCTATTAGCAAACCAAGACTTT GATCTTTCCGCGGTGTATATGCGTAACTGGGATACCCGCGATGAATCAGGGACAGACAAAGGTTGCGAGTGGGAA AATGATTGGGAAGACGTTCAACGAGTCTGTAAAAAGCTTGGGATACCGTGTCAAATGATCGACTTGTCACAGGAA TATTGGAACAAAGTTTTCGAGCCTTCACTGCAGGTCTGGGAGTCAGGCGCAACGCCAAATCCCGATGTATGGTGC AACAGAGAAATCAAGTTTGGTTCCCTCTTGGAAAGGCTTCCCACAAGTTCCATCGGGAATACTTGGTTTGCAACG GGCCATTACGCCCGCAAACTTTGGGTAATTGGCAACGGACTTCCTCGCCCACAACTTCTTCGTGGTAGGGATCCC ACCAAGGATCAATCATACTACCTATCTTCAATATCTGAGAGTGGTTTGCGACAAGCCCTCTTTCCAATAGGCCAC TTGCGCAAGCCAGAAGTACGGGCGCTTGCCAGAAAGTATGGTCTCCCCACCTCTGACCGCCCCGAAAGTATGGGT ATCTGCTTCGTTGGCGAAAAATCCCGATTCAATAGATTTCTCTCTTCATATATCCCCCCAAAACCTGGTCCAATT ATCGATCAGACAACAGGCAAAGCGATCGGCGAGCACTCTGGCCTTTGGAATTTCACTATTGGCGAGAATGCGCGG ATACCAGGAATGCACACAAAAATGTTCGTCTCCCGGAAGGATACAATGTCTAATTCCATCTTTGTTGTACCGGGA ACAAACCATTCCATGTTGTATTGCAATGCTCTCCACGTTCCCGTATTCAATTGGATATGGAAAGATTCGCCACAC CCAGAACTTAACCTTGGGAGAAGTTTTCGCGCGCAGGCGATGCATCGCTACCGCATGAGAAGCGTGCCTTGCACC GTTCATAGAGATCGAGATACTGGTCACATCAAAATAGAATTTGACGAAGGAGAAAAAGCTGTATCTCCAGGTCAA GCTGCCGTTCTCTACGACGATGAGTGGTGCTTAGGTTGTGGTATCATAGAGCGAACCTCATAA |
| Gene | >Agabi119p4|053530 ATGCAGCACCTGGCAAGACTCCGGCGCTGCTTCTCCACGTCGCTTCATGTTCCAAGATTGCAGCCTCGGAAAGGG GACAAGGGTGCGCGCATATGTCCTCCGCGCAGCGCTCTCATTGACTGGCATCCTCAGTTGTCGTCGGCATGTCCG GCGGAGTCGATTCCTCCGTAGCTGCATGGCTATTAGCAAACCAAGTAGGTGTTCTTGCGTCGCCCAGGCCCAAAC TAATGTTCAGTAGGACTTTGATCTTTCCGCGGTGTATATGCGTAACTGGGATACCCGCGATGAATCAGGGACAGA CAAAGGTTGCGAGTGGGAAAATGATTGGGAAGACGTTCAACGAGTCTGTAAAAAGCTTGGGATACCGTGTCAAAT GGTATGCCAGCATCAATGGACGAAAGCATCTCTAATCACTGTGACAGATCGACTTGTCACAGGAATATTGGAACA AAGTTTTCGAGCCTTCACTGCAGGTCTGGGAGTCAGGCGCAACGCCAAATCCCGATGTATGGTGCAACAGGTCCG ATTTGAGGTTGTAATCCGTCTTTTGTTGCTCATATGAACTTTATGGATAGAGAAATCAAGTTTGGTTCCCTCTTG GAAAGGCTTCCCACAAGTTCCATCGGGAATACTTGGTTTGCAACGGGCCATTACGCCCGCAAACTTTGGGTAATT GGCAACGGACTTCCTCGCCCACAACTTCTTCGTGGTAGGGATCCCACCAAGGATCAATCATACTACCTATCTTCA ATATCTGAGAGTGGTTTGCGACAAGCCCTCTTTCCAATAGGCCACTTGCGCAAGCCAGAAGTACGGGCGCTTGCC AGAAAGTATGGTCTCCCCACCTCTGACCGCCCCGAAAGTATGGGTATCTGCTTCGTTGGCGAAAAATCCCGATTC AATAGATTTCTCTGTGAGTGTGCAATCTGATCCCTGTCGCCATTATTTGTTTAATCTGTTTCAGCTTCATATATC CCCCCAAAACCTGGTCCAATTATCGATCAGACAACAGGCAAAGCGATCGGCGAGCACTCTGGCCTTTGGAATTTC ACTATTGGCGAGAATGCGCGGATACCAGGAATGCACACAAAAATGTTCGTCTCCCGGAAGGATACAATGTCTAAT TCCATCTTTGTTGTACCGGGAACAAACCATTCCATGTTGTATTGCAATGCTCTCCACGTTCCCGTATTCAATTGG ATATGGAAAGATTCGCCACACCCAGAACTTAACCTTGGGAGAAGTTTTCGCGCGCAGGCGATGCATCGCTACCGC ATGAGAAGCGTGCCTTGCACCGTTCATAGGTATGAGCTTCTCACAGTATATGATTGTACTATTCATCGTCACCGC ACAATTTAGAGATCGAGATACTGGTCACATCAAAATAGAATTTGACGAAGGAGAAAAAGCTGTATCTCCAGGTCA AGCTGCCGTTCTCTACGACGATGAGTGGTGCTTAGGTTGTGGTATCATAGAGCGAACCTCATAA |