Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|052700
Gene name
Locationscaffold_03a:28384..32168
Strand+
Gene length (bp)3784
Transcript length (bp)2898
Coding sequence length (bp)2898
Protein length (aa) 966

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 4.0E-08 428 508

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 27 49 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|052700
MDKKGQAVLPLQSAAPPRSSKSHVWKIIVYALLLQFAFYFLYIRTYYFGDSVPNGTLRSVIRPDVVAHRSNLTER
CRTLRAPAGPPPSFDPASRLDGHSDRFVPGTRPVLIRDARIWTGHDDGKEVIHGDVLLDRGLVVGVGKLSEVDYE
EFKELSVVDAKGRWVTPGLVDLHSHIAVDSAPHLNGAADTNSRKAPILPWIRSIDGMNTHDQAFELTVSGGVSTA
QILPGSAGNIGGQAFVIKLRPTDEKSTISKVVEPPETLIKSSDNVTHVHWRHMKHACGENQDRVYNQVRMDAAWN
FREAYHTANEIKIAQDAFCDAVEAEYWDVVDGKDIPEDYQWESLVDVLRGKVRLSVHCYEAVDLDMMVRLSNEFQ
FHITSFHHGGDTHLVPDLLKKTFGGPPTVALFASNARKKREAYRNSEFAPRILASHDIPVVMKSDHPVLNSRHLL
FEAQLAHYYGLSTELALSSVTTTSAKAAGLSHRVGFLSKGYDADVVMWDSHPLSLGATPAQVFIDGIPQLKDPHV
LHKPDGLQRSPRTPNFDREARETVEFDGLPPLRRHHRFVNGEIIKLVNVSTVWAVNDMHDDHLSLDDIVPGASHD
VFLQDGTVICVTKMGSRCDVNGDLSTQAIHEIDLQGGALLPGLVSFGAPLGLEEIAQEPSTNDGSVPDALTGSVP
AIAGGTNTIIRAVDGLAFNGRNLLHAYRNGVTKAITAPSGGGFIQGLSTEIFTGAENAIQRRAILQEETALHITI
SHSVDASISTQIATLRQLLLQSDTPAWKRVRERDIPLVVNVDSADIMSTLLRLKAEFRHNTGNDFDMTFTGGSEA
HLIAEDIARAGVSVIVTMPRPYPGNWESQRILAGAPLTHDNVVMELLEAGVNVGIGVIDGYAVRNTRFEVAWLAL
NSFGEIGRWEALALVTINVQRALRTHKQQNVMPSELVAYQGGDWMDFQSRVVGVFSNEQGIAEIF*
Coding >Agabi119p4|052700
ATGGACAAGAAGGGTCAAGCCGTCCTGCCTCTGCAATCTGCTGCGCCACCCAGGTCCAGCAAAAGCCATGTTTGG
AAAATAATCGTTTATGCTCTCCTCCTCCAATTCGCGTTCTACTTTCTTTACATTCGAACCTACTACTTCGGAGAT
TCAGTCCCAAACGGCACACTTCGATCCGTCATACGACCTGACGTTGTTGCTCACCGTTCTAATTTGACTGAACGT
TGCCGAACTTTACGAGCCCCCGCAGGACCTCCGCCATCCTTTGACCCGGCATCTCGTCTCGACGGACATTCCGAC
CGCTTCGTTCCAGGCACGCGACCCGTGCTTATCCGTGATGCTAGGATCTGGACAGGTCACGATGATGGTAAGGAG
GTCATACACGGCGACGTTCTATTGGATCGTGGTTTGGTAGTCGGCGTTGGAAAGTTGTCTGAGGTGGACTATGAG
GAATTCAAAGAGCTGAGTGTGGTGGATGCGAAGGGACGCTGGGTAACGCCAGGTCTGGTTGATTTACACTCCCAT
ATTGCCGTGGACAGTGCCCCACATCTTAATGGTGCTGCCGATACGAACTCGCGCAAGGCCCCTATTCTGCCTTGG
ATCCGAAGCATTGACGGAATGAACACCCATGATCAGGCGTTCGAACTCACTGTTTCCGGCGGCGTGTCGACCGCG
CAAATATTACCAGGAAGTGCGGGCAACATCGGTGGACAGGCTTTCGTGATCAAATTAAGGCCTACAGACGAGAAA
TCGACCATTTCAAAGGTTGTGGAACCTCCGGAGACGTTGATCAAATCATCAGATAATGTCACCCATGTTCATTGG
AGACACATGAAACACGCGTGTGGCGAAAACCAGGACAGAGTATATAACCAAGTGCGAATGGATGCTGCCTGGAAT
TTCCGGGAGGCTTACCATACCGCGAATGAAATCAAGATTGCCCAAGATGCCTTCTGCGATGCGGTAGAGGCGGAA
TACTGGGATGTTGTGGACGGAAAGGACATTCCTGAAGATTATCAATGGGAGTCCCTGGTTGATGTCCTAAGAGGC
AAAGTTCGCCTCTCAGTCCATTGTTACGAGGCTGTTGATCTCGACATGATGGTTCGGTTATCAAACGAATTCCAG
TTCCACATCACGTCTTTCCATCATGGAGGAGATACCCATCTTGTCCCCGATCTCTTGAAGAAGACTTTCGGAGGA
CCGCCGACTGTTGCATTATTTGCCTCGAACGCACGGAAAAAGCGTGAAGCTTATCGCAATTCCGAATTTGCACCA
CGAATTCTGGCAAGCCATGATATTCCGGTTGTGATGAAGTCTGACCATCCAGTGCTGAACTCCCGCCATCTTCTT
TTTGAGGCACAACTTGCTCACTACTATGGCTTAAGCACAGAACTAGCTCTATCGTCTGTAACCACTACATCAGCG
AAAGCGGCTGGTTTAAGCCACCGAGTAGGCTTCTTAAGTAAAGGTTATGACGCAGACGTTGTCATGTGGGACTCT
CACCCGTTAAGCCTGGGAGCAACTCCGGCTCAAGTATTCATTGACGGTATCCCACAGCTCAAAGATCCTCATGTT
CTTCACAAGCCTGACGGTCTTCAACGATCGCCACGAACGCCAAATTTCGACCGAGAGGCACGTGAAACTGTTGAA
TTCGACGGTCTTCCACCACTACGCAGGCACCATCGCTTCGTAAACGGAGAGATTATCAAATTAGTCAACGTCAGC
ACTGTATGGGCAGTAAACGACATGCATGACGATCATCTTTCACTTGATGATATAGTCCCTGGCGCATCACATGAT
GTATTCCTTCAGGACGGGACGGTTATTTGCGTTACAAAGATGGGTTCTCGATGTGATGTTAATGGGGATCTAAGC
ACTCAAGCGATCCACGAGATAGATTTGCAGGGTGGAGCTTTGTTGCCTGGTTTAGTGTCATTTGGTGCTCCGCTA
GGCTTGGAGGAAATCGCTCAGGAACCTTCGACGAATGACGGATCTGTCCCAGATGCTTTGACGGGATCGGTTCCC
GCGATCGCCGGAGGAACGAATACCATTATACGTGCTGTTGATGGATTAGCATTCAACGGCAGGAACCTTTTGCAT
GCATACCGTAATGGTGTCACTAAAGCAATCACCGCACCCTCTGGAGGGGGATTTATCCAGGGTCTTTCAACAGAA
ATTTTCACTGGGGCAGAGAATGCTATTCAGCGTAGAGCCATTTTACAAGAGGAGACCGCGCTTCATATTACGATC
AGTCACAGCGTCGATGCAAGTATTAGTACGCAGATTGCAACGCTTCGACAACTCTTGTTGCAATCGGACACCCCC
GCATGGAAGCGTGTCCGCGAGAGGGATATTCCGTTGGTTGTCAATGTCGACAGCGCAGACATCATGTCAACACTG
CTTAGATTGAAAGCCGAATTCCGTCATAACACCGGTAACGATTTCGACATGACCTTCACTGGAGGCTCCGAAGCA
CATTTGATTGCTGAGGATATTGCACGAGCTGGTGTCAGTGTCATTGTTACTATGCCGCGGCCCTATCCCGGAAAT
TGGGAGAGTCAACGAATATTGGCGGGTGCACCACTAACGCACGACAATGTTGTCATGGAACTTCTCGAAGCTGGA
GTGAACGTTGGAATTGGGGTTATAGATGGCTACGCAGTTCGCAACACAAGATTTGAAGTCGCTTGGCTAGCCCTC
AACTCGTTTGGAGAGATTGGTAGATGGGAAGCCTTGGCTCTTGTCACTATCAATGTCCAGCGTGCACTTCGAACG
CATAAACAACAGAACGTTATGCCATCTGAGCTCGTGGCTTACCAAGGCGGTGACTGGATGGACTTCCAGAGCAGA
GTCGTTGGCGTGTTTTCAAATGAACAAGGAATTGCCGAAATATTCTGA
Transcript >Agabi119p4|052700
ATGGACAAGAAGGGTCAAGCCGTCCTGCCTCTGCAATCTGCTGCGCCACCCAGGTCCAGCAAAAGCCATGTTTGG
AAAATAATCGTTTATGCTCTCCTCCTCCAATTCGCGTTCTACTTTCTTTACATTCGAACCTACTACTTCGGAGAT
TCAGTCCCAAACGGCACACTTCGATCCGTCATACGACCTGACGTTGTTGCTCACCGTTCTAATTTGACTGAACGT
TGCCGAACTTTACGAGCCCCCGCAGGACCTCCGCCATCCTTTGACCCGGCATCTCGTCTCGACGGACATTCCGAC
CGCTTCGTTCCAGGCACGCGACCCGTGCTTATCCGTGATGCTAGGATCTGGACAGGTCACGATGATGGTAAGGAG
GTCATACACGGCGACGTTCTATTGGATCGTGGTTTGGTAGTCGGCGTTGGAAAGTTGTCTGAGGTGGACTATGAG
GAATTCAAAGAGCTGAGTGTGGTGGATGCGAAGGGACGCTGGGTAACGCCAGGTCTGGTTGATTTACACTCCCAT
ATTGCCGTGGACAGTGCCCCACATCTTAATGGTGCTGCCGATACGAACTCGCGCAAGGCCCCTATTCTGCCTTGG
ATCCGAAGCATTGACGGAATGAACACCCATGATCAGGCGTTCGAACTCACTGTTTCCGGCGGCGTGTCGACCGCG
CAAATATTACCAGGAAGTGCGGGCAACATCGGTGGACAGGCTTTCGTGATCAAATTAAGGCCTACAGACGAGAAA
TCGACCATTTCAAAGGTTGTGGAACCTCCGGAGACGTTGATCAAATCATCAGATAATGTCACCCATGTTCATTGG
AGACACATGAAACACGCGTGTGGCGAAAACCAGGACAGAGTATATAACCAAGTGCGAATGGATGCTGCCTGGAAT
TTCCGGGAGGCTTACCATACCGCGAATGAAATCAAGATTGCCCAAGATGCCTTCTGCGATGCGGTAGAGGCGGAA
TACTGGGATGTTGTGGACGGAAAGGACATTCCTGAAGATTATCAATGGGAGTCCCTGGTTGATGTCCTAAGAGGC
AAAGTTCGCCTCTCAGTCCATTGTTACGAGGCTGTTGATCTCGACATGATGGTTCGGTTATCAAACGAATTCCAG
TTCCACATCACGTCTTTCCATCATGGAGGAGATACCCATCTTGTCCCCGATCTCTTGAAGAAGACTTTCGGAGGA
CCGCCGACTGTTGCATTATTTGCCTCGAACGCACGGAAAAAGCGTGAAGCTTATCGCAATTCCGAATTTGCACCA
CGAATTCTGGCAAGCCATGATATTCCGGTTGTGATGAAGTCTGACCATCCAGTGCTGAACTCCCGCCATCTTCTT
TTTGAGGCACAACTTGCTCACTACTATGGCTTAAGCACAGAACTAGCTCTATCGTCTGTAACCACTACATCAGCG
AAAGCGGCTGGTTTAAGCCACCGAGTAGGCTTCTTAAGTAAAGGTTATGACGCAGACGTTGTCATGTGGGACTCT
CACCCGTTAAGCCTGGGAGCAACTCCGGCTCAAGTATTCATTGACGGTATCCCACAGCTCAAAGATCCTCATGTT
CTTCACAAGCCTGACGGTCTTCAACGATCGCCACGAACGCCAAATTTCGACCGAGAGGCACGTGAAACTGTTGAA
TTCGACGGTCTTCCACCACTACGCAGGCACCATCGCTTCGTAAACGGAGAGATTATCAAATTAGTCAACGTCAGC
ACTGTATGGGCAGTAAACGACATGCATGACGATCATCTTTCACTTGATGATATAGTCCCTGGCGCATCACATGAT
GTATTCCTTCAGGACGGGACGGTTATTTGCGTTACAAAGATGGGTTCTCGATGTGATGTTAATGGGGATCTAAGC
ACTCAAGCGATCCACGAGATAGATTTGCAGGGTGGAGCTTTGTTGCCTGGTTTAGTGTCATTTGGTGCTCCGCTA
GGCTTGGAGGAAATCGCTCAGGAACCTTCGACGAATGACGGATCTGTCCCAGATGCTTTGACGGGATCGGTTCCC
GCGATCGCCGGAGGAACGAATACCATTATACGTGCTGTTGATGGATTAGCATTCAACGGCAGGAACCTTTTGCAT
GCATACCGTAATGGTGTCACTAAAGCAATCACCGCACCCTCTGGAGGGGGATTTATCCAGGGTCTTTCAACAGAA
ATTTTCACTGGGGCAGAGAATGCTATTCAGCGTAGAGCCATTTTACAAGAGGAGACCGCGCTTCATATTACGATC
AGTCACAGCGTCGATGCAAGTATTAGTACGCAGATTGCAACGCTTCGACAACTCTTGTTGCAATCGGACACCCCC
GCATGGAAGCGTGTCCGCGAGAGGGATATTCCGTTGGTTGTCAATGTCGACAGCGCAGACATCATGTCAACACTG
CTTAGATTGAAAGCCGAATTCCGTCATAACACCGGTAACGATTTCGACATGACCTTCACTGGAGGCTCCGAAGCA
CATTTGATTGCTGAGGATATTGCACGAGCTGGTGTCAGTGTCATTGTTACTATGCCGCGGCCCTATCCCGGAAAT
TGGGAGAGTCAACGAATATTGGCGGGTGCACCACTAACGCACGACAATGTTGTCATGGAACTTCTCGAAGCTGGA
GTGAACGTTGGAATTGGGGTTATAGATGGCTACGCAGTTCGCAACACAAGATTTGAAGTCGCTTGGCTAGCCCTC
AACTCGTTTGGAGAGATTGGTAGATGGGAAGCCTTGGCTCTTGTCACTATCAATGTCCAGCGTGCACTTCGAACG
CATAAACAACAGAACGTTATGCCATCTGAGCTCGTGGCTTACCAAGGCGGTGACTGGATGGACTTCCAGAGCAGA
GTCGTTGGCGTGTTTTCAAATGAACAAGGAATTGCCGAAATATTCTGA
Gene >Agabi119p4|052700
ATGGACAAGAAGGGTATTCTTCCTGACACGCATGTTTACTTTAAACTAACTCGGATTTAACGAGCAGGTCAAGCC
GGTTGCCCATTAGGTCACTCGCGCCTTCATGAAGCCTCTTACAGTCCTGCCTCTGCAATCTGCTGCGCCACCCAG
GTCCAGCAAAAGCCATGTTTGGAAAATAATCGTTTATGCTCTCCTCCTCCAATTCGCGTTCTACTTTCTTTACAT
TCGAACCTACTACTTCGGAGATTCAGTCCCAAACGGCACACTTCGATCCGTCATACGACCTGACGTTGTTGCTCA
CCGTTCTAATTTGACTGAACGTTGCCGAACTTTACGAGCCCCCGCAGGACCTCCGCCATCCTTTGACCCGGCATC
TCGTCTCGACGGACATTCCGACCGCTTCGTTCCAGGCACGCGACCCGTGCTTATCCGTGATGCTAGGATCTGGAC
AGGTCACGATGATGGTAAGGAGGTCATACACGGCGACGTTCTATTGGATCGTGGTTTGGTAGTCGGCGTTGGAAA
GTTGTCTGAGGTGGACTATGAGGAATTCAAAGAGCTGAGTGTGGTGGATGCGAAGGGACGCTGGGTAACGCCAGG
TCTGGTTGATTTACACTCCCATATTGCCGTGGACAGTGCCCCACATCTTAATGGTGCGTGTTATTGGGTCCCCCA
AAATTGCTCTACTGATCGTTTGATGAACAGGTGCTGCCGATACGAACTCGCGCAAGGCCCCTATTCTGCCTTGGA
TCCGAAGCATTGACGGAATGAACACCCATGATCAGGCGTTCGAACTCACTGTTTCCGGCGGCGTGTCGACCGCGC
AAATATTACCAGGAAGTGCGGGCAACATCGGTATGTAACTCATCTGCTCGTGTATCCGTGCCATGACACACCGCG
TTTTAGGTGGACAGGCTTTCGTGATCAAATTAAGGCCTACAGACGAGAAATCGACCATTTCAAAGGTTGTGGAAC
CTCCGGAGACGTTGATCAAATCATCAGATAATGTCACCCATGTTCATTGGAGACACATGAAGTACGCGTGCTTCT
TTACTTTGATTGTTGACTGACATCCTTCCTTCGGGATAGACACGCGTGTGGTATGTTTTCTGCCAATGACCCTCG
TTCGAGATCATAACGTCTTCAAGGCGAAAACCAGGACAGAGTATATAACCAAGTGCGAATGGATGCTGCCTGGAA
TTTCCGGGAGGCTTACCATACCGCGAATGAAATCAAGATTGCCCAAGATGCCTTCTGCGATGCGGTAGAGGCGGA
ATACTGGGATGTTGTGGACGGAAAGGACATTCCTGAAGATTATCAATGGGAGTCCCTGGTTGATGTCCTAAGAGG
CAAAGTTCGCGTAAGTCGAAGCCATGTACTTTCGTGGTTCAACTAGTGACCCAAGACAGCTCTCAGTCCATTGTT
ACGAGGTATGCTCTGTGCTTTGTCGATACCCTTGACCTACCTTGTTTGTCAGGCTGTTGATCTCGACATGATGGT
TCGGGTAAGCTTGGATAAACCTTCTGTCTTGTCCAGTTCACTAACTTTCATTCCAGTTATCAAACGAATTCCAGT
TCCACATCACGTCTTTCCATCATGGAGGAGATACCCATCTTGTCCCCGATCTCTTGAAGAAGACTTTCGTTAGTG
ATTAATCTGGGTCTTTCTGACTCTTTGAACTGACATTCTATCAAGGGAGGACCGCCGACTGTTGCATTATTTGCC
TCGAACGCACGGAAAAAGCGTGAAGCTTATCGCAATTCCGAATTTGCACCACGAATTCTGGCAAGCCATGATATT
CCGGTTGTGATGAAGGTGCGCACCTCATGCTCCCTTGCACTTGGGATGGCGACTCATGACGATCTATAGTCTGAC
CATCCAGTGCTGAACTCCCGCCATCTTCTTTTTGAGGCACAACTTGCTCACTACTATGGCTTAAGCACAGAACTA
GCTCTATCGTCTGTAACCACTACATCAGCGAAAGCGGCTGGTTTAAGCCACCGAGTAGGCTTCTTAAGTAAAGGT
TAGCTCTATATTGAGAACGTGTCAACGCAGCATGATTTAATTGCATATTCTCTAGGTTATGACGCAGGTAAGGTG
CCCATTTCCCCAAGTATGCAAGAATGTAATGACTATCCTTCTAGACGTTGTCATGTGGGACTCTCACCCGTTAAG
CCTGGGAGCAACTCCGGCTCAAGTATTCATTGACGGTATCCCACAGCTCAAAGATCCTCATGTTCTTCACAAGCC
TGACGGTCTTCAACGATCGCCACGAACGCCAAATTTCGACCGAGAGGCACGTGAAACTGTTGAATTCGACGGTCT
TCCACCACTACGCAGGCACCATCGCTTCGTAAACGGAGAGATTATCAAATTAGTCAACGTCAGCACTGTATGGGC
AGTAAACGACATGCATGACGATCATCTTTCACTTGATGATATAGTCCCTGGCGCATCACATGATGTATTCCTTCA
GGACGGGACGGTTATTTGCGTTACAAAGATGGGTTCTCGATGTGATGTTAATGGGGATCTAAGCACTCAAGCGAT
CCACGAGATAGATTTGCAGGGTGGAGCTTTGTTGCCTGGTTTAGTGTCATTTGGTGCTCCGCTAGGCTTGGAGGA
AATCGCTCAGGAACCTTCGACGAATGACGGATCTGTCCCAGATGCTTTGACGGGATCGGTTCCCGCGATCGCCGG
AGGAACGAATACCATTATACGTGCTGTTGATGGATTAGCATTCAACGGCAGGAACCTTTTGTATGTTTTGTCTTC
GTCTCTCTTGCCTCTTCAATTTTTACATTATATAGGCATGCATACCGTAATGGTGTCACTAAAGCAATCACCGCA
CCCTCTGGAGGGGGATTTATCCAGGGTCTTTCAACAGAAATTTTCACTGGGGCAGAGAATGCTATTCAGCGTAGA
GCCATTTTACAAGAGGAGACCGCGCTTCATATTACGATCAGTCACAGCGTCGATGCAAGTATTAGTACGCAGATT
GCAACGCTTCGACAACTCTTGTTGCAATCGGACACCCCCGCATGGAAGCGTGTCCGCGAGGCGAGTTAATGTCTA
CTTCGTTGGTACTTATCTCTAAAGTCTTATTGGTTTTATAGAGGGATATTCCGTTGGTTGTCAATGTCGACAGCG
CAGACATCATGTCAACACTGCTTAGATTGAAAGCCGAATTCCGTCATAACACCGGTAACGATTTCGACATGACCT
TCACTGGAGGCTCCGAAGCACATTTGATTGCTGAGGATATTGCACGAGCTGGTGTCAGTGTCATTGTTACTATGC
CGCGGCCCTATCCCGGAAATTGGGAGAGTCAACGAATGTGAGGCTTTGTGCTTTCGTTCGACTTCAATCTACTAG
ACCTAATATTGTGTATATATTCAGATTGGCGGGTGCACCACTAACGCACGACAATGTTGTCATGGAACTTCTCGA
AGCTGGAGTGAACGTTGGAATTGGGGTTATAGATGGCTACGCAGTTCGCAACACAAGATTTGAAGTCGCTTGGGT
ATGTCGGTGGCTTTCTACACGAAACGCCAGGTTTACTAAGACCTTACTATAGCTAGCCCTCAACTCGTTTGGAGA
GATTGGTAGATGGGAAGCCTTGGCTCTTGTCACTATCAATGTCCAGCGTGCACTTCGAACGCATAAACAACAGAA
CGTTATGCCATCTGAGCTCGTGGCTTACCAAGGCGGTGACTGGATGGACTTCCAGAGCAGAGTCGTTGGCGTGTT
TTCAAATGAACAAGGAATTGCCGAAATATTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail