Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|052380
Gene name
Locationscaffold_02:3190796..3192192
Strand-
Gene length (bp)1396
Transcript length (bp)1185
Coding sequence length (bp)1185
Protein length (aa) 395

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01758 SBF Sodium Bile acid symporter family 5.8E-47 75 269

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P45946|ARSB_BACSU Arsenite resistance protein ArsB OS=Bacillus subtilis (strain 168) GN=arsB PE=3 SV=2 28 369 4.0E-86
sp|Q06598|ARR3_YEAST Arsenical-resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARR3 PE=1 SV=1 1 381 8.0E-81
sp|Q8NQC8|ACR3_CORGL Arsenical-resistance protein Acr3 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=acr3 PE=1 SV=2 29 375 2.0E-76
sp|P74311|Y944_SYNY3 Uncharacterized transporter slr0944 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0944 PE=3 SV=1 30 386 2.0E-41
sp|A6TP80|ACR3_ALKMQ Arsenical-resistance protein Acr3 OS=Alkaliphilus metalliredigens (strain QYMF) GN=acr3 PE=1 SV=1 28 350 2.0E-26

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 64 86 22
3 107 129 22
4 139 158 19
5 165 187 22
6 207 229 22
7 241 263 22
8 278 300 22
9 321 343 22
10 348 370 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|052380
MSNDKELQGIACSRMASPRTSSIKGVWQQLSWLDRLLSPLILLAMILGTILSEFTPQVRQALNVAHFNGVSVPIV
IGLVVMMWPVLTKVQYEKLPALFSSSKIWVQIGISVALNWIVGPFVMLGLAWATLPDLPTYRTGVIMVGIARCIA
MVMIWNTIAKGHVEYCAILVVFNAVLQIALYSPYAVWFINVIGRQDGGIKISYGDVAISVLIYLGIPLVAGVVTR
YSIWLIAGKRFLVETFVPYFSPVALLGLLYTIIVLFAYQGHEMLHHIGPVFRVFVPLVLYFIVMWSSAFALMYYL
NQKERKKGSEAFDYEIAVSQAFTAASNNFELAIAVAIAVYGVDSQQALAATVGPLVEVPVLLALTWVALLCKDRL
GWQRLNEDTEKDGGDECQK*
Coding >Agabi119p4|052380
ATGTCAAACGACAAGGAACTACAAGGTATTGCGTGTTCTCGCATGGCTTCTCCACGAACTTCATCAATAAAAGGT
GTATGGCAGCAACTAAGCTGGCTCGACCGATTGCTGTCACCCCTCATCCTACTGGCTATGATCCTTGGCACAATT
CTAAGCGAGTTCACGCCTCAAGTTAGACAAGCTTTGAACGTCGCCCATTTCAACGGTGTTTCCGTCCCTATCGTT
ATTGGACTGGTCGTAATGATGTGGCCCGTACTTACGAAAGTTCAATACGAGAAACTCCCCGCCCTCTTTTCCTCC
TCGAAAATATGGGTACAAATCGGCATTTCCGTCGCACTGAATTGGATCGTCGGTCCATTTGTCATGCTTGGATTG
GCTTGGGCTACTTTACCAGACCTTCCGACATATCGCACTGGCGTCATTATGGTTGGCATTGCACGATGCATCGCT
ATGGTCATGATCTGGAACACCATTGCTAAAGGCCATGTCGAGTACTGTGCCATCCTCGTGGTCTTCAACGCTGTT
TTGCAAATCGCCTTGTATTCCCCGTATGCCGTATGGTTTATCAACGTCATTGGGCGTCAGGACGGAGGCATCAAA
ATCTCCTACGGGGACGTCGCAATTTCCGTTCTTATATATCTTGGTATTCCCTTGGTCGCTGGGGTCGTTACTCGA
TATTCGATCTGGCTCATCGCCGGAAAGCGATTCCTAGTCGAGACTTTCGTCCCATATTTCTCTCCAGTTGCACTT
TTGGGCCTTCTCTACACAATCATCGTCCTTTTTGCGTATCAAGGTCACGAGATGCTCCATCACATAGGCCCAGTG
TTTCGTGTCTTCGTACCTCTGGTGCTCTATTTCATTGTCATGTGGTCATCCGCGTTCGCATTGATGTATTATTTG
AACCAAAAAGAACGCAAAAAAGGTTCCGAGGCATTCGACTATGAGATCGCCGTATCTCAAGCTTTCACTGCAGCT
AGCAATAATTTCGAACTCGCTATTGCGGTTGCTATTGCTGTATACGGCGTTGACTCCCAGCAAGCACTCGCGGCT
ACGGTCGGGCCTCTTGTCGAAGTTCCGGTCTTGCTTGCATTGACTTGGGTGGCGCTATTATGCAAGGACAGGCTG
GGCTGGCAGAGATTGAACGAGGATACAGAGAAGGACGGAGGCGATGAATGTCAAAAGTAA
Transcript >Agabi119p4|052380
ATGTCAAACGACAAGGAACTACAAGGTATTGCGTGTTCTCGCATGGCTTCTCCACGAACTTCATCAATAAAAGGT
GTATGGCAGCAACTAAGCTGGCTCGACCGATTGCTGTCACCCCTCATCCTACTGGCTATGATCCTTGGCACAATT
CTAAGCGAGTTCACGCCTCAAGTTAGACAAGCTTTGAACGTCGCCCATTTCAACGGTGTTTCCGTCCCTATCGTT
ATTGGACTGGTCGTAATGATGTGGCCCGTACTTACGAAAGTTCAATACGAGAAACTCCCCGCCCTCTTTTCCTCC
TCGAAAATATGGGTACAAATCGGCATTTCCGTCGCACTGAATTGGATCGTCGGTCCATTTGTCATGCTTGGATTG
GCTTGGGCTACTTTACCAGACCTTCCGACATATCGCACTGGCGTCATTATGGTTGGCATTGCACGATGCATCGCT
ATGGTCATGATCTGGAACACCATTGCTAAAGGCCATGTCGAGTACTGTGCCATCCTCGTGGTCTTCAACGCTGTT
TTGCAAATCGCCTTGTATTCCCCGTATGCCGTATGGTTTATCAACGTCATTGGGCGTCAGGACGGAGGCATCAAA
ATCTCCTACGGGGACGTCGCAATTTCCGTTCTTATATATCTTGGTATTCCCTTGGTCGCTGGGGTCGTTACTCGA
TATTCGATCTGGCTCATCGCCGGAAAGCGATTCCTAGTCGAGACTTTCGTCCCATATTTCTCTCCAGTTGCACTT
TTGGGCCTTCTCTACACAATCATCGTCCTTTTTGCGTATCAAGGTCACGAGATGCTCCATCACATAGGCCCAGTG
TTTCGTGTCTTCGTACCTCTGGTGCTCTATTTCATTGTCATGTGGTCATCCGCGTTCGCATTGATGTATTATTTG
AACCAAAAAGAACGCAAAAAAGGTTCCGAGGCATTCGACTATGAGATCGCCGTATCTCAAGCTTTCACTGCAGCT
AGCAATAATTTCGAACTCGCTATTGCGGTTGCTATTGCTGTATACGGCGTTGACTCCCAGCAAGCACTCGCGGCT
ACGGTCGGGCCTCTTGTCGAAGTTCCGGTCTTGCTTGCATTGACTTGGGTGGCGCTATTATGCAAGGACAGGCTG
GGCTGGCAGAGATTGAACGAGGATACAGAGAAGGACGGAGGCGATGAATGTCAAAAGTAA
Gene >Agabi119p4|052380
ATGTCAAACGACAAGGAACTACAAGGTATTGCGTGTTCTCGCATGGCTTCTCCACGAACTTCATCAATAAAAGGT
GTGTGCCCAAAGGCTCAAAGCACTGACCTGACATATAACACGGACCTTCAGGTGTATGGCAGCAACTAAGCTGGC
TCGACCGATTGCTGTCACCCCTCATCCTACTGGCTATGATCCTTGGCACAATTCTAAGCGAGTTCACGCCTCAAG
TTAGACAAGCTTTGAACGTCGCCCATTTCAACGGTGTTTCCGTCCGTAAGTACTTTGCTTTCTTCATTGCCGCCG
AGTACCTAACCTATTTTTTAATCCTATAGCTATCGTTATTGGACTGGTCGTAATGATGTGGCCCGTACTTACGAA
AGTTCAATACGAGAAACTCCCCGCCCTCTTTTCCTCCTCGAAAATATGGGTACAAATCGGCATTTCCGTCGCACT
GAATTGGATCGTCGGTCCATTTGTCATGCTTGGATTGGCTTGGGCTACTTTACCAGACCTTCCGACATATCGCAC
TGGCGTCATTATGGTTGGCATTGCACGATGCATCGCTATGGTCATGATCTGGAACACCATTGCTAAAGGCCATGT
CGAGTACTGTGCCATCCTCGTGGTCTTCAACGCTGTTTTGCAAATCGCCTTGTATTCCCCGTATGCCGTATGGTT
TATCAACGTCATTGGGCGTCAGGACGGAGGCATCAAAATCTCCTACGGGGACGTCGCAATTTCCGTTCTTATAGT
GCGCATCCTCCTCCTTCGTATTTCCCTTAACCTTACGTTCATAATAGTATCTTGGTATTCCCTTGGTCGCTGGGG
TCGTTACTCGATATTCGATCTGGCTCATCGCCGGAAAGCGATTCCTAGTCGAGACTTTCGTCCCATATTTCTCTC
CAGTTGCACTTTTGGGCCTTCTCTACACAATCATCGTCCTTTTTGCGTATCAAGGTCACGAGATGCTCCATCACA
TAGGCCCAGTGTTTCGTGTCTTCGTACCTCTGGTGCTCTATTTCATTGTCATGTGGTCATCCGCGTTCGCATTGA
TGTATTATTTGAACCAAAAAGAACGCAAAAAAGGTTCCGAGGCATTCGACTATGAGATCGCCGTATCTCAAGCTT
TCACTGCAGCTAGCAATAATTTCGTGAGTTTACCTCCTTGTGTGTTTATCTTTAGCTCACGACTTTATTCGAGGA
ACTCGCTATTGCGGTTGCTATTGCTGTATACGGCGTTGACTCCCAGCAAGCACTCGCGGCTACGGTCGGGCCTCT
TGTCGAAGTTCCGGTCTTGCTTGCATTGACTTGGGTGGCGCTATTATGCAAGGACAGGCTGGGCTGGCAGAGATT
GAACGAGGATACAGAGAAGGACGGAGGCGATGAATGTCAAAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail