Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|049530
Gene name
Locationscaffold_02:2612037..2613007
Strand+
Gene length (bp)970
Transcript length (bp)654
Coding sequence length (bp)654
Protein length (aa) 218

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04777 Evr1_Alr Erv1 / Alr family 4.5E-28 79 167

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12284|ERV2_YEAST FAD-linked sulfhydryl oxidase ERV2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV2 PE=1 SV=1 64 176 1.0E-38
sp|Q9Y806|ERV2_SCHPO FAD-linked sulfhydryl oxidase erv2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv2 PE=3 SV=1 53 173 8.0E-27
sp|P56213|ALR_MOUSE FAD-linked sulfhydryl oxidase ALR OS=Mus musculus GN=Gfer PE=1 SV=2 74 180 1.0E-24
sp|Q63042|ALR_RAT FAD-linked sulfhydryl oxidase ALR OS=Rattus norvegicus GN=Gfer PE=1 SV=2 74 180 2.0E-24
sp|P55789|ALR_HUMAN FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens GN=GFER PE=1 SV=2 74 180 7.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12284|ERV2_YEAST FAD-linked sulfhydryl oxidase ERV2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV2 PE=1 SV=1 64 176 1.0E-38
sp|Q9Y806|ERV2_SCHPO FAD-linked sulfhydryl oxidase erv2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv2 PE=3 SV=1 53 173 8.0E-27
sp|P56213|ALR_MOUSE FAD-linked sulfhydryl oxidase ALR OS=Mus musculus GN=Gfer PE=1 SV=2 74 180 1.0E-24
sp|Q63042|ALR_RAT FAD-linked sulfhydryl oxidase ALR OS=Rattus norvegicus GN=Gfer PE=1 SV=2 74 180 2.0E-24
sp|P55789|ALR_HUMAN FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens GN=GFER PE=1 SV=2 74 180 7.0E-23
sp|P27882|ERV1_YEAST Mitochondrial FAD-linked sulfhydryl oxidase ERV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV1 PE=1 SV=2 77 173 3.0E-20
sp|O14144|ERV1_SCHPO Mitochondrial FAD-linked sulfhydryl oxidase erv1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv1 PE=3 SV=1 75 169 5.0E-20
sp|Q8GXX0|ERV1_ARATH FAD-linked sulfhydryl oxidase ERV1 OS=Arabidopsis thaliana GN=ERV1 PE=1 SV=1 74 170 6.0E-20
[Show less]

GO

GO Term Description Terminal node
GO:0016972 thiol oxidase activity Yes
GO:0016491 oxidoreductase activity No
GO:0003824 catalytic activity No
GO:0016670 oxidoreductase activity, acting on a sulfur group of donors, oxygen as acceptor No
GO:0016667 oxidoreductase activity, acting on a sulfur group of donors No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|049530
MISRFAKSLFIILFALVGLTMLAMLHPPSRAYLNPLTGQLFGEGGVEQTLNRPPKEGVVHGGVIMAKLGNETAKA
ALGRATWKLLHTVTLRFPENPTPDEREALDSYIRLTSRVYPCGECAAELQELLKVYPPQTSSRRAASLWLCSLHN
QVNERLNKPEYDCSQLSTEYDCGCGDDPLDSTTTKTTLNPPKFDPMDLEIDTTKDEITGAGLIKGGR*
Coding >Agabi119p4|049530
ATGATCTCCCGCTTCGCAAAGTCTCTCTTTATCATTCTATTCGCCCTGGTTGGGCTCACCATGCTGGCCATGCTG
CACCCGCCGTCTCGCGCGTACCTTAATCCCTTGACAGGCCAGCTTTTCGGCGAGGGTGGCGTCGAGCAAACATTG
AATCGACCACCTAAGGAGGGGGTCGTACATGGCGGCGTGATAATGGCGAAACTAGGAAATGAAACTGCAAAAGCT
GCCCTTGGGAGGGCTACTTGGAAGTTGCTACATACAGTGACTCTCCGGTTTCCTGAAAACCCAACACCGGATGAA
CGCGAAGCACTCGACTCGTATATCCGTCTAACCTCACGGGTGTATCCATGCGGTGAATGCGCAGCTGAACTTCAG
GAACTACTGAAAGTTTATCCGCCCCAAACATCATCACGCCGTGCTGCTTCGCTATGGCTATGTAGCCTCCATAAT
CAAGTGAACGAGCGACTGAACAAACCAGAATACGACTGCTCCCAGCTATCTACCGAATACGACTGCGGCTGTGGA
GACGATCCACTTGATTCAACTACAACAAAAACGACACTAAATCCTCCGAAATTTGACCCCATGGATCTTGAAATT
GATACAACAAAGGACGAGATAACAGGGGCTGGACTCATCAAAGGTGGCCGATGA
Transcript >Agabi119p4|049530
ATGATCTCCCGCTTCGCAAAGTCTCTCTTTATCATTCTATTCGCCCTGGTTGGGCTCACCATGCTGGCCATGCTG
CACCCGCCGTCTCGCGCGTACCTTAATCCCTTGACAGGCCAGCTTTTCGGCGAGGGTGGCGTCGAGCAAACATTG
AATCGACCACCTAAGGAGGGGGTCGTACATGGCGGCGTGATAATGGCGAAACTAGGAAATGAAACTGCAAAAGCT
GCCCTTGGGAGGGCTACTTGGAAGTTGCTACATACAGTGACTCTCCGGTTTCCTGAAAACCCAACACCGGATGAA
CGCGAAGCACTCGACTCGTATATCCGTCTAACCTCACGGGTGTATCCATGCGGTGAATGCGCAGCTGAACTTCAG
GAACTACTGAAAGTTTATCCGCCCCAAACATCATCACGCCGTGCTGCTTCGCTATGGCTATGTAGCCTCCATAAT
CAAGTGAACGAGCGACTGAACAAACCAGAATACGACTGCTCCCAGCTATCTACCGAATACGACTGCGGCTGTGGA
GACGATCCACTTGATTCAACTACAACAAAAACGACACTAAATCCTCCGAAATTTGACCCCATGGATCTTGAAATT
GATACAACAAAGGACGAGATAACAGGGGCTGGACTCATCAAAGGTGGCCGATGA
Gene >Agabi119p4|049530
ATGATCTCCCGCTTCGCAAAGTCTCTCTTTATCATTCTATTCGCCCTGGCAAGTCAAACATTTTTTTCATGAGTT
TCTATTGACATTTCACTTAGGTTGGGCTCACCATGCTGGCCATGCTGCACCCGCCGTCTCGCGCGTACCTTAATC
CCTTGACAGGCCAGCTTTTCGGCGAGGGTGGCGTCGAGCAAACATTGAATCGACCACCTAAGGAGGGGGTCGTAC
ATGGCGGCGTGATAATGGCGAAACTAGGAAATGAAACTGCAAAGTAATGAGTCTTGCCCCATAGGTCCACCACCT
TCGTCATTCTGATCTCGACAGAGCTGCCCTTGGGAGGGCTACTTGGAAGTTGCTGTATGTCTTTTTTACGTGGCG
CTACATAAGCTTGACTCGGTTTGCAGACATACAGTGACTCTCCGGTTTCCTGAAGTACGTGTCGCCGACGAATGT
CTGGATAATGAAATTAACACTCAGCTTTTGTAGAACCCAACACCGGATGAACGCGAAGCACTCGACTCGTATATC
CGTCTAACCTCACGGGTGTATCCATGCGGTGAATGCGCAGCTGAACTTCAGGAACTACTGAAAGTTTATCCGCCC
CAAGTACGTTCATTGCCTAAAATCATTTACCCTTTGTGTATTGACGCATTCTAATAGACATCATCACGCCGTGCT
GCTTCGCTATGGTATGATTATCCTCACTCCATTTCCCTTCCGATCATGACTCACCAATTACATTTCTTGAAGGCT
ATGTAGCCTCCATAATCAAGTGAACGAGCGACTGAACAAACCAGAATACGACTGCTCCCAGCTATCTACCGAATA
CGACTGCGGCTGTGGAGACGATCCACTTGATTCAACTACAACAAAAACGACACTAAATCCTCCGAAATTTGACCC
CATGGATCTTGAAATTGATACAACAAAGGACGAGATAACAGGGGCTGGACTCATCAAAGGTGGCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail