Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|048590
Gene name
Locationscaffold_02:2432748..2433842
Strand+
Gene length (bp)1094
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04889 Cwf_Cwc_15 Cwf15/Cwc15 cell cycle control protein 1.1E-83 1 272

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B020|CWC15_EMENI Pre-mRNA-splicing factor cwc15 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc15 PE=3 SV=1 1 272 1.0E-34
sp|O45766|CWC15_CAEEL Protein CWC15 homolog OS=Caenorhabditis elegans GN=T10C6.5 PE=3 SV=1 1 272 5.0E-33
sp|P78794|CWC15_SCHPO Pre-mRNA-splicing factor cwf15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf15 PE=1 SV=2 1 271 2.0E-30
sp|Q6NUB2|CW15A_XENLA Protein CWC15 homolog A OS=Xenopus laevis GN=cwc15-a PE=2 SV=1 162 272 6.0E-27
sp|Q0VFP5|CWC15_XENTR Protein CWC15 homolog OS=Xenopus tropicalis GN=cwc15 PE=2 SV=1 165 272 6.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5B020|CWC15_EMENI Pre-mRNA-splicing factor cwc15 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cwc15 PE=3 SV=1 1 272 1.0E-34
sp|O45766|CWC15_CAEEL Protein CWC15 homolog OS=Caenorhabditis elegans GN=T10C6.5 PE=3 SV=1 1 272 5.0E-33
sp|P78794|CWC15_SCHPO Pre-mRNA-splicing factor cwf15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf15 PE=1 SV=2 1 271 2.0E-30
sp|Q6NUB2|CW15A_XENLA Protein CWC15 homolog A OS=Xenopus laevis GN=cwc15-a PE=2 SV=1 162 272 6.0E-27
sp|Q0VFP5|CWC15_XENTR Protein CWC15 homolog OS=Xenopus tropicalis GN=cwc15 PE=2 SV=1 165 272 6.0E-25
sp|Q6DKE6|CW15B_XENLA Protein CWC15 homolog B OS=Xenopus laevis GN=cwc15-b PE=2 SV=1 165 272 2.0E-24
sp|Q9V3B6|CWC15_DROME Protein CWC15 homolog OS=Drosophila melanogaster GN=c12.1 PE=2 SV=1 163 272 1.0E-23
sp|Q9JHS9|CWC15_MOUSE Spliceosome-associated protein CWC15 homolog OS=Mus musculus GN=Cwc15 PE=1 SV=1 162 272 2.0E-23
sp|Q5BJP2|CWC15_RAT Spliceosome-associated protein CWC15 homolog OS=Rattus norvegicus GN=Cwc15 PE=1 SV=1 162 272 2.0E-23
sp|Q2KJD3|CWC15_BOVIN Spliceosome-associated protein CWC15 homolog OS=Bos taurus GN=CWC15 PE=2 SV=1 162 272 2.0E-23
sp|Q5RE65|CWC15_PONAB Spliceosome-associated protein CWC15 homolog OS=Pongo abelii GN=CWC15 PE=2 SV=1 162 272 2.0E-23
sp|Q9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog OS=Homo sapiens GN=CWC15 PE=1 SV=2 162 272 2.0E-23
sp|Q6IQU4|CWC15_DANRE Protein CWC15 homolog OS=Danio rerio GN=cwc15 PE=2 SV=1 162 272 2.0E-18
sp|Q6C0E6|CWC15_YARLI Pre-mRNA-splicing factor CWC15 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CWC15 PE=3 SV=1 1 272 2.0E-18
sp|Q6BP48|CWC15_DEBHA Pre-mRNA-splicing factor CWC15 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CWC15 PE=3 SV=2 1 272 3.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0000398 mRNA splicing, via spliceosome Yes
GO:0005681 spliceosomal complex Yes
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0032991 protein-containing complex No
GO:0006807 nitrogen compound metabolic process No
GO:0006396 RNA processing No
GO:0044238 primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006397 mRNA processing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008380 RNA splicing No
GO:1990904 ribonucleoprotein complex No
GO:0016070 RNA metabolic process No
GO:0140513 nuclear protein-containing complex No
GO:0071704 organic substance metabolic process No
GO:0000377 RNA splicing, via transesterification reactions with bulged adenosine as nucleophile No
GO:0016071 mRNA metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0000375 RNA splicing, via transesterification reactions No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|048590
MSTAHRPTWDPAQARTVVGGSRQFSVRDMAAHTKLKFRQVGQTSASEVKKRDLRAELFLAEAEAKNKKRKAEGKP
PLPIEGISASSETQAMAEGGGDEESNKRRKLLQEALDLDKDDDDDDDDEEGEKGEKVGDNGSASKKGAADESSEE
EEEDSDDEEDETAELLRELDKIKRERAEDKARKEQEQSDQDAATREEHIATANPLLNLAAALGQTPAGLNTTAPG
TFSVKKRWDDDLVFKNQSMNDGGKPQHFVNDLLRTEFHKKFMSKFIK*
Coding >Agabi119p4|048590
ATGTCGACAGCGCATAGACCGACATGGGATCCAGCGCAGGCTAGGACTGTCGTGGGTGGCTCACGACAATTCTCT
GTCCGTGATATGGCCGCCCATACAAAACTTAAATTCCGTCAAGTTGGTCAAACGTCTGCATCGGAAGTCAAGAAA
CGTGATCTTCGAGCTGAATTGTTTTTGGCGGAAGCGGAGGCGAAGAATAAGAAACGAAAGGCGGAGGGGAAGCCA
CCGTTGCCTATCGAGGGTATTTCTGCTTCTTCTGAAACGCAGGCGATGGCGGAAGGTGGTGGTGATGAGGAGTCG
AATAAGAGGAGAAAGTTGTTACAAGAGGCGTTGGATTTGGATAAAGATGATGATGATGATGATGATGACGAGGAA
GGGGAGAAAGGGGAGAAAGTCGGTGATAATGGAAGTGCGTCTAAGAAGGGCGCAGCAGATGAAAGCAGTGAAGAA
GAGGAAGAGGACTCTGATGACGAAGAAGACGAAACCGCTGAATTGTTACGTGAACTCGATAAAATAAAACGAGAA
CGAGCAGAAGACAAAGCAAGAAAAGAGCAAGAGCAATCAGATCAAGATGCAGCTACAAGAGAAGAACATATAGCT
ACAGCGAATCCATTATTGAATCTCGCTGCTGCGCTTGGTCAAACGCCTGCTGGATTGAATACGACAGCGCCTGGA
ACTTTCTCTGTGAAGAAACGTTGGGATGATGATCTTGTATTTAAGAATCAGTCGATGAATGACGGTGGAAAACCT
CAACACTTTGTCAATGACCTACTTCGAACAGAGTTTCACAAAAAGTTCATGTCGAAATTTATAAAGTAA
Transcript >Agabi119p4|048590
ATGTCGACAGCGCATAGACCGACATGGGATCCAGCGCAGGCTAGGACTGTCGTGGGTGGCTCACGACAATTCTCT
GTCCGTGATATGGCCGCCCATACAAAACTTAAATTCCGTCAAGTTGGTCAAACGTCTGCATCGGAAGTCAAGAAA
CGTGATCTTCGAGCTGAATTGTTTTTGGCGGAAGCGGAGGCGAAGAATAAGAAACGAAAGGCGGAGGGGAAGCCA
CCGTTGCCTATCGAGGGTATTTCTGCTTCTTCTGAAACGCAGGCGATGGCGGAAGGTGGTGGTGATGAGGAGTCG
AATAAGAGGAGAAAGTTGTTACAAGAGGCGTTGGATTTGGATAAAGATGATGATGATGATGATGATGACGAGGAA
GGGGAGAAAGGGGAGAAAGTCGGTGATAATGGAAGTGCGTCTAAGAAGGGCGCAGCAGATGAAAGCAGTGAAGAA
GAGGAAGAGGACTCTGATGACGAAGAAGACGAAACCGCTGAATTGTTACGTGAACTCGATAAAATAAAACGAGAA
CGAGCAGAAGACAAAGCAAGAAAAGAGCAAGAGCAATCAGATCAAGATGCAGCTACAAGAGAAGAACATATAGCT
ACAGCGAATCCATTATTGAATCTCGCTGCTGCGCTTGGTCAAACGCCTGCTGGATTGAATACGACAGCGCCTGGA
ACTTTCTCTGTGAAGAAACGTTGGGATGATGATCTTGTATTTAAGAATCAGTCGATGAATGACGGTGGAAAACCT
CAACACTTTGTCAATGACCTACTTCGAACAGAGTTTCACAAAAAGTTCATGTCGAAATTTATAAAGTAA
Gene >Agabi119p4|048590
ATGTCGACAGCGCATAGACCGACATGGGATCCAGCGCAGGCTAGGACTGTCGTGGGTGGCTCACGACAATTCTCT
GTCCGTGATATGGCCGCCCATACAAAACTTAAATTCCGGTATGTAACCCCGAATTAAAATATTCAATTTTCATAT
TTATCAAACTCTCTAATCTAGTCAAGTTGGTCAAACGTCTGCATCGGAAGTCAAGAAACGTGATCTTCGAGCTGA
ATTGTTTTTGGCGGAAGCGGAGGCGAAGAATAAGAAACGAAAGGCGGAGGGGAAGCCACCGTTGCCTATCGAGGG
TATTTCTGCTTCTTCTGAAACGCAGGCGATGGCGGAAGGTGGTGGTGATGAGGAGTCGAATAAGAGGAGAAAGTT
GTTACAAGAGGCGTTGGATTTGGATAAAGATGATGATGATGATGATGATGACGAGGAAGGGGAGAAAGGGGAGAA
AGTCGGTGATAATGGAAGTGCGTCTAAGAAGGGCGCAGCAGATGAAAGGTGCGTTACTCATTCTATCTAATATCA
CCAACCGACTTAAATTTATCTCAGCAGTGAAGAAGAGGAAGAGGACTCTGATGACGAAGAAGACGAAACCGCTGA
ATTGTTACGTGAACTCGATAAAATAAAACGAGAACGAGCAGAAGACAAAGCAAGAAAAGAGCAAGAGCAATCAGA
TCAAGATGCAGCTACAAGAGAAGAACATATAGCTACAGCGAATCCATTATTGAATCTCGCTGCTGCGCTTGGTCA
AACGCCTGCTGGATTGAATACGACAGCGCCTGGAACTTTCTCTGTGAAGAAACGTTGGGATGATGGTCAGCTTTG
CTGTTTTTGAGTTTTCTTTTGACGTGGTTGAAGTTAATGCTGCGGATTATAGATCTTGTATTTAAGAATCAGTCG
ATGAATGACGGTGGAAAACCTCAACACTTTGTCAATGACCTACTTCGAACAGAGTTTCACAAGTATGTTGATACA
ATTCCATCCCTTATATATTGACTGACGGTGTCTTTGCAGAAAGTTCATGTCGAAATTTATAAAGGTCTGTCCCAC
TGTTTATAATCCCTTGACTTTGTCTGAGAATTCTCGTCTAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail