Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|048560
Gene name
Locationscaffold_02:2422050..2422997
Strand-
Gene length (bp)947
Transcript length (bp)774
Coding sequence length (bp)774
Protein length (aa) 258

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10153 Efg1 rRNA-processing protein Efg1 2.7E-38 48 160

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A8N5J5|EFG1P_COPC7 rRNA-processing protein EFG1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=EFG1 PE=3 SV=1 1 250 3.0E-68
sp|P0CN34|EFG1P_CRYNJ rRNA-processing protein EFG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EFG1 PE=3 SV=1 40 161 8.0E-31
sp|P0CN35|EFG1P_CRYNB rRNA-processing protein EFG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EFG1 PE=3 SV=1 40 161 8.0E-31
sp|A7EPT0|EFG1P_SCLS1 rRNA-processing protein efg1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=efg1 PE=3 SV=1 39 201 2.0E-23
sp|A5DID3|EFG1P_PICGU rRNA-processing protein EFG1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EFG1 PE=3 SV=2 44 247 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A8N5J5|EFG1P_COPC7 rRNA-processing protein EFG1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=EFG1 PE=3 SV=1 1 250 3.0E-68
sp|P0CN34|EFG1P_CRYNJ rRNA-processing protein EFG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=EFG1 PE=3 SV=1 40 161 8.0E-31
sp|P0CN35|EFG1P_CRYNB rRNA-processing protein EFG1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=EFG1 PE=3 SV=1 40 161 8.0E-31
sp|A7EPT0|EFG1P_SCLS1 rRNA-processing protein efg1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=efg1 PE=3 SV=1 39 201 2.0E-23
sp|A5DID3|EFG1P_PICGU rRNA-processing protein EFG1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=EFG1 PE=3 SV=2 44 247 1.0E-22
sp|A6RVU0|EFG1P_BOTFB rRNA-processing protein efg1 OS=Botryotinia fuckeliana (strain B05.10) GN=efg1 PE=3 SV=1 39 201 2.0E-22
sp|A3LNR4|EFG1P_PICST rRNA-processing protein EFG1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=EFG1 PE=3 SV=1 44 247 2.0E-22
sp|Q5AK42|EFG1P_CANAL rRNA-processing protein EFG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.11461 PE=3 SV=1 38 201 2.0E-22
sp|Q4PFU7|EFG1P_USTMA rRNA-processing protein EFG1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=EFG1 PE=3 SV=1 47 254 6.0E-22
sp|Q09867|EFG1P_SCHPO rRNA-processing protein efg1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=efg1 PE=3 SV=2 42 160 6.0E-22
sp|Q0U913|EFG1P_PHANO rRNA-processing protein EFG1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=EFG1 PE=3 SV=1 1 201 1.0E-21
sp|A5E2Z7|EFG1P_LODEL rRNA-processing protein EFG1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=EFG1 PE=3 SV=1 46 247 3.0E-21
sp|Q6CXA6|EFG1P_KLULA rRNA-processing protein EFG1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=EFG1 PE=3 SV=1 24 224 4.0E-21
sp|Q75D81|EFG1P_ASHGO rRNA-processing protein EFG1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=EFG1 PE=3 SV=2 44 225 5.0E-21
sp|Q1E0G9|EFG1P_COCIM rRNA-processing protein EFG1 OS=Coccidioides immitis (strain RS) GN=EFG1 PE=3 SV=1 42 201 1.0E-20
sp|Q6BH91|EFG1P_DEBHA rRNA-processing protein EFG1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=EFG1 PE=3 SV=1 44 161 3.0E-19
sp|A7TMK6|EFG1P_VANPO rRNA-processing protein EFG1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=EFG1 PE=3 SV=1 44 161 5.0E-19
sp|A6RBE9|EFG1P_AJECN rRNA-processing protein EFG1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=EFG1 PE=3 SV=1 43 170 7.0E-18
sp|Q3E705|EFG1P_YEAST rRNA-processing protein EFG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EFG1 PE=1 SV=2 44 247 8.0E-18
sp|A6ZUS8|EFG1P_YEAS7 rRNA-processing protein EFG1 OS=Saccharomyces cerevisiae (strain YJM789) GN=EFG1 PE=3 SV=1 44 247 8.0E-18
sp|Q6FTQ8|EFG1P_CANGA rRNA-processing protein EFG1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=EFG1 PE=3 SV=1 21 194 1.0E-16
sp|Q5B4J6|EFG1P_EMENI rRNA-processing protein efg1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=efg1 PE=3 SV=1 39 201 3.0E-16
sp|Q0C9M9|EFG1P_ASPTN rRNA-processing protein efg1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=efg1 PE=3 SV=1 39 201 7.0E-16
sp|Q7RYN6|EFG1P_NEUCR rRNA-processing protein efg1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=efg1 PE=3 SV=1 15 161 1.0E-15
sp|A2QNW5|EFG1P_ASPNC rRNA-processing protein efg1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=efg1 PE=3 SV=1 39 166 1.0E-14
sp|Q2UEF7|EFG1P_ASPOR rRNA-processing protein efg1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=efg1 PE=3 SV=1 39 201 4.0E-14
sp|Q4WI71|EFG1P_ASPFU rRNA-processing protein efg1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=efg1 PE=3 SV=1 39 201 4.0E-13
sp|Q6CFG6|EFG1P_YARLI rRNA-processing protein EFG1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EFG1 PE=3 SV=1 34 247 6.0E-13
sp|A1CF47|EFG1P_ASPCL rRNA-processing protein efg1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=efg1 PE=3 SV=1 43 160 2.0E-12
sp|Q2H6A9|EFG1P_CHAGB rRNA-processing protein EFG1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=EFG1 PE=3 SV=1 45 160 5.0E-12
sp|A4RMA9|EFG1P_MAGO7 rRNA-processing protein EFG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=EFG1 PE=3 SV=1 33 161 4.0E-11
sp|A1CYY6|EFG1P_NEOFI rRNA-processing protein efg1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=efg1 PE=3 SV=2 43 201 6.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0006364 rRNA processing Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034470 ncRNA processing No
GO:0090304 nucleic acid metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006396 RNA processing No
GO:0044238 primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016072 rRNA metabolic process No
GO:0009987 cellular process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|048560
MAPIRTHDSRPQTSNSAGKFKHKKAPRQQRNLRKELDTESAAPGVSKIKSSLRQTRRLLAKDKLAADVRVETERR
LKALEGELAQAEVANKERTMATRYHKIKFFERQKVTRKISQIQKQIASTEDDPTKEKLLRTLYERRVDLNYILHY
PKLKKYISLFPPEIRKGEQPSTASAKDAAETAQGREEVRSWVRSCMEKGELSGEPERYEASIKSKRKDFDSSNMS
SKTKPHRIQEESKKAIEEDDFFGNDDDDDKDS*
Coding >Agabi119p4|048560
ATGGCACCCATACGAACCCATGATTCCAGACCACAAACATCAAACTCTGCTGGAAAGTTTAAGCACAAAAAGGCG
CCTCGACAGCAACGAAATTTAAGGAAGGAGCTCGATACAGAGTCGGCTGCACCAGGCGTTTCCAAAATTAAGTCA
TCACTACGACAGACACGAAGGCTACTTGCAAAGGACAAACTTGCAGCTGATGTTCGAGTCGAGACGGAACGGCGG
CTGAAGGCACTCGAAGGAGAATTAGCACAAGCCGAGGTTGCAAATAAGGAACGGACGATGGCAACACGATATCAT
AAAATCAAGTTTTTTGAACGTCAAAAAGTGACACGAAAAATCTCTCAAATCCAAAAACAGATAGCTTCTACCGAA
GACGACCCGACGAAAGAGAAACTTTTGCGGACATTGTACGAACGTCGAGTGGACTTGAACTATATTCTTCATTAT
CCAAAACTCAAAAAATACATCTCCCTCTTCCCACCCGAGATTCGCAAGGGTGAACAGCCATCGACAGCGTCCGCG
AAGGATGCAGCGGAGACTGCGCAAGGACGAGAAGAAGTTCGTAGCTGGGTGAGATCATGCATGGAGAAAGGTGAA
CTATCGGGAGAACCGGAAAGATACGAAGCATCCATCAAATCAAAACGAAAAGATTTTGATAGTAGTAACATGTCA
AGCAAGACAAAACCTCATCGAATACAGGAAGAGTCGAAAAAGGCAATTGAGGAGGATGATTTCTTCGGTAACGAC
GATGACGACGACAAAGACTCATAG
Transcript >Agabi119p4|048560
ATGGCACCCATACGAACCCATGATTCCAGACCACAAACATCAAACTCTGCTGGAAAGTTTAAGCACAAAAAGGCG
CCTCGACAGCAACGAAATTTAAGGAAGGAGCTCGATACAGAGTCGGCTGCACCAGGCGTTTCCAAAATTAAGTCA
TCACTACGACAGACACGAAGGCTACTTGCAAAGGACAAACTTGCAGCTGATGTTCGAGTCGAGACGGAACGGCGG
CTGAAGGCACTCGAAGGAGAATTAGCACAAGCCGAGGTTGCAAATAAGGAACGGACGATGGCAACACGATATCAT
AAAATCAAGTTTTTTGAACGTCAAAAAGTGACACGAAAAATCTCTCAAATCCAAAAACAGATAGCTTCTACCGAA
GACGACCCGACGAAAGAGAAACTTTTGCGGACATTGTACGAACGTCGAGTGGACTTGAACTATATTCTTCATTAT
CCAAAACTCAAAAAATACATCTCCCTCTTCCCACCCGAGATTCGCAAGGGTGAACAGCCATCGACAGCGTCCGCG
AAGGATGCAGCGGAGACTGCGCAAGGACGAGAAGAAGTTCGTAGCTGGGTGAGATCATGCATGGAGAAAGGTGAA
CTATCGGGAGAACCGGAAAGATACGAAGCATCCATCAAATCAAAACGAAAAGATTTTGATAGTAGTAACATGTCA
AGCAAGACAAAACCTCATCGAATACAGGAAGAGTCGAAAAAGGCAATTGAGGAGGATGATTTCTTCGGTAACGAC
GATGACGACGACAAAGACTCATAG
Gene >Agabi119p4|048560
ATGGCACCCATACGAACCCATGATTCCAGACCACAAACATCAAACTCTGCTGGAAAGTTTAAGCACAAAAAGGCG
CCTCGACAGCAACGAAATTTAAGGAAGGAGCTCGATACAGAGTCGGCTGCACCAGGCGTTTCCAAAATTAAGTCA
TCACTACGACAGACACGAAGGCTACTTGCAAAGGTATATCTTCCATTTACTGCGTTACGTTTTTATCGTATGAAC
ATTGTGCCATTTGTAGGACAAACTTGCAGCTGATGTTCGAGTCGAGACGGAACGGCGGCTGAAGGCACTCGAAGG
AGAATTAGCACAAGCCGAGGTTGCAAATAAGGAACGGACGATGGCAACACGATATCATAAAATCAAGTTTTTTGG
TATGTGAAGTTCATGTTCTCGCAGTATTACTCAAAGCTAATAAATGCCTACTTAGAACGTCAAAAAGTGACACGA
AAAATCTCTCAAATCCAAAAACAGATAGCTTCTACCGAAGACGACCCGACGAAAGAGAAACTTTTGCGGACATTG
TACGAACGTCGAGTGGACTTGAACTATATTCTTGTGGGATCCATCTTATGTTCTGTAGGCATACTCGAAAGCTGA
CTTTTCATGTCGAATAGCATTATCCAAAACTCAAAAAATACATCTCCCTCTTCCCACCCGAGATTCGCAAGGGTG
AACAGCCATCGACAGCGTCCGCGAAGGATGCAGCGGAGACTGCGCAAGGACGAGAAGAAGTTCGTAGCTGGGTGA
GATCATGCATGGAGAAAGGTGAACTATCGGGAGAACCGGAAAGATACGAAGCATCCATCAAATCAAAACGAAAAG
ATTTTGATAGTAGTAACATGTCAAGCAAGACAAAACCTCATCGAATACAGGAAGAGTCGAAAAAGGCAATTGAGG
AGGATGATTTCTTCGGTAACGACGATGACGACGACAAAGACTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail