Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|048440
Gene name
Locationscaffold_02:2390282..2392589
Strand-
Gene length (bp)2307
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00732 GMC_oxred_N GMC oxidoreductase 2.2E-60 33 342
PF05199 GMC_oxred_C GMC oxidoreductase 6.3E-30 441 579

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3L1D1|PDH1_AGABI Pyranose dehydrogenase OS=Agaricus bisporus GN=pdh1 PE=1 SV=1 4 587 4.0E-114
sp|Q0R4L2|PDH3_LEUMG Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris GN=pdh3 PE=2 SV=1 7 587 1.0E-112
sp|V5NDL4|PDH1_AGACM Pyranose dehydrogenase OS=Agaricus campestris GN=pdh1 PE=1 SV=1 9 588 5.0E-111
sp|Q3L245|PDH1_LEUMG Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris GN=pdh1 PE=1 SV=1 12 588 2.0E-110
sp|V5NC32|PDH1_AGAXA Pyranose dehydrogenase OS=Agaricus xanthodermus GN=pdh1 PE=1 SV=1 12 588 3.0E-110
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3L1D1|PDH1_AGABI Pyranose dehydrogenase OS=Agaricus bisporus GN=pdh1 PE=1 SV=1 4 587 4.0E-114
sp|Q0R4L2|PDH3_LEUMG Pyranose dehydrogenase 3 OS=Leucoagaricus meleagris GN=pdh3 PE=2 SV=1 7 587 1.0E-112
sp|V5NDL4|PDH1_AGACM Pyranose dehydrogenase OS=Agaricus campestris GN=pdh1 PE=1 SV=1 9 588 5.0E-111
sp|Q3L245|PDH1_LEUMG Pyranose dehydrogenase 1 OS=Leucoagaricus meleagris GN=pdh1 PE=1 SV=1 12 588 2.0E-110
sp|V5NC32|PDH1_AGAXA Pyranose dehydrogenase OS=Agaricus xanthodermus GN=pdh1 PE=1 SV=1 12 588 3.0E-110
sp|Q3L243|PDH2_LEUMG Pyranose dehydrogenase 2 OS=Leucoagaricus meleagris GN=pdh2 PE=2 SV=1 12 588 2.0E-108
sp|P18173|DHGL_DROME Glucose dehydrogenase [FAD, quinone] OS=Drosophila melanogaster GN=Gld PE=3 SV=3 32 587 4.0E-62
sp|P18172|DHGL_DROPS Glucose dehydrogenase [FAD, quinone] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4 32 587 1.0E-61
sp|A7N2P9|BETA_VIBCB Oxygen-dependent choline dehydrogenase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=betA PE=3 SV=1 30 583 2.0E-60
sp|Q1QXE1|BETA1_CHRSD Oxygen-dependent choline dehydrogenase 1 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=betA1 PE=3 SV=1 29 584 3.0E-60
sp|Q00593|ALKJ_PSEOL Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans GN=alkJ PE=1 SV=1 33 583 6.0E-59
sp|Q9WWW2|ALKJ_PSEPU Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida GN=alkJ PE=3 SV=1 33 583 1.0E-58
sp|Q6LGH5|BETA_PHOPR Oxygen-dependent choline dehydrogenase OS=Photobacterium profundum GN=betA PE=3 SV=1 33 583 3.0E-58
sp|Q8D3K2|BETA_VIBVU Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=betA PE=3 SV=1 30 586 8.0E-58
sp|Q8BJ64|CHDH_MOUSE Choline dehydrogenase, mitochondrial OS=Mus musculus GN=Chdh PE=1 SV=1 24 584 1.0E-57
sp|Q7MF12|BETA_VIBVY Oxygen-dependent choline dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=betA PE=3 SV=1 30 586 8.0E-57
sp|Q12062|AFLK_ASPPA Versicolorin B synthase OS=Aspergillus parasiticus GN=vbs PE=1 SV=1 33 578 1.0E-56
sp|B7UJG4|BETA_ECO27 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=betA PE=3 SV=1 32 584 1.0E-56
sp|Q985M5|BETA_RHILO Oxygen-dependent choline dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=betA PE=3 SV=1 34 583 2.0E-56
sp|A8GBX9|BETA_SERP5 Oxygen-dependent choline dehydrogenase OS=Serratia proteamaculans (strain 568) GN=betA PE=3 SV=1 32 586 3.0E-56
sp|B6I074|BETA_ECOSE Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain SE11) GN=betA PE=3 SV=1 32 584 7.0E-56
sp|P17444|BETA_ECOLI Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain K12) GN=betA PE=1 SV=1 32 584 7.0E-56
sp|B1J0W6|BETA_ECOLC Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=betA PE=3 SV=1 32 584 7.0E-56
sp|A7ZWV4|BETA_ECOHS Oxygen-dependent choline dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=betA PE=3 SV=1 32 584 7.0E-56
sp|B1XE52|BETA_ECODH Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=betA PE=3 SV=1 32 584 7.0E-56
sp|B7M2V5|BETA_ECO8A Oxygen-dependent choline dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=betA PE=3 SV=1 32 584 7.0E-56
sp|B7L439|BETA_ECO55 Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=betA PE=3 SV=1 32 584 7.0E-56
sp|A7ZI50|BETA_ECO24 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=betA PE=3 SV=1 32 584 7.0E-56
sp|B5Z1R0|BETA_ECO5E Oxygen-dependent choline dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=betA PE=3 SV=1 32 584 7.0E-56
sp|Q8X6C6|BETA_ECO57 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O157:H7 GN=betA PE=3 SV=1 32 584 7.0E-56
sp|Q0TKW1|BETA_ECOL5 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=betA PE=3 SV=2 32 584 1.0E-55
sp|Q0T7N0|BETA_SHIF8 Oxygen-dependent choline dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=betA PE=3 SV=1 32 584 1.0E-55
sp|Q9L4K0|BETA2_CHRSD Oxygen-dependent choline dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=betA PE=3 SV=1 29 584 4.0E-55
sp|B7N8L3|BETA_ECOLU Oxygen-dependent choline dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=betA PE=3 SV=1 32 584 6.0E-55
sp|A7MFA8|BETA_CROS8 Oxygen-dependent choline dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=betA PE=3 SV=1 32 584 6.0E-55
sp|Q1RFM3|BETA_ECOUT Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=betA PE=3 SV=2 32 584 8.0E-55
sp|B7MCD0|BETA_ECO45 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=betA PE=3 SV=1 32 584 8.0E-55
sp|Q8FKI9|BETA_ECOL6 Oxygen-dependent choline dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=betA PE=3 SV=2 32 584 1.0E-54
sp|Q3JLL7|BETA_BURP1 Oxygen-dependent choline dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=betA PE=3 SV=1 28 584 2.0E-54
sp|A6T613|BETA_KLEP7 Oxygen-dependent choline dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=betA PE=3 SV=1 32 584 2.0E-54
sp|B5Y008|BETA_KLEP3 Oxygen-dependent choline dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=betA PE=3 SV=1 32 584 2.0E-54
sp|Q1IG70|BETA_PSEE4 Oxygen-dependent choline dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=betA PE=3 SV=1 32 584 3.0E-54
sp|Q6UPE0|CHDH_RAT Choline dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Chdh PE=1 SV=1 30 584 3.0E-54
sp|Q47944|SDH_GLUOY L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans PE=3 SV=1 31 584 5.0E-54
sp|C6DKY4|BETA_PECCP Oxygen-dependent choline dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=betA PE=3 SV=1 32 589 7.0E-54
sp|Q63KK7|BETA_BURPS Oxygen-dependent choline dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=betA PE=3 SV=1 28 586 1.0E-53
sp|B4EHJ2|BETA_BURCJ Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=betA PE=3 SV=1 28 584 1.0E-53
sp|Q8NE62|CHDH_HUMAN Choline dehydrogenase, mitochondrial OS=Homo sapiens GN=CHDH PE=1 SV=2 18 584 1.0E-53
sp|Q88CW6|BETA_PSEPK Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=betA PE=3 SV=1 32 584 3.0E-53
sp|Q62CH8|BETA_BURMA Oxygen-dependent choline dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=betA PE=3 SV=1 28 584 3.0E-53
sp|Q2T6D0|BETA_BURTA Oxygen-dependent choline dehydrogenase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=betA PE=3 SV=1 28 584 3.0E-53
sp|B0KN19|BETA_PSEPG Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=betA PE=3 SV=1 32 584 3.0E-53
sp|A4JJG6|BETA_BURVG Oxygen-dependent choline dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=betA PE=3 SV=1 28 584 3.0E-53
sp|Q4K4K7|BETA_PSEF5 Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=betA PE=3 SV=1 32 584 4.0E-53
sp|A5WA97|BETA_PSEP1 Oxygen-dependent choline dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=betA PE=3 SV=1 32 584 4.0E-53
sp|B9JBA2|BETA_AGRRK Oxygen-dependent choline dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=betA PE=3 SV=1 32 583 6.0E-53
sp|C3MIE4|BETA_RHISN Oxygen-dependent choline dehydrogenase OS=Rhizobium sp. (strain NGR234) GN=betA PE=3 SV=1 32 583 7.0E-53
sp|B4SHV9|BETA_STRM5 Oxygen-dependent choline dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) GN=betA PE=3 SV=1 31 584 7.0E-53
sp|Q6FDF9|BETA_ACIAD Oxygen-dependent choline dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=betA PE=3 SV=1 33 584 1.0E-52
sp|B1K707|BETA_BURCC Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) GN=betA PE=3 SV=1 28 584 1.0E-52
sp|Q9X2M2|BETA_STAXY Oxygen-dependent choline dehydrogenase OS=Staphylococcus xylosus GN=betA PE=3 SV=1 30 584 1.0E-52
sp|A0B2F7|BETA_BURCH Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) GN=betA PE=3 SV=1 28 584 1.0E-52
sp|Q1BQE2|BETA_BURCA Oxygen-dependent choline dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) GN=betA PE=3 SV=1 28 584 1.0E-52
sp|Q6D6D9|BETA_PECAS Oxygen-dependent choline dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=betA PE=3 SV=1 32 586 2.0E-52
sp|Q39A44|BETA_BURL3 Oxygen-dependent choline dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=betA PE=3 SV=1 28 584 2.0E-52
sp|B0V945|BETA_ACIBY Oxygen-dependent choline dehydrogenase OS=Acinetobacter baumannii (strain AYE) GN=betA PE=3 SV=1 32 584 4.0E-52
sp|B0VST3|BETA_ACIBS Oxygen-dependent choline dehydrogenase OS=Acinetobacter baumannii (strain SDF) GN=betA PE=3 SV=1 32 584 4.0E-52
sp|B2HV79|BETA_ACIBC Oxygen-dependent choline dehydrogenase OS=Acinetobacter baumannii (strain ACICU) GN=betA PE=3 SV=1 32 584 4.0E-52
sp|B7I895|BETA_ACIB5 Oxygen-dependent choline dehydrogenase OS=Acinetobacter baumannii (strain AB0057) GN=betA PE=3 SV=1 32 584 4.0E-52
sp|B7GYG5|BETA_ACIB3 Oxygen-dependent choline dehydrogenase OS=Acinetobacter baumannii (strain AB307-0294) GN=betA PE=3 SV=1 32 584 4.0E-52
sp|B2FQ89|BETA_STRMK Oxygen-dependent choline dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=betA PE=3 SV=1 31 584 4.0E-52
sp|Q3K5H3|BETA_PSEPF Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=betA PE=3 SV=1 32 584 5.0E-52
sp|B1LIJ7|BETA_ECOSM Oxygen-dependent choline dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=betA PE=3 SV=1 32 584 5.0E-52
sp|Q4A0Q1|BETA_STAS1 Oxygen-dependent choline dehydrogenase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=betA PE=3 SV=1 30 584 6.0E-52
sp|A9AMZ9|BETA_BURM1 Oxygen-dependent choline dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=betA PE=3 SV=1 28 584 6.0E-52
sp|A6U6Y8|BETA_SINMW Oxygen-dependent choline dehydrogenase OS=Sinorhizobium medicae (strain WSM419) GN=betA PE=3 SV=1 32 583 2.0E-51
sp|B3PTE0|BETA_RHIE6 Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=betA PE=3 SV=1 32 583 3.0E-51
sp|Q2KB43|BETA_RHIEC Oxygen-dependent choline dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=betA PE=3 SV=1 32 583 4.0E-51
sp|C3K3D3|BETA_PSEFS Oxygen-dependent choline dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=betA PE=3 SV=1 32 584 4.0E-51
sp|Q0B711|BETA_BURCM Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=betA PE=3 SV=1 28 584 4.0E-51
sp|A4XPI5|BETA_PSEMY Oxygen-dependent choline dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=betA PE=3 SV=1 32 584 4.0E-51
sp|B1Z034|BETA_BURA4 Oxygen-dependent choline dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) GN=betA PE=3 SV=1 28 584 5.0E-51
sp|P64264|Y1310_MYCBO Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1310 PE=3 SV=1 31 584 1.0E-50
sp|P9WMV5|Y1279_MYCTU Uncharacterized GMC-type oxidoreductase Rv1279 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1279 PE=1 SV=1 31 584 1.0E-50
sp|P9WMV4|Y1279_MYCTO Uncharacterized GMC-type oxidoreductase MT1316 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1316 PE=3 SV=1 31 584 1.0E-50
sp|A6X2G7|BETA_OCHA4 Oxygen-dependent choline dehydrogenase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=betA PE=3 SV=1 34 583 1.0E-50
sp|Q1MJU4|BETA_RHIL3 Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=betA PE=3 SV=1 32 583 5.0E-50
sp|Q88AE7|BETA_PSESM Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=betA PE=3 SV=1 30 584 7.0E-50
sp|B5ZUG2|BETA_RHILW Oxygen-dependent choline dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=betA PE=3 SV=1 32 583 1.0E-49
sp|Q8PPG8|BETA_XANAC Oxygen-dependent choline dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=betA PE=3 SV=1 30 584 2.0E-49
sp|Q1CFR7|BETA_YERPN Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=betA PE=3 SV=1 32 584 2.0E-49
sp|Q8ZGW0|BETA_YERPE Oxygen-dependent choline dehydrogenase OS=Yersinia pestis GN=betA PE=3 SV=1 32 584 2.0E-49
sp|Q1C932|BETA_YERPA Oxygen-dependent choline dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=betA PE=3 SV=1 32 584 2.0E-49
sp|B1JSR0|BETA_YERPY Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=betA PE=3 SV=1 32 584 2.0E-49
sp|A7FKL6|BETA_YERP3 Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=betA PE=3 SV=1 32 584 2.0E-49
sp|A6VEI3|BETA_PSEA7 Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=betA PE=3 SV=1 32 584 3.0E-49
sp|Q8G1Z8|BETA_BRUSU Oxygen-dependent choline dehydrogenase OS=Brucella suis biovar 1 (strain 1330) GN=betA PE=3 SV=1 34 583 3.0E-49
sp|A8AJN0|BETA_CITK8 Oxygen-dependent choline dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=betA PE=3 SV=1 32 584 3.0E-49
sp|B2JS89|BETA_BURP8 Oxygen-dependent choline dehydrogenase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=betA PE=3 SV=1 28 584 4.0E-49
sp|P54223|BETA_RHIME Oxygen-dependent choline dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=betA PE=3 SV=2 32 583 4.0E-49
sp|Q9HTJ2|BETA_PSEAE Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=betA PE=3 SV=1 32 584 4.0E-49
sp|B7V5R3|BETA_PSEA8 Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=betA PE=3 SV=1 32 584 4.0E-49
sp|Q4ZM63|BETA_PSEU2 Oxygen-dependent choline dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=betA PE=3 SV=1 30 584 5.0E-49
sp|Q13NG7|BETA_BURXL Oxygen-dependent choline dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=betA PE=3 SV=1 28 584 6.0E-49
sp|Q02DZ0|BETA_PSEAB Oxygen-dependent choline dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=betA PE=3 SV=1 32 584 6.0E-49
sp|B2TCJ8|BETA_BURPP Oxygen-dependent choline dehydrogenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=betA PE=3 SV=1 28 583 8.0E-49
sp|Q8P5D7|BETA_XANCP Oxygen-dependent choline dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=betA PE=3 SV=1 30 584 8.0E-49
sp|B0RNU9|BETA_XANCB Oxygen-dependent choline dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=betA PE=3 SV=1 30 584 8.0E-49
sp|Q4UYN5|BETA_XANC8 Oxygen-dependent choline dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=betA PE=3 SV=1 30 584 8.0E-49
sp|Q48CM7|BETA_PSE14 Oxygen-dependent choline dehydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=betA PE=3 SV=1 30 584 1.0E-48
sp|Q3BXK8|BETA_XANC5 Oxygen-dependent choline dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=betA PE=3 SV=1 30 584 1.0E-48
sp|A9M9H8|BETA_BRUC2 Oxygen-dependent choline dehydrogenase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=betA PE=3 SV=1 34 583 1.0E-48
sp|B4EX94|BETA_PROMH Oxygen-dependent choline dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=betA PE=3 SV=1 33 584 1.0E-48
sp|B0CKN4|BETA_BRUSI Oxygen-dependent choline dehydrogenase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=betA PE=3 SV=1 34 583 1.0E-48
sp|A5VPA6|BETA_BRUO2 Oxygen-dependent choline dehydrogenase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=betA PE=3 SV=1 34 583 1.0E-48
sp|Q66D54|BETA_YERPS Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=betA PE=3 SV=1 32 584 2.0E-48
sp|B2K8U4|BETA_YERPB Oxygen-dependent choline dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=betA PE=3 SV=1 32 584 2.0E-48
sp|A4TNP2|BETA_YERPP Oxygen-dependent choline dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=betA PE=3 SV=1 32 584 3.0E-48
sp|Q8YFY2|BETA_BRUME Oxygen-dependent choline dehydrogenase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=betA PE=3 SV=2 34 583 6.0E-48
sp|Q7X2H8|CHOX_ARTGO Choline oxidase OS=Arthrobacter globiformis GN=codA PE=1 SV=1 23 584 3.0E-47
sp|Q4L9D7|BETA_STAHJ Oxygen-dependent choline dehydrogenase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=betA PE=3 SV=1 29 584 3.0E-47
sp|Q8UH55|BETA_AGRFC Oxygen-dependent choline dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=betA PE=3 SV=2 32 583 3.0E-46
sp|Q8CMY2|BETA_STAES Oxygen-dependent choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=betA PE=3 SV=1 29 584 2.0E-45
sp|Q5HL11|BETA_STAEQ Oxygen-dependent choline dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=betA PE=3 SV=1 29 584 2.0E-45
sp|Q9AJD6|PNO_MICLT Pyridoxine 4-oxidase OS=Microbacterium luteolum GN=pno PE=1 SV=3 31 577 1.0E-44
sp|E4QP00|HMFO_METS6 5-(hydroxymethyl)furfural oxidase OS=Methylovorus sp. (strain MP688) GN=MPQ_0130 PE=1 SV=1 33 583 1.0E-42
sp|P04841|ALOX_PICAN Alcohol oxidase OS=Pichia angusta GN=MOX PE=1 SV=1 32 586 9.0E-40
sp|Q8NUM0|BETA_STAAW Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=betA PE=3 SV=1 33 584 1.0E-39
sp|Q6G664|BETA_STAAS Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=betA PE=3 SV=1 33 584 1.0E-39
sp|A8Z5A4|BETA_STAAT Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=betA PE=3 SV=1 33 584 4.0E-39
sp|Q6GDJ1|BETA_STAAR Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=betA PE=3 SV=1 33 584 4.0E-39
sp|P60337|BETA_STAAN Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain N315) GN=betA PE=1 SV=1 33 584 4.0E-39
sp|P60336|BETA_STAAM Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=betA PE=3 SV=1 33 584 4.0E-39
sp|A6QK99|BETA_STAAE Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain Newman) GN=betA PE=3 SV=1 33 584 4.0E-39
sp|Q5HCU1|BETA_STAAC Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain COL) GN=betA PE=3 SV=1 33 584 4.0E-39
sp|Q2YWJ5|BETA_STAAB Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=betA PE=3 SV=1 33 584 4.0E-39
sp|A5IW37|BETA_STAA9 Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain JH9) GN=betA PE=3 SV=1 33 584 4.0E-39
sp|Q2FV11|BETA_STAA8 Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=betA PE=3 SV=1 33 584 4.0E-39
sp|Q2FDP9|BETA_STAA3 Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=betA PE=3 SV=1 33 584 4.0E-39
sp|A6U4Z2|BETA_STAA2 Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain JH1) GN=betA PE=3 SV=1 33 584 4.0E-39
sp|A7X6Z3|BETA_STAA1 Oxygen-dependent choline dehydrogenase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=betA PE=3 SV=1 33 584 4.0E-39
sp|P46371|YTH2_RHOER Uncharacterized GMC-type oxidoreductase in thcA 5'region OS=Rhodococcus erythropolis PE=3 SV=1 29 583 3.0E-33
sp|Q00922|ALOX_CANBO Alcohol oxidase OS=Candida boidinii GN=AOD1 PE=1 SV=1 32 507 4.0E-33
sp|P04842|ALOX1_PICPG Alcohol oxidase 1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=AOX1 PE=1 SV=2 32 583 7.0E-32
sp|F2QY27|ALOX1_PICP7 Alcohol oxidase 1 OS=Komagataella pastoris (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) GN=AOX1 PE=1 SV=1 32 583 7.0E-32
sp|C4R702|ALOX2_PICPG Alcohol oxidase 2 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=AOX2 PE=3 SV=1 32 583 1.0E-31
sp|F2R038|ALOX2_PICP7 Alcohol oxidase 2 OS=Komagataella pastoris (strain ATCC 76273 / CBS 7435 / CECT 11047 / NRRL Y-11430 / Wegner 21-1) GN=AOX2 PE=2 SV=1 32 583 1.0E-31
sp|P13006|GOX_ASPNG Glucose oxidase OS=Aspergillus niger GN=gox PE=1 SV=1 34 587 2.0E-27
sp|P81156|GOX_PENAG Glucose oxidase OS=Penicillium amagasakiense PE=1 SV=1 26 587 9.0E-24
sp|Q5UPK7|YL128_MIMIV Putative GMC-type oxidoreductase L128 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L128 PE=3 SV=1 34 583 1.0E-22
sp|Q92452|GOX_TALFL Glucose oxidase OS=Talaromyces flavus GN=GOX PE=3 SV=1 26 587 1.0E-22
sp|Q9VGP2|NINAG_DROME Neither inactivation nor afterpotential protein G OS=Drosophila melanogaster GN=ninaG PE=2 SV=2 33 583 1.0E-20
sp|Q5UQH9|YR832_MIMIV Putative truncated GMC-type inactive oxidoreductase R832 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R832 PE=3 SV=1 34 360 1.0E-12
sp|Q9S746|HTH_ARATH Protein HOTHEAD OS=Arabidopsis thaliana GN=HTH PE=1 SV=1 295 577 6.0E-12
sp|O82784|MDL4_PRUSE (R)-mandelonitrile lyase 4 OS=Prunus serotina GN=MDL4 PE=2 SV=1 254 561 2.0E-11
sp|Q01738|CDH_PHACH Cellobiose dehydrogenase OS=Phanerochaete chrysosporium GN=CDH-1 PE=1 SV=1 28 583 1.0E-10
sp|O24243|MDL1_PRUDU (R)-mandelonitrile lyase 1 OS=Prunus dulcis GN=MDL1 PE=2 SV=1 295 561 1.0E-10
sp|Q5UPL2|YR135_MIMIV Putative GMC-type oxidoreductase R135 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R135 PE=1 SV=1 34 341 6.0E-09
sp|Q5UQZ1|YL894_MIMIV Putative truncated GMC-type inactive oxidoreductase L894 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L894 PE=1 SV=1 29 341 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0097159 organic cyclic compound binding No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003824 catalytic activity No
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0036094 small molecule binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|048440
MASFLWILLFSVGFRIAGAKIYDSLSELEKSQFDFIICGGGNAGLVLANRLSENPAVQVLVIEAGGRTQDDPDTQ
IPFLDINLLADRAKYQWNTTTTPQKGLLGKTINYPRGFGLGGSTAHNGMIWIKGSVDDYDNWAKVTGDDGWSYNA
LEPYMKKVERFTNPTEKGPDFVNGKFNPQAHGFQGPLGISIIGNEDRIDDLVVEVLKSKEFNMSVVDGNDKSSLG
IWWIQSSVSGGTRSSSATSYLDPIDCRPNLSVVINTQVTRVIQTKKGDFRTVEVAGGPKEPRQTFTACKEVILSA
GVVGSAQLLLLSGIGHKQELAAVGVKLTHESPNVGKGLSNQPQTLFSWEGNFTMNSLIANQTFFDESLARWNKNH
TGPMNTVPANLVSAFRLPENSTLLKGIEDPSAGPRTPHYYMGLATTEYFNSGSQPTIGAVLQVSEPISRGSVTLN
SNDPFDQPNVDLAFLVEDLDTQILLQAYRTAKAQIEHPLMKGFALDRLSPPPEVQIDDDIIIYMRNNTIATSHAV
GTAAMSRNGSHDGVVGPDLKVKGINGLRVVDASVFPVNLQMNNQAAVYHLAERASDLIKHEWHL*
Coding >Agabi119p4|048440
ATGGCTTCCTTCCTATGGATCTTGCTCTTCAGTGTCGGTTTTCGAATCGCAGGAGCGAAGATTTACGATAGTTTG
TCGGAACTCGAAAAGTCCCAGTTCGATTTCATCATTTGTGGCGGCGGAAACGCTGGCCTTGTTTTAGCGAATAGG
CTATCGGAAAATCCCGCAGTTCAAGTTCTCGTCATTGAAGCTGGCGGACGTACCCAAGACGACCCGGACACACAA
ATTCCTTTCCTTGACATCAATCTCTTGGCAGATAGGGCGAAGTACCAATGGAACACTACCACCACACCTCAAAAA
GGGTTGCTTGGCAAGACAATCAATTATCCTCGAGGATTTGGACTTGGAGGTTCCACTGCGCATAATGGCATGATT
TGGATTAAGGGCTCAGTGGACGATTATGACAATTGGGCCAAGGTCACAGGTGACGATGGTTGGTCGTATAATGCT
CTGGAACCATATATGAAAAAGGTTGAAAGATTCACCAATCCCACCGAGAAAGGCCCAGATTTTGTTAACGGCAAA
TTCAATCCTCAAGCTCATGGATTTCAAGGTCCCCTTGGGATTAGCATAATTGGCAATGAAGATCGGATTGATGAC
TTGGTCGTGGAAGTGTTGAAATCTAAGGAGTTTAACATGTCAGTAGTGGACGGAAATGATAAAAGTTCACTCGGC
ATTTGGTGGATACAATCGTCCGTATCTGGTGGAACACGTTCAAGCTCGGCAACCTCATACCTCGACCCCATCGAT
TGCCGCCCAAACCTAAGCGTCGTAATCAATACACAAGTTACTAGGGTCATTCAAACGAAGAAAGGCGATTTTAGA
ACGGTTGAGGTCGCTGGAGGTCCCAAAGAGCCACGTCAAACATTTACGGCATGCAAAGAGGTTATCCTTTCGGCA
GGTGTTGTAGGGTCTGCACAACTACTACTTCTTTCAGGCATAGGGCACAAACAAGAACTCGCCGCTGTCGGCGTC
AAGTTAACACATGAGTCACCCAATGTTGGTAAAGGACTAAGTAACCAGCCTCAGACGCTCTTTTCTTGGGAGGGA
AATTTCACAATGAACAGCCTCATCGCCAACCAGACTTTCTTCGATGAATCGCTGGCACGATGGAACAAAAATCAT
ACAGGGCCGATGAATACTGTTCCAGCCAACCTTGTGTCTGCTTTCAGACTTCCAGAAAACTCAACCTTGCTCAAG
GGTATCGAAGATCCTTCTGCGGGACCCAGGACCCCTCATTACTACATGGGTCTTGCCACCACTGAATATTTCAAT
TCCGGATCTCAACCTACGATTGGCGCTGTTCTTCAAGTTTCGGAACCCATAAGCCGCGGTTCTGTTACCCTCAAC
TCGAATGACCCTTTTGATCAGCCAAACGTGGATCTCGCCTTCCTTGTGGAAGATTTGGATACACAAATCCTACTC
CAGGCTTACAGGACAGCGAAAGCACAAATCGAGCATCCACTCATGAAAGGGTTTGCGCTAGACCGACTGAGCCCA
CCTCCTGAAGTCCAAATCGATGACGATATTATAATCTACATGCGAAACAACACTATAGCGACGTCCCACGCCGTT
GGAACCGCTGCCATGAGTCGAAATGGAAGTCACGATGGTGTCGTAGGTCCAGATCTCAAAGTAAAAGGGATCAAT
GGCCTCCGTGTTGTTGATGCGTCGGTCTTTCCCGTCAACCTGCAAATGAATAACCAGGCAGCAGTATACCATTTA
GCCGAACGAGCGTCAGATTTGATTAAACATGAATGGCATTTATAA
Transcript >Agabi119p4|048440
ATGGCTTCCTTCCTATGGATCTTGCTCTTCAGTGTCGGTTTTCGAATCGCAGGAGCGAAGATTTACGATAGTTTG
TCGGAACTCGAAAAGTCCCAGTTCGATTTCATCATTTGTGGCGGCGGAAACGCTGGCCTTGTTTTAGCGAATAGG
CTATCGGAAAATCCCGCAGTTCAAGTTCTCGTCATTGAAGCTGGCGGACGTACCCAAGACGACCCGGACACACAA
ATTCCTTTCCTTGACATCAATCTCTTGGCAGATAGGGCGAAGTACCAATGGAACACTACCACCACACCTCAAAAA
GGGTTGCTTGGCAAGACAATCAATTATCCTCGAGGATTTGGACTTGGAGGTTCCACTGCGCATAATGGCATGATT
TGGATTAAGGGCTCAGTGGACGATTATGACAATTGGGCCAAGGTCACAGGTGACGATGGTTGGTCGTATAATGCT
CTGGAACCATATATGAAAAAGGTTGAAAGATTCACCAATCCCACCGAGAAAGGCCCAGATTTTGTTAACGGCAAA
TTCAATCCTCAAGCTCATGGATTTCAAGGTCCCCTTGGGATTAGCATAATTGGCAATGAAGATCGGATTGATGAC
TTGGTCGTGGAAGTGTTGAAATCTAAGGAGTTTAACATGTCAGTAGTGGACGGAAATGATAAAAGTTCACTCGGC
ATTTGGTGGATACAATCGTCCGTATCTGGTGGAACACGTTCAAGCTCGGCAACCTCATACCTCGACCCCATCGAT
TGCCGCCCAAACCTAAGCGTCGTAATCAATACACAAGTTACTAGGGTCATTCAAACGAAGAAAGGCGATTTTAGA
ACGGTTGAGGTCGCTGGAGGTCCCAAAGAGCCACGTCAAACATTTACGGCATGCAAAGAGGTTATCCTTTCGGCA
GGTGTTGTAGGGTCTGCACAACTACTACTTCTTTCAGGCATAGGGCACAAACAAGAACTCGCCGCTGTCGGCGTC
AAGTTAACACATGAGTCACCCAATGTTGGTAAAGGACTAAGTAACCAGCCTCAGACGCTCTTTTCTTGGGAGGGA
AATTTCACAATGAACAGCCTCATCGCCAACCAGACTTTCTTCGATGAATCGCTGGCACGATGGAACAAAAATCAT
ACAGGGCCGATGAATACTGTTCCAGCCAACCTTGTGTCTGCTTTCAGACTTCCAGAAAACTCAACCTTGCTCAAG
GGTATCGAAGATCCTTCTGCGGGACCCAGGACCCCTCATTACTACATGGGTCTTGCCACCACTGAATATTTCAAT
TCCGGATCTCAACCTACGATTGGCGCTGTTCTTCAAGTTTCGGAACCCATAAGCCGCGGTTCTGTTACCCTCAAC
TCGAATGACCCTTTTGATCAGCCAAACGTGGATCTCGCCTTCCTTGTGGAAGATTTGGATACACAAATCCTACTC
CAGGCTTACAGGACAGCGAAAGCACAAATCGAGCATCCACTCATGAAAGGGTTTGCGCTAGACCGACTGAGCCCA
CCTCCTGAAGTCCAAATCGATGACGATATTATAATCTACATGCGAAACAACACTATAGCGACGTCCCACGCCGTT
GGAACCGCTGCCATGAGTCGAAATGGAAGTCACGATGGTGTCGTAGGTCCAGATCTCAAAGTAAAAGGGATCAAT
GGCCTCCGTGTTGTTGATGCGTCGGTCTTTCCCGTCAACCTGCAAATGAATAACCAGGCAGCAGTATACCATTTA
GCCGAACGAGCGTCAGATTTGATTAAACATGAATGGCATTTATAA
Gene >Agabi119p4|048440
ATGGCTTCCTTCCTATGGATCTTGCTCTTCAGTGTCGGTTTTCGAATCGCAGGAGCGAAGATTTACGATAGTTTG
TCGGAACTCGAAAAGTCCCAGTTCGATTTCATCATTTGTGGCGGTAAGCTATCTGAAACAGTTCCTGCAGATTTA
GCTCTGATAAACAGCTTTTAAGGCGGAAACGCTGGCCTTGTTTTAGCGAATAGGCTATCGGAAAATCCCGCAGTT
CAAGTTCTCGTCATTGAAGCTGGCGGACGGTGTGTTGCTGTTTGACATAGCTTCTGGAACCAAGGTTGAAACTTA
ATTCCACAGTACCCAAGACGACCCGGACACACAAATTCCTTTCCTTGACATCAATCTCTTGGCAGATAGGGCGAA
GTACCAATGGAACACTACCACCACACCTCAAAAAGGGTTGCTTGGCAAGACAATCAATTATCCTCGAGGATTTGG
ACTTGGAGGTTCCACTGCGCATAGTGAGTAGTGACTAGTTCCGAGATAACTTAAGAAGGAATTAAGAGTTCTTCT
AGATGGCATGATTTGGATTAAGGGCTCAGTGGACGATTATGACAATTGGGCCAAGGTCACAGGTGACGATGGTTG
GTCGTATAATGCTCTGGAACCATATATGAAAAAGGTCGGTCTAAGTAATGCCTTCCGCCCGTTTGTTTCGTCTGA
TAGTCATGAAGGTTGAAAGATTCACCAATCCCACCGAGAAAGGCCCAGATTTTGTTAACGGCAAATTCAATCCTC
AAGCTCATGGATTTCAAGGTCCCCTTGGGATTAGCATAATTGGCAATGAAGATCGGATTGATGACTTGGTCGTGG
AAGTGTTGAAATCTAAGGAGTTTAACATGTCAGTAGTGGACGGAAATGATAAAAGTTCACTCGGCATTTGTAAGT
CTTCTCTCTTGCAAATATTGACTGATATAAATCAGTGACCATTACATCGATTAGGGTGGATACAATCGTCCGTAT
CTGGTGGAACACGTTCAAGCTCGGCAACCTCATACCTCGACCCCATCGATTGCCGCCCAAACCTAAGCGTCGTAA
TCAATACACAAGTTACTAGGGTCATTCAAACGAAGAAAGGCGATTTTAGAACGGTTGAGGTCGCTGGAGGTCCCA
AAGGTCCCTCTCTTCTCTAAACATGTTTTTTCGTTTATCTTCAACCCTTTGTCACAGAGCCACGTCAAACATTTA
CGGCATGCAAAGAGGTTATCCTTTCGGCAGGTGTTGTAGGGTCTGCACAACTACTACTTCTTTCAGGCATAGGGC
ACAAACAAGAACTCGCCGCTGTCGGCGTCAAGTTAACACATGAGTCACCCAATGTTGGTAAAGGACTAAGTAACC
AGCCTCAGACGCTCTTTTCTTGGGAGGGAAATTTCACAATGAACAGGTAGGTTTACGTTCGCTGAAGTTAATAGA
AACCCAGTATAAATCTTCCTAGCCTCATCGCCAACCAGACTTTCTTCGATGAATCGCTGGCACGATGGAACAAAA
ATCATACAGGGCCGATGAATACTGTTCCAGCCAACCTTGTGTCTGCTTTCAGACTTCCAGAAAACTCAACCTTGC
TCAAGGGTATCGAAGATCCTTCTGCGGGACCCAGGACCCCTCATTACTACATGGGTCTTGCCGTGAGTTTGTGGT
ACTTTTCTTTCAGATTGTTCTTATAGTCGTATTTGAAGACCACTGAATATTTCAATTCCGGATCTCAACCTACGA
TTGGCGCTGTTCTTCAAGTTTCGGAACCCATAAGCCGTATGTGTAGTTTTTATGGTTCCAGGCATCTCATTCCGA
ATTGCTTTAGGCGGTTCTGTTACCCTCAACTCGAATGACCCTTTTGATCAGCCAAACGTGGATCTCGCCTTCCTT
GTGGAAGATTTGGATACACAAATCCTACTCCAGGCTTACAGGACAGCGAAAGCACAAATCGAGCATCCACTCATG
AAAGGGTTTGCGCTAGACCGACTGAGCCCACCTCCTGAAGTCCAAATCGATGACGATATTATAATCTACATGCGA
AACAACACTATAGCGACGTCCCACGCCGTTGGAACCGCTGCCATGAGTCGAAATGGAAGTCACGATGGTGTCGTA
GGTCCAGATCTCAAAGTAAAAGGGATCAATGGCCTCCGTGTTGTTGATGCGTCGGTCTTTGTGAGTTTTATGTTA
TCCGAACGCATGTCTTGTACTGTTGTTGACAATCATTGGCAGCCCGTCAACCTGCAAATGAATAACCAGGCAGCA
GTATACCATTTAGCCGAACGAGCGTCAGATTTGATTAAACATGAATGGCATTTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail