Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|048290
Gene name
Locationscaffold_02:2350809..2353638
Strand-
Gene length (bp)2829
Transcript length (bp)2283
Coding sequence length (bp)2283
Protein length (aa) 761

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02366 PMT Dolichyl-phosphate-mannose-protein mannosyltransferase 7.8E-81 93 335
PF16192 PMT_4TMC C-terminal four TMM region of protein-O-mannosyltransferase 2.2E-18 572 639
PF16192 PMT_4TMC C-terminal four TMM region of protein-O-mannosyltransferase 8.2E-28 640 754
PF02815 MIR MIR domain 4.7E-25 382 548

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ADM9|PMT2_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT2 PE=1 SV=1 75 756 0.0E+00
sp|P47190|PMT3_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT3 PE=1 SV=2 89 760 0.0E+00
sp|Q9C100|PMT2_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm2 PE=3 SV=1 31 758 0.0E+00
sp|Q5A688|PMT6_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT6 PE=2 SV=1 14 756 0.0E+00
sp|P31382|PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT2 PE=1 SV=2 74 756 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ADM9|PMT2_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT2 PE=1 SV=1 75 756 0.0E+00
sp|P47190|PMT3_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT3 PE=1 SV=2 89 760 0.0E+00
sp|Q9C100|PMT2_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm2 PE=3 SV=1 31 758 0.0E+00
sp|Q5A688|PMT6_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT6 PE=2 SV=1 14 756 0.0E+00
sp|P31382|PMT2_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT2 PE=1 SV=2 74 756 0.0E+00
sp|P42934|PMT6_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT6 PE=1 SV=1 89 756 9.0E-175
sp|Q9UKY4|POMT2_HUMAN Protein O-mannosyl-transferase 2 OS=Homo sapiens GN=POMT2 PE=1 SV=2 53 755 4.0E-142
sp|Q29IL2|POMT2_DROPS Protein O-mannosyl-transferase 2 OS=Drosophila pseudoobscura pseudoobscura GN=tw PE=3 SV=1 96 755 5.0E-142
sp|Q8BGQ4|POMT2_MOUSE Protein O-mannosyl-transferase 2 OS=Mus musculus GN=Pomt2 PE=1 SV=1 54 755 4.0E-138
sp|Q9W5D4|POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster GN=tw PE=2 SV=1 96 636 3.0E-125
sp|O74189|PMT1_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT1 PE=2 SV=1 96 728 2.0E-107
sp|Q59X23|PMT4_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT4 PE=2 SV=1 100 737 4.0E-97
sp|P33775|PMT1_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT1 PE=1 SV=1 32 735 6.0E-97
sp|Q2LZ62|POMT1_DROPS Protein O-mannosyltransferase 1 OS=Drosophila pseudoobscura pseudoobscura GN=rt PE=3 SV=2 96 755 2.0E-94
sp|Q99PR0|POMT1_RAT Protein O-mannosyl-transferase 1 OS=Rattus norvegicus GN=Pomt1 PE=2 SV=1 92 700 6.0E-94
sp|Q9VTK2|POMT1_DROME Protein O-mannosyltransferase 1 OS=Drosophila melanogaster GN=rt PE=2 SV=2 96 755 1.0E-93
sp|Q8R2R1|POMT1_MOUSE Protein O-mannosyl-transferase 1 OS=Mus musculus GN=Pomt1 PE=1 SV=1 112 700 2.0E-92
sp|Q9Y6A1|POMT1_HUMAN Protein O-mannosyl-transferase 1 OS=Homo sapiens GN=POMT1 PE=1 SV=3 88 756 1.0E-91
sp|P52867|PMT5_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT5 PE=1 SV=1 96 757 2.0E-82
sp|Q5ACU3|PMT5_CANAL Dolichyl-phosphate-mannose--protein mannosyltransferase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMT5 PE=2 SV=1 62 756 2.0E-78
sp|O42933|PMT4_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm4 PE=3 SV=1 89 754 3.0E-78
sp|P46971|PMT4_YEAST Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT4 PE=1 SV=1 62 686 1.0E-76
sp|O13898|PMT1_SCHPO Dolichyl-phosphate-mannose--protein mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ogm1 PE=1 SV=1 83 695 1.0E-68
sp|Q06644|PMT7_YEAST Probable dolichyl-phosphate-mannose--protein mannosyltransferase 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMT7 PE=1 SV=1 252 537 1.0E-15
sp|Q93ZE8|SDF2_ARATH Stromal cell-derived factor 2-like protein OS=Arabidopsis thaliana GN=SDF2 PE=1 SV=1 383 545 9.0E-11
sp|Q54P23|SDF2_DICDI Stromal cell-derived factor 2-like protein OS=Dictyostelium discoideum GN=DDB_G0284847 PE=3 SV=1 406 554 2.0E-10
sp|Q9W5D4|POMT2_DROME Protein O-mannosyl-transferase 2 OS=Drosophila melanogaster GN=tw PE=2 SV=1 661 755 9.0E-10
sp|Q3T083|SDF2L_BOVIN Stromal cell-derived factor 2-like protein 1 OS=Bos taurus GN=SDF2L1 PE=2 SV=1 383 481 7.0E-09
sp|Q8NRZ6|PMT_CORGL Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pmt PE=3 SV=1 70 332 1.0E-08
sp|Q9HCN8|SDF2L_HUMAN Stromal cell-derived factor 2-like protein 1 OS=Homo sapiens GN=SDF2L1 PE=1 SV=2 383 481 4.0E-08
sp|Q3SZ45|SDF2_BOVIN Stromal cell-derived factor 2 OS=Bos taurus GN=SDF2 PE=2 SV=1 383 481 4.0E-08
sp|Q9ESP1|SDF2L_MOUSE Stromal cell-derived factor 2-like protein 1 OS=Mus musculus GN=Sdf2l1 PE=1 SV=2 383 481 6.0E-08
sp|Q99470|SDF2_HUMAN Stromal cell-derived factor 2 OS=Homo sapiens GN=SDF2 PE=1 SV=2 383 481 1.0E-07
sp|Q9DCT5|SDF2_MOUSE Stromal cell-derived factor 2 OS=Mus musculus GN=Sdf2 PE=1 SV=1 359 481 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0000030 mannosyltransferase activity Yes
GO:0006493 protein O-linked glycosylation Yes
GO:0016020 membrane Yes
GO:0043413 macromolecule glycosylation No
GO:1901564 organonitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006486 protein glycosylation No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:0008150 biological_process No
GO:0070085 glycosylation No
GO:0016757 glycosyltransferase activity No
GO:0043412 macromolecule modification No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0043170 macromolecule metabolic process No
GO:0016758 hexosyltransferase activity No
GO:0036211 protein modification process No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 135 157 22
2 172 194 22
3 214 236 22
4 256 278 22
5 313 335 22
6 653 675 22
7 682 704 22
8 714 736 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|048290
MRPAAVALDFEPSDSDYDHDLPLYRHDPPYSMSDEKVRLNEDYDDEGKDVYAKVNRNARPYIASGRMPQPPPPPA
TSISEFLFQNLEHLAPIIYTLLSCWTRFHNIGASNLVVWDEAHFGKFASHYLKREFYFDVHPPLGKMIVGFVGLL
AGYNGGFDFESGKVYPPEVPYVAMRVMLATFGVAMVPLGWYTAVELGMSSWACHLTALMVLCDVAWLTISRFILL
DSMLLFFTFLTVFCLTKFHNQQYQSFSIDWWLWLTFTGISIGCVTSVKLVGLFVTALVGAYTIEDLWEKFGDTRL
TIREQVNHWAARVVCLIVVPILVFMASFKLHFLVLAHSGPGDAQMSSLFQANLVGNDFAKNPLSVAFGSKVTLKN
MGWGGGLLHSHIQTYPTGSNQQQVTCYHYKDNNNEWVILPPWNEAEYDPNAELRFVKDGDLVRLNHPATTRNLHS
HTVLAPISKLNYEVSGYGNETVGDVHDIWRVEVVDDIHRGKLVPGKDDDIHSLTTRLRFKHNQLGCYLRAANAVL
PQWGFKQIEVSCDKENNAKDAHTYWNVESHWNDRLPAGDMKLYKSPFLRDFWHLNVAMMTSNNALVPDPDKADIL
ASKPFDWPLLHLGLRMCGWGDAQLKYYLIGTPTIWWGGTRKYQDMDVREWEHFMYVGKVAFLGWAFHFVPFLIMG
RVTYIHHYLPTLYFSVLMLAHVLDHFVFTTPRLSHKNKSIAFGICAFVIVATFWWFRGVSFGIGGPINDHWGLRW
RKTWNIYEGI*
Coding >Agabi119p4|048290
ATGAGGCCCGCCGCAGTTGCCCTGGATTTTGAACCTTCAGACTCAGACTACGACCACGACCTTCCTCTTTACCGC
CACGACCCTCCGTACTCCATGTCGGACGAAAAGGTGCGGCTCAACGAGGACTATGACGACGAGGGCAAGGACGTC
TACGCCAAGGTGAACAGAAACGCTAGGCCATACATCGCCAGTGGCCGTATGCCCCAGCCCCCTCCACCGCCTGCA
ACCTCCATTAGCGAGTTTCTTTTCCAAAATCTCGAACACCTCGCCCCCATCATCTACACCCTCTTGTCCTGCTGG
ACTCGTTTTCACAACATCGGTGCCTCCAACCTTGTCGTCTGGGACGAAGCACACTTTGGAAAATTCGCCTCCCAT
TACCTCAAACGCGAGTTTTATTTCGATGTTCACCCACCCTTGGGTAAAATGATCGTCGGATTCGTCGGACTACTG
GCGGGGTACAATGGAGGATTTGACTTTGAGAGTGGAAAGGTCTATCCACCAGAAGTACCGTATGTCGCTATGAGA
GTTATGTTGGCTACCTTTGGTGTCGCCATGGTTCCACTCGGGTGGTATACCGCTGTTGAACTCGGAATGAGCTCG
TGGGCATGCCATTTGACTGCACTCATGGTGCTTTGTGATGTTGCTTGGTTGACTATCTCTCGTTTCATCCTTCTC
GATTCCATGCTCCTTTTCTTCACGTTCCTTACCGTCTTCTGCTTGACAAAATTCCATAACCAACAATATCAATCA
TTTTCTATTGACTGGTGGCTATGGCTCACCTTCACCGGCATATCTATCGGTTGTGTCACAAGTGTAAAATTGGTT
GGCCTGTTTGTTACAGCCCTCGTCGGTGCTTATACGATTGAAGACCTCTGGGAAAAATTCGGCGACACAAGGCTT
ACTATTCGCGAGCAAGTTAACCATTGGGCCGCTCGTGTCGTCTGTCTCATCGTCGTCCCCATCCTCGTCTTCATG
GCCTCATTCAAACTCCACTTCCTTGTCCTCGCCCACTCCGGTCCTGGCGATGCTCAAATGTCCTCTCTCTTCCAA
GCCAACCTTGTTGGTAACGACTTTGCTAAAAACCCGCTCTCCGTTGCTTTTGGTTCGAAAGTCACTTTAAAAAAC
ATGGGTTGGGGTGGTGGATTGTTACATTCACATATCCAAACCTATCCTACGGGTTCAAATCAACAACAAGTCACT
TGTTATCACTATAAAGACAACAACAATGAATGGGTCATTCTGCCGCCTTGGAACGAAGCCGAATATGATCCAAAC
GCTGAACTTCGATTCGTGAAGGATGGAGATCTAGTACGATTAAACCATCCCGCGACCACAAGGAACTTGCACTCT
CACACCGTCCTCGCACCCATCTCAAAGCTAAATTACGAAGTCTCTGGTTACGGGAATGAAACTGTCGGTGATGTT
CATGACATTTGGCGCGTGGAGGTTGTGGACGATATACATAGAGGCAAATTGGTTCCTGGCAAAGATGATGACATA
CATTCGTTGACAACGAGATTAAGGTTCAAGCATAATCAACTAGGGTGTTATCTGAGGGCTGCAAACGCGGTGTTA
CCGCAGTGGGGTTTCAAACAGATTGAAGTCAGTTGTGATAAGGAGAACAATGCGAAGGATGCGCATACGTATTGG
AACGTTGAGAGTCATTGGAACGACCGACTGCCCGCTGGTGATATGAAACTCTACAAGTCACCCTTCCTCCGTGAT
TTCTGGCATTTGAACGTTGCTATGATGACTTCCAACAATGCTCTCGTTCCCGATCCAGACAAAGCAGATATACTC
GCATCCAAACCTTTCGATTGGCCACTCCTACACCTCGGATTACGGATGTGTGGGTGGGGTGACGCGCAACTGAAA
TATTACTTGATTGGTACGCCCACCATTTGGTGGGGAGGTACGAGAAAGTATCAAGACATGGATGTTAGAGAGTGG
GAACATTTCATGTATGTCGGGAAGGTTGCTTTCTTGGGATGGGCGTTCCACTTTGTGCCTTTCTTGATTATGGGA
CGTGTCACATATATCCATCACTATCTTCCGACATTGTATTTTTCTGTTCTAATGCTTGCCCATGTCCTCGACCAT
TTCGTATTCACCACTCCTCGCCTCTCACATAAAAACAAGTCCATCGCCTTTGGTATCTGCGCATTCGTAATCGTA
GCAACCTTCTGGTGGTTCAGAGGTGTTTCATTTGGTATTGGAGGTCCAATTAATGACCATTGGGGATTGAGATGG
CGAAAAACTTGGAATATATATGAAGGGATATAA
Transcript >Agabi119p4|048290
ATGAGGCCCGCCGCAGTTGCCCTGGATTTTGAACCTTCAGACTCAGACTACGACCACGACCTTCCTCTTTACCGC
CACGACCCTCCGTACTCCATGTCGGACGAAAAGGTGCGGCTCAACGAGGACTATGACGACGAGGGCAAGGACGTC
TACGCCAAGGTGAACAGAAACGCTAGGCCATACATCGCCAGTGGCCGTATGCCCCAGCCCCCTCCACCGCCTGCA
ACCTCCATTAGCGAGTTTCTTTTCCAAAATCTCGAACACCTCGCCCCCATCATCTACACCCTCTTGTCCTGCTGG
ACTCGTTTTCACAACATCGGTGCCTCCAACCTTGTCGTCTGGGACGAAGCACACTTTGGAAAATTCGCCTCCCAT
TACCTCAAACGCGAGTTTTATTTCGATGTTCACCCACCCTTGGGTAAAATGATCGTCGGATTCGTCGGACTACTG
GCGGGGTACAATGGAGGATTTGACTTTGAGAGTGGAAAGGTCTATCCACCAGAAGTACCGTATGTCGCTATGAGA
GTTATGTTGGCTACCTTTGGTGTCGCCATGGTTCCACTCGGGTGGTATACCGCTGTTGAACTCGGAATGAGCTCG
TGGGCATGCCATTTGACTGCACTCATGGTGCTTTGTGATGTTGCTTGGTTGACTATCTCTCGTTTCATCCTTCTC
GATTCCATGCTCCTTTTCTTCACGTTCCTTACCGTCTTCTGCTTGACAAAATTCCATAACCAACAATATCAATCA
TTTTCTATTGACTGGTGGCTATGGCTCACCTTCACCGGCATATCTATCGGTTGTGTCACAAGTGTAAAATTGGTT
GGCCTGTTTGTTACAGCCCTCGTCGGTGCTTATACGATTGAAGACCTCTGGGAAAAATTCGGCGACACAAGGCTT
ACTATTCGCGAGCAAGTTAACCATTGGGCCGCTCGTGTCGTCTGTCTCATCGTCGTCCCCATCCTCGTCTTCATG
GCCTCATTCAAACTCCACTTCCTTGTCCTCGCCCACTCCGGTCCTGGCGATGCTCAAATGTCCTCTCTCTTCCAA
GCCAACCTTGTTGGTAACGACTTTGCTAAAAACCCGCTCTCCGTTGCTTTTGGTTCGAAAGTCACTTTAAAAAAC
ATGGGTTGGGGTGGTGGATTGTTACATTCACATATCCAAACCTATCCTACGGGTTCAAATCAACAACAAGTCACT
TGTTATCACTATAAAGACAACAACAATGAATGGGTCATTCTGCCGCCTTGGAACGAAGCCGAATATGATCCAAAC
GCTGAACTTCGATTCGTGAAGGATGGAGATCTAGTACGATTAAACCATCCCGCGACCACAAGGAACTTGCACTCT
CACACCGTCCTCGCACCCATCTCAAAGCTAAATTACGAAGTCTCTGGTTACGGGAATGAAACTGTCGGTGATGTT
CATGACATTTGGCGCGTGGAGGTTGTGGACGATATACATAGAGGCAAATTGGTTCCTGGCAAAGATGATGACATA
CATTCGTTGACAACGAGATTAAGGTTCAAGCATAATCAACTAGGGTGTTATCTGAGGGCTGCAAACGCGGTGTTA
CCGCAGTGGGGTTTCAAACAGATTGAAGTCAGTTGTGATAAGGAGAACAATGCGAAGGATGCGCATACGTATTGG
AACGTTGAGAGTCATTGGAACGACCGACTGCCCGCTGGTGATATGAAACTCTACAAGTCACCCTTCCTCCGTGAT
TTCTGGCATTTGAACGTTGCTATGATGACTTCCAACAATGCTCTCGTTCCCGATCCAGACAAAGCAGATATACTC
GCATCCAAACCTTTCGATTGGCCACTCCTACACCTCGGATTACGGATGTGTGGGTGGGGTGACGCGCAACTGAAA
TATTACTTGATTGGTACGCCCACCATTTGGTGGGGAGGTACGAGAAAGTATCAAGACATGGATGTTAGAGAGTGG
GAACATTTCATGTATGTCGGGAAGGTTGCTTTCTTGGGATGGGCGTTCCACTTTGTGCCTTTCTTGATTATGGGA
CGTGTCACATATATCCATCACTATCTTCCGACATTGTATTTTTCTGTTCTAATGCTTGCCCATGTCCTCGACCAT
TTCGTATTCACCACTCCTCGCCTCTCACATAAAAACAAGTCCATCGCCTTTGGTATCTGCGCATTCGTAATCGTA
GCAACCTTCTGGTGGTTCAGAGGTGTTTCATTTGGTATTGGAGGTCCAATTAATGACCATTGGGGATTGAGATGG
CGAAAAACTTGGAATATATATGAAGGGATATAA
Gene >Agabi119p4|048290
ATGAGGCCCGCCGCAGTTGCCCTGGATTTTGAACCTTCAGACTCAGACTACGACCACGACCTTCCTCTTTACCGC
CACGACCCTCCGTACTCCATGTCGGACGAAAAGGTGCGGCTCAACGAGGACTATGACGACGAGGGCAAGGACGTC
TACGCCAAGGTGAACAGAAACGCTAGGCCATACATCGCCAGTGGCCGTATGCCCCAGCCCCCTCCACCGCCTGCA
ACCTCCATTGTAGGTCTCTCCAGCTGCTGCCCTGCTTCTGATTAACATCTTTCTCCTCCAGAGCGAGTTTCTTTT
CCAAAATCTCGAACACCTCGCCCCCATCATCTACACCCTCTTGTCCTGCTGGACTCGTTTTCACAACATCGGTGC
CTCCAACCTTGTCGTCTGGGACGAAGCACACTTTGGAAAATTCGCCTCCCATTACCTCAAACGCGAGTTTTATTT
CGATGTTCACCCACCCTTGGGTAAAATGATCGTCGGATTCGTCGGACTACTGGCGGGGTACAATGGAGGATTTGA
CTTTGAGAGTGGAAAGGTCTATCCACCAGAAGTACCGTATGTCGCTATGAGAGTTATGTTGGCTACCTTTGGTGT
CGCCATGGTTCCACTCGGGTGGTATACCGCTGTTGAACTCGGAATGAGCTCGTGGGCATGCCATTTGACTGCACT
CATGGTGCTTTGTGGTACGTTTCATCCCCAGATGCTGTCGTAGTCTCCGAACTTATGTTGACTTCCAGATGTTGC
TTGGTTGACTATCTCTCGTTTCATCCTTCTCGATTCCATGCTCCTTTTCTTCACGTTCCTTACCGTCTTCTGCTT
GACAAAATTCCATAACCAACAATATCAGTGAGTTTTGACATATTCCCTTCAGCCTCAAGTTCTCATACTCGAGTA
GATCATTTTCTATTGACTGGTGGCTATGGCTCACCTTCACCGGCATATCTATCGGTTGTGTCACAAGGTGCGCTA
GACCAGTGGTTGTTTACCACCTAATGATGCTAACGACGTAACATCCTTGCTAGTGTAAAATTGGTTGGCCTGTTT
GTTACAGCCCTCGTCGGTGCTTATACGATTGAAGACCTCTGGGAAAAATTCGGCGACACAAGGCTTACTATTGTA
CGTGTTTTCTCTCTTTCCCTTCATGACAATCCTTTAATAACCCATTGTCCAAAGCGCGAGCAAGTTAACCATTGG
GCCGCTCGTGTCGTCTGTCTCATCGTCGTCCCCATCCTCGTCTTCATGGCCTCATTCAAACTCCACTTCCTTGTC
CTCGCCCACTCCGGTCCTGGCGATGCTCAAATGTCCTCTCTCTTCCAAGCCAACCTTGTTGGTAACGACTTTGCT
AAAAACCCGCTCTCCGTTGCTTTTGGTTCGAAAGTCACTTTAAAAAACATGGGTTGGGGTGGTGGATTGTTACAT
TCACATATCCAAACCTATCCTACGGGTTCAAATCAACAACAAGTCACTTGTTATCACTATAAAGACAACAACAAT
GAATGGGTCATTCTGCCGCCTTGGAACGAAGCCGAATATGATCCAAACGCTGAACTTCGATTCGTGAAGGATGGA
GATCTAGTACGATTAAACCATCCCGCGACCACAAGGAACTTGCACTCTCACACCGTCCTCGCACCCATCTCAAAG
CTAAATTACGAAGTCTCTGGTTACGGGAATGAAACTGTCGGTGATGTTCATGACATTTGGCGCGTGGAGGTTGTG
GACGATATACATAGAGGCAAATTGGTTCCTGGCAAAGATGATGACATACATTCGTTGACAACGAGATTAAGGTTC
AAGCATAATCAACTAGGGTGTTATCTGAGGGCTGCAAACGCGGTGTTACCGCAGTGGGGTTTCAAACAGATTGAA
GTCAGTTGTGATAAGGAGAACAATGCGAAGGATGCGCATACGTATTGGAACGTTGAGAGTCATTGGAACGACCGA
CGTAAATTATCCTTCCCTTCTTTGACTCTCGTTTGACTAATTTGTCTCGGTTCCAGTGCCCGCTGGTGATATGAA
ACTCTACAAGTCACCCTTCCTCCGTGATTTCTGGCATTTGAACGTTGCTATGATGACTTCCAACAATGCTCTCGT
TCCCGATCCAGACAAAGCAGATATACTCGCATCCAAACCTTTCGATTGGCCACTCCTACACCTCGGATTACGGAT
GTGTGGGTGGGGTGACGCGCAACTGAAATATTACTTGATTGGTACGCCCACCATTTGGTGGGGAGGTACGGTGAG
TTTAATCGCCGGGTTGGCAACTTGGGGAGTGTATGTGTTGCGGTGGCAGAGAAAGTATCAAGACATGGATGTTAG
AGAGTGGGAACATTTCATGTATGTCGGGAAGGTTGCTTTCTTGGGATGGGCGTTCCACTTTGGTGAGGTTTCTTT
TACTTGGTGGTATGTAGATTGTTATTGACGGCGGCTACTCACAGTGCCTTTCTTGATTATGGGACGTGTCACATA
TATCCATCACTATGTATGTTTTCTCCCTTGTATTCATGATGGCGATTTGCATTCTAATAATTCATACAGCTTCCG
ACATTGTATTTTTCTGTTCTAATGCTTGCCCATGTCCTCGACCATTTCGTATTCACCACTCCTCGCCTCTCACAT
AAAAACAAGTCCATCGCCTTTGGTATCTGCGCATTCGTAATCGTAGCAACCTTCTGGTGGTTCAGAGGTGTTTCA
TTTGGTATTGGAGGTCCAATTAATGACCATTGGGGATTGAGATGGCGAAAAGTGCGTACAGCTTTTTTTATTCCT
TGTTTCCTTCCTCATTATTCTTTGTAGACTTGGAATATATATGAAGGGATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail