Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|047990
Gene name
Locationscaffold_02:2272651..2278007
Strand+
Gene length (bp)5356
Transcript length (bp)4836
Coding sequence length (bp)4836
Protein length (aa) 1612

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02854 MIF4G MIF4G domain 7.6E-58 1048 1305
PF12152 eIF_4G1 Eukaryotic translation initiation factor 4G1 9.8E-18 815 870

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10475|IF4G_SCHPO Eukaryotic translation initiation factor 4 gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif471 PE=1 SV=1 1021 1366 5.0E-99
sp|O43432|IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens GN=EIF4G3 PE=1 SV=2 848 1424 3.0E-59
sp|Q80XI3|IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus GN=Eif4g3 PE=1 SV=2 848 1424 9.0E-59
sp|P39936|IF4F2_YEAST Eukaryotic initiation factor 4F subunit p130 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF4632 PE=1 SV=1 1019 1354 2.0E-57
sp|P39935|IF4F1_YEAST Eukaryotic initiation factor 4F subunit p150 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF4631 PE=1 SV=2 1019 1368 4.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10475|IF4G_SCHPO Eukaryotic translation initiation factor 4 gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif471 PE=1 SV=1 1021 1366 5.0E-99
sp|O43432|IF4G3_HUMAN Eukaryotic translation initiation factor 4 gamma 3 OS=Homo sapiens GN=EIF4G3 PE=1 SV=2 848 1424 3.0E-59
sp|Q80XI3|IF4G3_MOUSE Eukaryotic translation initiation factor 4 gamma 3 OS=Mus musculus GN=Eif4g3 PE=1 SV=2 848 1424 9.0E-59
sp|P39936|IF4F2_YEAST Eukaryotic initiation factor 4F subunit p130 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF4632 PE=1 SV=1 1019 1354 2.0E-57
sp|P39935|IF4F1_YEAST Eukaryotic initiation factor 4F subunit p150 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TIF4631 PE=1 SV=2 1019 1368 4.0E-54
sp|Q6NZJ6|IF4G1_MOUSE Eukaryotic translation initiation factor 4 gamma 1 OS=Mus musculus GN=Eif4g1 PE=1 SV=1 850 1399 6.0E-53
sp|Q04637|IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens GN=EIF4G1 PE=1 SV=4 850 1399 1.0E-52
sp|G5CEW6|IF4G_WHEAT Eukaryotic translation initiation factor 4G OS=Triticum aestivum PE=1 SV=1 1020 1332 2.0E-52
sp|B9FXV5|IF4G_ORYSJ Eukaryotic translation initiation factor 4G OS=Oryza sativa subsp. japonica GN=Os07g0555200 PE=2 SV=2 844 1351 3.0E-51
sp|Q76E23|IF4G_ARATH Eukaryotic translation initiation factor 4G OS=Arabidopsis thaliana GN=EIF4G PE=1 SV=2 841 1382 1.0E-46
sp|P41110|IF4G1_RABIT Eukaryotic translation initiation factor 4 gamma 1 OS=Oryctolagus cuniculus GN=EIF4G1 PE=1 SV=1 1032 1426 2.0E-40
sp|Q93ZT6|IF4G1_ARATH Eukaryotic translation initiation factor isoform 4G-1 OS=Arabidopsis thaliana GN=EIF(ISO)4G1 PE=1 SV=1 1046 1583 3.0E-36
sp|Q84PB3|IF4G1_ORYSJ Eukaryotic translation initiation factor isoform 4G-1 OS=Oryza sativa subsp. japonica GN=Os04g0499300 PE=2 SV=2 996 1327 2.0E-35
sp|Q03387|IF4G1_WHEAT Eukaryotic translation initiation factor isoform 4G-1 OS=Triticum aestivum PE=1 SV=2 1046 1367 5.0E-35
sp|Q6K641|IF4G2_ORYSJ Eukaryotic translation initiation factor isoform 4G-2 OS=Oryza sativa subsp. japonica GN=Os02g0611500 PE=2 SV=1 1044 1325 1.0E-34
sp|Q41583|IF4G2_WHEAT Eukaryotic translation initiation factor isoform 4G-2 OS=Triticum aestivum PE=2 SV=1 1046 1367 2.0E-33
sp|Q553R3|IF4G_DICDI Eukaryotic translation initiation factor 4 gamma OS=Dictyostelium discoideum GN=eif4g PE=3 SV=1 1026 1309 2.0E-33
sp|O82233|IF4G2_ARATH Eukaryotic translation initiation factor isoform 4G-2 OS=Arabidopsis thaliana GN=EIF(ISO)4G2 PE=1 SV=1 1046 1327 2.0E-32
sp|Q95L46|IF4G2_BOVIN Eukaryotic translation initiation factor 4 gamma 2 OS=Bos taurus GN=EIF4G2 PE=2 SV=2 1044 1328 1.0E-31
sp|P78344|IF4G2_HUMAN Eukaryotic translation initiation factor 4 gamma 2 OS=Homo sapiens GN=EIF4G2 PE=1 SV=1 1044 1328 1.0E-31
sp|P79398|IF4G2_RABIT Eukaryotic translation initiation factor 4 gamma 2 OS=Oryctolagus cuniculus GN=EIF4G2 PE=2 SV=1 1044 1328 1.0E-31
sp|Q62448|IF4G2_MOUSE Eukaryotic translation initiation factor 4 gamma 2 OS=Mus musculus GN=Eif4g2 PE=1 SV=2 1044 1328 1.0E-31
sp|Q5R7J9|IF4G2_PONAB Eukaryotic translation initiation factor 4 gamma 2 OS=Pongo abelii GN=EIF4G2 PE=2 SV=2 1044 1328 1.0E-31
sp|C7G046|Y6969_DICDI von Willebrand factor A domain-containing protein DDB_G0286969 OS=Dictyostelium discoideum GN=DDB_G0286969 PE=3 SV=1 1038 1316 2.0E-17
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 576 723 3.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 612 762 4.0E-11
sp|Q8IDX6|RBP2A_PLAF7 Reticulocyte-binding protein 2 homolog a OS=Plasmodium falciparum (isolate 3D7) GN=PF13_0198 PE=3 SV=1 634 786 1.0E-10
sp|Q61884|MNS1_MOUSE Meiosis-specific nuclear structural protein 1 OS=Mus musculus GN=Mns1 PE=1 SV=1 576 806 4.0E-09
sp|Q6AXQ8|MNS1_RAT Meiosis-specific nuclear structural protein 1 OS=Rattus norvegicus GN=Mns1 PE=2 SV=1 576 806 1.0E-07
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 598 805 3.0E-07
sp|Q8NEH6|MNS1_HUMAN Meiosis-specific nuclear structural protein 1 OS=Homo sapiens GN=MNS1 PE=2 SV=2 582 802 4.0E-07
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 597 757 5.0E-07
sp|F1QBY1|NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio GN=nipblb PE=2 SV=1 576 780 8.0E-07
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 623 759 2.0E-06
sp|Q4PBP6|NST1_USTMA Stress response protein NST1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NST1 PE=3 SV=2 572 731 2.0E-06
sp|Q4R7T8|MNS1_MACFA Meiosis-specific nuclear structural protein 1 OS=Macaca fascicularis GN=MNS1 PE=2 SV=2 572 802 2.0E-06
sp|Q6AXQ8|MNS1_RAT Meiosis-specific nuclear structural protein 1 OS=Rattus norvegicus GN=Mns1 PE=2 SV=1 572 766 2.0E-06
sp|Q1MTN9|RLF2_SCHPO Chromatin assembly factor 1 subunit rlf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rlf2 PE=3 SV=2 638 735 4.0E-06
sp|Q8IID4|DYHC2_PLAF7 Dynein heavy chain-like protein PF11_0240 OS=Plasmodium falciparum (isolate 3D7) GN=PF11_0240 PE=3 SV=1 573 747 7.0E-06
sp|Q15149|PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 570 843 8.0E-06
sp|Q75CK5|NST1_ASHGO Stress response protein NST1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NST1 PE=3 SV=2 623 750 9.0E-06
sp|A2R7P5|NST1_ASPNC Stress response protein nst1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=nst1 PE=3 SV=1 634 735 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|047990
MKRLHVASYLVSGLGGLLASVEAPALEELTLEITRDSPAFGHGALPREAVEDLLGRSGGRGRLERLAVIGLIHAS
PAAFTPAGRSFLTTASTKKNNTPPASSVPHSMSRPSTAQQARNPSVARPSAWSKGPPTSAPSRSQSPAPSTPTFH
SHSRRPSALSGVSIKDGVTVNKNNAGAAKQGSAVTFGSIDDVSAPISSSPAAAPAIKSESVKSFGTIDADTHVNG
KSTLSARPSVAVPASSTSSSASSPAVSVASAALKLGKPDIAKLFQNPSSAPSSHPPSDTSSPSLRPTGLPSSQHP
PSSQPSQSSVPSQPSQLSSHPSFTPYRHPPSGAGSGPSRSPAYPPPRQSVNGSGPRTQGGPNGAPSQINPGMPSP
RLAPMPHNGQPAGMPPPPQMQVGQQVPVAWPGYYYPSPDTYGYPPHQAWYQPQHHLPSGPHGPPHTGMPISPRNP
PIPLQPGSGTPTLSHAAANPVHSPHPPPPLAHPSASMGSISSPPPTPSTNTSRLNANSSAFAPRPKVTFKTAEGL
EVALGDLSSKTSASPSPANNAPANGQGTFRQGSPANGNPNRRGVRMETEDQQRRRLAEEERAKAEAEDKVRKEKE
AEARKKREQEELKRKEEEATKKKEEEAKKKKEEEEKERIRKEEEEKERVRKEEEERVRKEVEEKERLRKEEEERE
RVRLEEAENEKKRKEEEEKQRIRKEEEERQREEEERKRKEEEEEERERLRKEEEEKERQRQEAEKASRAKELEEE
AEASQSREEGELDALEEHDIVSSPKSDFDKKFKEPLRINTSEAQRRRPDPLDLSNAGPVSAAPRSAIAAARVIDD
LSRVSYPEGIASPQPDLNTNAKDGKFRYDRDFLMQFMAICKEKPDMLPPLDAIGLEPIDQANLTMQRGGSGRHRQ
SSGPSAVQRGNSIGLGFASAPGFSKSSGLNPFAAGGMGNFTTTGKLTSDERFQNSSRSASVSGMGGFGGRPVAMQ
RTSSQGGPGGVASNRTRSQRGKQREKMPVQQTSNVHGSQLSNFEPVAPLKVSENRWDRKALHVEGDSPEVVDRKV
RGLLNKLTMERFDSISDQIIEWANKSEKEKDGRTLIQVIRLVFEKATDEATWSEMYARLCRKMMEQISTKVQDDG
IRNNEGKPIAGGQLFRKYLLNRCQEDFERGWVTKEATAAAAATKAMEDQAIKAAHGKGEEGGEDEVALYSEEYYA
AQKAKRQGLGLIKFIGELFKLQMLTERIMHECVKKLLGNVNNPEEEEIESLCKLLSTVGQSLDTPKAHGHMDVYF
KRMRELAESTNVSSRMQFMLQDLLEFRQRKWVARNAVAAPTTIAQIHEAAAKEKAAQEKELSQRQISMSRGGSRR
GGDRNEQPPANPEGWAVAGNTARPPSKVDLSNFGKINKAPPTTFGPGSVFAGKKDKRESLSRSNSSANMFSMLQN
AESGADKAAEALPQRKKLALLPRTKPIENETETEAQQQESDEEQVQSPTAEMNDEAALKKIDEDSKELFGVRNLS
EAEVYFSSLPSQHHHKLVEKLVSTAVESKEADARLVSDLFGIAASKSSCSPAAFEEGFAPVAEIIVDLAIDAPKA
FDLFAIIVKGASLDEDRRSRLASKSEDSEKLLLLLS*
Coding >Agabi119p4|047990
ATGAAGCGGCTGCATGTTGCGTCCTACCTCGTGTCGGGCCTCGGCGGGCTGCTCGCGAGCGTCGAGGCGCCCGCA
CTCGAGGAGCTCACCCTCGAGATCACTCGCGACAGCCCGGCATTCGGGCACGGGGCGCTGCCGAGAGAGGCCGTA
GAGGATCTGCTGGGGAGGTCGGGGGGCCGGGGCCGGCTAGAGCGGCTGGCGGTGATCGGACTTATTCACGCCTCT
CCAGCTGCTTTTACGCCTGCTGGCAGGTCATTTTTGACGACCGCATCCACAAAAAAAAACAACACCCCCCCCGCC
TCATCCGTGCCACATTCAATGAGCAGACCTTCCACTGCACAACAAGCCAGGAATCCCTCAGTTGCAAGACCGTCA
GCCTGGTCAAAAGGTCCCCCGACCTCTGCGCCCTCTCGCTCCCAGTCGCCCGCCCCATCCACCCCCACCTTTCAC
TCCCACTCGCGCCGCCCAAGTGCCCTCTCAGGTGTCTCCATTAAGGATGGCGTCACCGTCAACAAAAACAACGCC
GGCGCCGCAAAACAAGGTTCTGCCGTCACATTTGGTTCGATAGACGACGTCTCCGCCCCCATTTCTTCTTCGCCC
GCTGCCGCCCCCGCTATCAAGTCAGAGAGCGTCAAATCCTTCGGCACAATAGATGCAGACACACATGTGAATGGT
AAATCCACTCTTTCCGCGAGACCGTCTGTGGCGGTCCCAGCTTCCAGCACCAGCTCGTCTGCCTCTTCTCCTGCC
GTCTCAGTGGCGTCCGCTGCCCTCAAGCTTGGCAAACCAGACATCGCCAAGCTTTTCCAAAATCCCTCATCGGCC
CCTTCATCCCATCCCCCATCAGACACATCCTCCCCTTCCTTACGTCCCACTGGCTTACCCTCATCACAACATCCC
CCATCCTCACAGCCCTCCCAGTCTTCGGTACCCTCACAGCCCTCCCAACTATCTTCTCACCCTTCCTTCACCCCG
TATCGCCATCCACCATCAGGTGCTGGCTCAGGTCCTTCCCGCTCTCCTGCCTACCCTCCTCCGCGCCAGTCTGTC
AACGGCTCTGGCCCTCGCACACAAGGTGGTCCTAATGGTGCTCCCTCGCAGATTAACCCCGGGATGCCTAGCCCT
CGGCTAGCTCCCATGCCACATAATGGCCAACCTGCAGGTATGCCTCCCCCGCCTCAGATGCAAGTGGGTCAACAA
GTGCCCGTCGCATGGCCCGGTTACTATTATCCGAGTCCCGATACGTATGGCTATCCCCCTCATCAAGCCTGGTAC
CAACCTCAACATCACCTTCCCAGCGGTCCGCACGGGCCACCTCACACTGGAATGCCCATATCTCCCCGAAATCCT
CCCATACCCCTTCAACCCGGATCCGGTACTCCAACACTGTCCCATGCCGCCGCCAATCCCGTCCATTCCCCACAT
CCTCCCCCTCCTCTTGCCCATCCGTCGGCAAGTATGGGCTCTATATCCTCACCCCCTCCCACCCCTTCTACAAAT
ACCTCCCGGTTAAATGCCAATTCCTCTGCCTTTGCTCCAAGACCAAAAGTCACTTTCAAAACGGCGGAAGGTTTG
GAGGTTGCCCTCGGTGACTTGTCTTCTAAAACCAGTGCCAGTCCGTCGCCCGCAAATAATGCGCCGGCGAACGGG
CAAGGGACATTTAGACAAGGCAGTCCTGCGAATGGGAATCCCAACCGCCGAGGCGTGAGAATGGAGACTGAAGAT
CAACAAAGAAGACGATTAGCGGAGGAAGAGAGAGCCAAGGCTGAAGCCGAGGACAAGGTCAGAAAAGAGAAAGAG
GCGGAAGCGCGTAAGAAGCGGGAACAAGAGGAGTTGAAGAGGAAGGAAGAGGAAGCCACAAAGAAGAAGGAAGAA
GAGGCCAAAAAGAAAAAGGAGGAAGAAGAAAAAGAACGCATCCGGAAAGAAGAGGAAGAGAAGGAGCGCGTTCGG
AAAGAGGAAGAAGAGCGGGTCCGAAAAGAGGTTGAAGAGAAGGAAAGGCTACGGAAAGAGGAAGAGGAGAGAGAA
CGCGTACGTTTGGAAGAGGCCGAGAATGAGAAGAAGAGGAAGGAAGAGGAGGAGAAGCAACGGATACGCAAGGAA
GAGGAAGAGCGCCAGCGCGAAGAGGAAGAACGAAAGCGTAAGGAGGAAGAGGAAGAAGAGCGTGAACGTCTACGC
AAAGAGGAGGAAGAGAAGGAGCGCCAACGTCAAGAAGCCGAAAAGGCGTCGAGAGCCAAGGAGCTTGAGGAGGAG
GCTGAAGCTAGTCAGTCTAGAGAGGAGGGTGAACTTGATGCACTCGAGGAGCATGACATTGTGTCAAGCCCCAAA
TCTGATTTCGACAAGAAATTCAAGGAGCCCCTCCGCATCAATACTTCCGAAGCTCAAAGAAGACGACCAGATCCC
CTGGACCTTTCCAATGCTGGGCCTGTGTCTGCTGCTCCGCGCTCTGCCATCGCCGCGGCTCGCGTAATTGATGAC
CTCAGCCGCGTGTCTTATCCTGAAGGCATCGCGAGCCCTCAACCCGACCTCAATACCAATGCCAAGGACGGAAAG
TTCCGGTATGATCGTGATTTCCTCATGCAATTCATGGCAATCTGCAAAGAAAAACCAGACATGCTTCCTCCCCTC
GACGCTATTGGATTGGAACCAATTGACCAAGCAAACCTTACTATGCAACGCGGGGGTTCTGGTCGTCATCGCCAA
TCGTCTGGCCCGTCTGCTGTTCAACGCGGAAATTCAATTGGTCTCGGATTTGCATCTGCCCCTGGCTTTAGCAAG
TCGAGCGGCCTCAATCCTTTTGCTGCTGGTGGCATGGGCAACTTTACGACGACCGGCAAACTTACAAGCGACGAG
CGTTTCCAAAACTCGTCCCGCTCTGCTTCTGTTAGTGGTATGGGTGGATTTGGTGGCCGGCCTGTGGCTATGCAG
CGGACGTCCAGTCAAGGTGGTCCTGGCGGAGTTGCCAGCAATCGGACGCGGAGTCAGCGCGGGAAGCAACGCGAA
AAGATGCCAGTTCAGCAAACTTCTAATGTTCATGGCAGTCAGCTTTCCAATTTCGAACCTGTTGCGCCTCTTAAA
GTTTCCGAGAACCGTTGGGATAGAAAAGCCCTCCACGTTGAGGGAGACTCGCCAGAAGTGGTTGACCGCAAGGTC
AGGGGTCTCCTCAATAAGTTGACGATGGAGAGATTTGACTCGATCTCTGATCAAATCATTGAATGGGCTAATAAA
TCGGAGAAGGAGAAGGATGGGAGAACCCTTATCCAGGTTATCCGTCTTGTCTTTGAGAAGGCGACTGATGAAGCT
ACGTGGTCGGAGATGTATGCTCGATTATGTCGCAAGATGATGGAGCAGATCAGTACCAAGGTGCAGGATGATGGG
ATCAGGAATAATGAGGGCAAGCCTATTGCTGGTGGTCAACTTTTCCGCAAATATCTTTTGAACAGATGTCAAGAG
GACTTTGAGCGTGGTTGGGTGACGAAAGAGGCGACTGCTGCTGCTGCTGCTACCAAAGCCATGGAAGATCAAGCT
ATCAAGGCTGCTCACGGGAAGGGTGAGGAAGGTGGAGAGGACGAGGTTGCGCTGTATTCGGAAGAGTACTATGCG
GCACAAAAGGCGAAGCGACAGGGTCTTGGTCTCATCAAATTCATCGGTGAACTATTCAAGTTGCAGATGCTGACA
GAGCGTATCATGCATGAATGTGTGAAGAAGCTCTTGGGCAATGTTAATAATCCCGAGGAGGAGGAGATTGAGAGT
TTATGCAAGCTCCTTTCTACTGTTGGTCAGAGTTTGGACACGCCGAAGGCTCATGGTCATATGGATGTTTATTTC
AAACGTATGAGGGAGTTGGCTGAGAGTACGAACGTTAGTTCTCGTATGCAGTTCATGCTTCAGGATTTGTTGGAA
TTCAGGCAGAGGAAATGGGTTGCGAGAAATGCTGTTGCCGCTCCCACGACGATTGCTCAGATTCACGAAGCTGCT
GCTAAAGAGAAGGCTGCCCAGGAGAAGGAATTATCGCAACGACAGATTAGCATGTCCCGTGGTGGTTCGAGACGT
GGCGGTGATCGTAACGAACAGCCTCCGGCGAACCCGGAGGGTTGGGCCGTTGCTGGCAACACAGCCAGGCCTCCC
TCCAAGGTGGACCTTTCCAACTTTGGCAAGATCAATAAAGCCCCGCCTACGACTTTTGGTCCTGGGAGTGTGTTT
GCTGGTAAGAAAGATAAGCGCGAGTCACTGTCTCGGTCGAATTCGAGCGCGAATATGTTCTCTATGCTTCAAAAT
GCTGAATCTGGAGCCGATAAGGCTGCAGAAGCCCTGCCTCAGCGCAAGAAATTGGCCCTTCTACCTCGTACCAAA
CCCATTGAAAATGAAACTGAAACTGAAGCTCAGCAGCAAGAAAGTGACGAGGAGCAAGTTCAATCGCCGACAGCG
GAAATGAACGACGAAGCTGCGCTGAAAAAGATTGATGAAGATTCCAAAGAATTGTTTGGTGTTCGGAATCTTTCT
GAAGCTGAGGTATACTTTTCGTCATTGCCTTCGCAGCATCATCACAAGCTGGTGGAGAAGTTGGTGTCGACCGCT
GTGGAATCGAAAGAGGCTGATGCGCGATTGGTTTCGGATTTGTTTGGGATTGCTGCGTCTAAGAGTTCGTGCAGT
CCCGCAGCGTTCGAAGAGGGATTTGCGCCTGTTGCTGAGATTATTGTGGACCTTGCGATTGATGCTCCGAAGGCC
TTTGACCTGTTTGCTATCATAGTTAAGGGGGCCTCATTAGATGAGGATCGACGGTCACGGTTAGCGTCGAAGTCG
GAGGACAGTGAAAAACTTCTTTTGCTATTATCTTAG
Transcript >Agabi119p4|047990
ATGAAGCGGCTGCATGTTGCGTCCTACCTCGTGTCGGGCCTCGGCGGGCTGCTCGCGAGCGTCGAGGCGCCCGCA
CTCGAGGAGCTCACCCTCGAGATCACTCGCGACAGCCCGGCATTCGGGCACGGGGCGCTGCCGAGAGAGGCCGTA
GAGGATCTGCTGGGGAGGTCGGGGGGCCGGGGCCGGCTAGAGCGGCTGGCGGTGATCGGACTTATTCACGCCTCT
CCAGCTGCTTTTACGCCTGCTGGCAGGTCATTTTTGACGACCGCATCCACAAAAAAAAACAACACCCCCCCCGCC
TCATCCGTGCCACATTCAATGAGCAGACCTTCCACTGCACAACAAGCCAGGAATCCCTCAGTTGCAAGACCGTCA
GCCTGGTCAAAAGGTCCCCCGACCTCTGCGCCCTCTCGCTCCCAGTCGCCCGCCCCATCCACCCCCACCTTTCAC
TCCCACTCGCGCCGCCCAAGTGCCCTCTCAGGTGTCTCCATTAAGGATGGCGTCACCGTCAACAAAAACAACGCC
GGCGCCGCAAAACAAGGTTCTGCCGTCACATTTGGTTCGATAGACGACGTCTCCGCCCCCATTTCTTCTTCGCCC
GCTGCCGCCCCCGCTATCAAGTCAGAGAGCGTCAAATCCTTCGGCACAATAGATGCAGACACACATGTGAATGGT
AAATCCACTCTTTCCGCGAGACCGTCTGTGGCGGTCCCAGCTTCCAGCACCAGCTCGTCTGCCTCTTCTCCTGCC
GTCTCAGTGGCGTCCGCTGCCCTCAAGCTTGGCAAACCAGACATCGCCAAGCTTTTCCAAAATCCCTCATCGGCC
CCTTCATCCCATCCCCCATCAGACACATCCTCCCCTTCCTTACGTCCCACTGGCTTACCCTCATCACAACATCCC
CCATCCTCACAGCCCTCCCAGTCTTCGGTACCCTCACAGCCCTCCCAACTATCTTCTCACCCTTCCTTCACCCCG
TATCGCCATCCACCATCAGGTGCTGGCTCAGGTCCTTCCCGCTCTCCTGCCTACCCTCCTCCGCGCCAGTCTGTC
AACGGCTCTGGCCCTCGCACACAAGGTGGTCCTAATGGTGCTCCCTCGCAGATTAACCCCGGGATGCCTAGCCCT
CGGCTAGCTCCCATGCCACATAATGGCCAACCTGCAGGTATGCCTCCCCCGCCTCAGATGCAAGTGGGTCAACAA
GTGCCCGTCGCATGGCCCGGTTACTATTATCCGAGTCCCGATACGTATGGCTATCCCCCTCATCAAGCCTGGTAC
CAACCTCAACATCACCTTCCCAGCGGTCCGCACGGGCCACCTCACACTGGAATGCCCATATCTCCCCGAAATCCT
CCCATACCCCTTCAACCCGGATCCGGTACTCCAACACTGTCCCATGCCGCCGCCAATCCCGTCCATTCCCCACAT
CCTCCCCCTCCTCTTGCCCATCCGTCGGCAAGTATGGGCTCTATATCCTCACCCCCTCCCACCCCTTCTACAAAT
ACCTCCCGGTTAAATGCCAATTCCTCTGCCTTTGCTCCAAGACCAAAAGTCACTTTCAAAACGGCGGAAGGTTTG
GAGGTTGCCCTCGGTGACTTGTCTTCTAAAACCAGTGCCAGTCCGTCGCCCGCAAATAATGCGCCGGCGAACGGG
CAAGGGACATTTAGACAAGGCAGTCCTGCGAATGGGAATCCCAACCGCCGAGGCGTGAGAATGGAGACTGAAGAT
CAACAAAGAAGACGATTAGCGGAGGAAGAGAGAGCCAAGGCTGAAGCCGAGGACAAGGTCAGAAAAGAGAAAGAG
GCGGAAGCGCGTAAGAAGCGGGAACAAGAGGAGTTGAAGAGGAAGGAAGAGGAAGCCACAAAGAAGAAGGAAGAA
GAGGCCAAAAAGAAAAAGGAGGAAGAAGAAAAAGAACGCATCCGGAAAGAAGAGGAAGAGAAGGAGCGCGTTCGG
AAAGAGGAAGAAGAGCGGGTCCGAAAAGAGGTTGAAGAGAAGGAAAGGCTACGGAAAGAGGAAGAGGAGAGAGAA
CGCGTACGTTTGGAAGAGGCCGAGAATGAGAAGAAGAGGAAGGAAGAGGAGGAGAAGCAACGGATACGCAAGGAA
GAGGAAGAGCGCCAGCGCGAAGAGGAAGAACGAAAGCGTAAGGAGGAAGAGGAAGAAGAGCGTGAACGTCTACGC
AAAGAGGAGGAAGAGAAGGAGCGCCAACGTCAAGAAGCCGAAAAGGCGTCGAGAGCCAAGGAGCTTGAGGAGGAG
GCTGAAGCTAGTCAGTCTAGAGAGGAGGGTGAACTTGATGCACTCGAGGAGCATGACATTGTGTCAAGCCCCAAA
TCTGATTTCGACAAGAAATTCAAGGAGCCCCTCCGCATCAATACTTCCGAAGCTCAAAGAAGACGACCAGATCCC
CTGGACCTTTCCAATGCTGGGCCTGTGTCTGCTGCTCCGCGCTCTGCCATCGCCGCGGCTCGCGTAATTGATGAC
CTCAGCCGCGTGTCTTATCCTGAAGGCATCGCGAGCCCTCAACCCGACCTCAATACCAATGCCAAGGACGGAAAG
TTCCGGTATGATCGTGATTTCCTCATGCAATTCATGGCAATCTGCAAAGAAAAACCAGACATGCTTCCTCCCCTC
GACGCTATTGGATTGGAACCAATTGACCAAGCAAACCTTACTATGCAACGCGGGGGTTCTGGTCGTCATCGCCAA
TCGTCTGGCCCGTCTGCTGTTCAACGCGGAAATTCAATTGGTCTCGGATTTGCATCTGCCCCTGGCTTTAGCAAG
TCGAGCGGCCTCAATCCTTTTGCTGCTGGTGGCATGGGCAACTTTACGACGACCGGCAAACTTACAAGCGACGAG
CGTTTCCAAAACTCGTCCCGCTCTGCTTCTGTTAGTGGTATGGGTGGATTTGGTGGCCGGCCTGTGGCTATGCAG
CGGACGTCCAGTCAAGGTGGTCCTGGCGGAGTTGCCAGCAATCGGACGCGGAGTCAGCGCGGGAAGCAACGCGAA
AAGATGCCAGTTCAGCAAACTTCTAATGTTCATGGCAGTCAGCTTTCCAATTTCGAACCTGTTGCGCCTCTTAAA
GTTTCCGAGAACCGTTGGGATAGAAAAGCCCTCCACGTTGAGGGAGACTCGCCAGAAGTGGTTGACCGCAAGGTC
AGGGGTCTCCTCAATAAGTTGACGATGGAGAGATTTGACTCGATCTCTGATCAAATCATTGAATGGGCTAATAAA
TCGGAGAAGGAGAAGGATGGGAGAACCCTTATCCAGGTTATCCGTCTTGTCTTTGAGAAGGCGACTGATGAAGCT
ACGTGGTCGGAGATGTATGCTCGATTATGTCGCAAGATGATGGAGCAGATCAGTACCAAGGTGCAGGATGATGGG
ATCAGGAATAATGAGGGCAAGCCTATTGCTGGTGGTCAACTTTTCCGCAAATATCTTTTGAACAGATGTCAAGAG
GACTTTGAGCGTGGTTGGGTGACGAAAGAGGCGACTGCTGCTGCTGCTGCTACCAAAGCCATGGAAGATCAAGCT
ATCAAGGCTGCTCACGGGAAGGGTGAGGAAGGTGGAGAGGACGAGGTTGCGCTGTATTCGGAAGAGTACTATGCG
GCACAAAAGGCGAAGCGACAGGGTCTTGGTCTCATCAAATTCATCGGTGAACTATTCAAGTTGCAGATGCTGACA
GAGCGTATCATGCATGAATGTGTGAAGAAGCTCTTGGGCAATGTTAATAATCCCGAGGAGGAGGAGATTGAGAGT
TTATGCAAGCTCCTTTCTACTGTTGGTCAGAGTTTGGACACGCCGAAGGCTCATGGTCATATGGATGTTTATTTC
AAACGTATGAGGGAGTTGGCTGAGAGTACGAACGTTAGTTCTCGTATGCAGTTCATGCTTCAGGATTTGTTGGAA
TTCAGGCAGAGGAAATGGGTTGCGAGAAATGCTGTTGCCGCTCCCACGACGATTGCTCAGATTCACGAAGCTGCT
GCTAAAGAGAAGGCTGCCCAGGAGAAGGAATTATCGCAACGACAGATTAGCATGTCCCGTGGTGGTTCGAGACGT
GGCGGTGATCGTAACGAACAGCCTCCGGCGAACCCGGAGGGTTGGGCCGTTGCTGGCAACACAGCCAGGCCTCCC
TCCAAGGTGGACCTTTCCAACTTTGGCAAGATCAATAAAGCCCCGCCTACGACTTTTGGTCCTGGGAGTGTGTTT
GCTGGTAAGAAAGATAAGCGCGAGTCACTGTCTCGGTCGAATTCGAGCGCGAATATGTTCTCTATGCTTCAAAAT
GCTGAATCTGGAGCCGATAAGGCTGCAGAAGCCCTGCCTCAGCGCAAGAAATTGGCCCTTCTACCTCGTACCAAA
CCCATTGAAAATGAAACTGAAACTGAAGCTCAGCAGCAAGAAAGTGACGAGGAGCAAGTTCAATCGCCGACAGCG
GAAATGAACGACGAAGCTGCGCTGAAAAAGATTGATGAAGATTCCAAAGAATTGTTTGGTGTTCGGAATCTTTCT
GAAGCTGAGGTATACTTTTCGTCATTGCCTTCGCAGCATCATCACAAGCTGGTGGAGAAGTTGGTGTCGACCGCT
GTGGAATCGAAAGAGGCTGATGCGCGATTGGTTTCGGATTTGTTTGGGATTGCTGCGTCTAAGAGTTCGTGCAGT
CCCGCAGCGTTCGAAGAGGGATTTGCGCCTGTTGCTGAGATTATTGTGGACCTTGCGATTGATGCTCCGAAGGCC
TTTGACCTGTTTGCTATCATAGTTAAGGGGGCCTCATTAGATGAGGATCGACGGTCACGGTTAGCGTCGAAGTCG
GAGGACAGTGAAAAACTTCTTTTGCTATTATCTTAG
Gene >Agabi119p4|047990
ATGAAGCGGCTGCATGTTGCGTCCTACCTCGTGTCGGGCCTCGGCGGGCTGCTCGCGAGCGTCGAGGCGCCCGCA
CTCGAGGAGCTCACCCTCGAGATCACTCGCGACAGCCCGGCATTCGGGCACGGGGCGCTGCCGAGAGAGGCCGTA
GAGGATCTGCTGGGGAGGTCGGGGGGCCGGGGCCGGCTAGAGCGGCTGGCGGTGATCGGACTTGTAAATAGTTAG
CTAGTAATGTACCCCGGACACCGGGTTATGTCAGCATGGGACTGCGAATTTTTGAGAGGACGAGCCCGAGTGTTG
TCCTTGTGCACAGGACTACAGCTCTGCCCGGATCGCTCACAGCGTCCGCCGCCTTTTCTTTCTAGATTCACGCCT
CTCCAGCTGCTTTTACGCCTGCTGGCAGGTCATTTTTGACGACCGCATCCACAAAAAAAAACAACACCCCCCCCG
CCTCATCCGTGCCACATTCGTGAGTCGCCTGTGCTGTCGCCCGATCGACGCTGATGTCCTCCGAGAATGAGCAGA
CCTTCCACTGCACAACAAGCCAGGAATCCCTCAGTTGCAAGACCGTCAGCCTGGTCAAAAGGTCCCCCGACCTCT
GCGCCCTCTCGCTCCCAGTCGCCCGCCCCATCCACCCCCACCTTTCACTCCCACTCGCGCCGCCCAAGTGCCCTC
TCAGGTGTCTCCATTAAGGATGGCGTCACCGTCAACAAAAACAACGCCGGCGCCGCAAAACAAGGTATGTCGTTC
CCCTTCCACCTCCCCAGCGTCTAACCCCGCCCACCACTCAGGTTCTGCCGTCACATTTGGTTCGATAGACGACGT
CTCCGCCCCCATTTCTTCTTCGCCCGCTGCCGCCCCCGCTATCAAGTCAGAGAGCGTCAAATCCTTCGGCACAAT
AGATGCAGACACACATGTGAATGGTAAATCCACTCTTTCCGCGAGACCGTCTGTGGCGGTCCCAGCTTCCAGCAC
CAGCTCGTCTGCCTCTTCTCCTGCCGTCTCAGTGGCGTCCGCTGCCCTCAAGCTTGGCAAACCAGACATCGCCAA
GCTTTTCCAAAATCCCTCATCGGCCCCTTCATCCCATCCCCCATCAGACACATCCTCCCCTTCCTTACGTCCCAC
TGGCTTACCCTCATCACAACATCCCCCATCCTCACAGCCCTCCCAGTCTTCGGTACCCTCACAGCCCTCCCAACT
ATCTTCTCACCCTTCCTTCACCCCGTATCGCCATCCACCATCAGGTGCTGGCTCAGGTCCTTCCCGCTCTCCTGC
CTACCCTCCTCCGCGCCAGTCTGTCAACGGCTCTGGCCCTCGCACACAAGGTGGTCCTAATGGTGCTCCCTCGCA
GATTAACCCCGGGATGCCTAGCCCTCGGCTAGCTCCCATGCCACATAATGGCCAACCTGCAGGTATGCCTCCCCC
GCCTCAGATGCAAGTGGGTCAACAAGTGCCCGTCGCATGGCCCGGTTACTATGTAAGTCGAGCCTTTTCGTCCCT
GCAAAGTCTATTCATTCATTGTGTACAGTATCCGAGTCCCGATACGTATGGCTATCCCCCTCATCAAGCCTGGTA
CCAACCTCAACATCACCTTCCCAGCGGTCCGCACGGGCCACCTCACACTGGAATGCCCATATCTCCCCGAAATCC
TCCCATACCCCTTCAACCCGGATCCGGTACTCCAACACTGTCCCATGCCGCCGCCAATCCCGTCCATTCCCCACA
TCCTCCCCCTCCTCTTGCCCATCCGTCGGCAAGTATGGGCTCTATATCCTCACCCCCTCCCACCCCTTCTACAAA
TACCTCCCGGTTAAATGCCAATTCCTCTGCCTTTGCTCCAAGACCAAAAGTCACTTTCAAAACGGCGGAAGGTTT
GGAGGTTGCCCTCGGTGACTTGTCTTCTAAAACCAGTGCCAGTCCGTCGCCCGCAAATAATGCGCCGGCGAACGG
GCAAGGGACATTTAGACAAGGCAGTCCTGCGAATGGGAATCCCAACCGCCGAGGCGTGAGAATGGAGACTGAAGA
TCAACAAAGAAGACGATTAGCGGAGGAAGAGAGAGCCAAGGCTGAAGCCGAGGACAAGGTCAGAAAAGAGAAAGA
GGCGGAAGCGCGTAAGAAGCGGGAACAAGAGGAGTTGAAGAGGAAGGAAGAGGAAGCCACAAAGAAGAAGGAAGA
AGAGGCCAAAAAGAAAAAGGAGGAAGAAGAAAAAGAACGCATCCGGAAAGAAGAGGAAGAGAAGGAGCGCGTTCG
GAAAGAGGAAGAAGAGCGGGTCCGAAAAGAGGTTGAAGAGAAGGAAAGGCTACGGAAAGAGGAAGAGGAGAGAGA
ACGCGTACGTTTGGAAGAGGCCGAGAATGAGAAGAAGAGGAAGGAAGAGGAGGAGAAGCAACGGATACGCAAGGA
AGAGGAAGAGCGCCAGCGCGAAGAGGAAGAACGAAAGCGTAAGGAGGAAGAGGAAGAAGAGCGTGAACGTCTACG
CAAAGAGGAGGAAGAGAAGGAGCGCCAACGTCAAGAAGCCGAAAAGGCGTCGAGAGCCAAGGAGCTTGAGGAGGA
GGCTGAAGCTAGTCAGTCTAGAGAGGAGGGTGAACTTGATGCACTCGAGGAGCATGACATTGTGTCAAGCCCCAA
ATCTGATTTCGACAAGAAATTCAAGGAGCCCCTCCGCATCAATACTTCCGAAGCTCAAAGAAGACGACCAGATCC
CCTGGACCTTTCCAATGCTGGGCCTGTGTCTGCTGCTCCGCGCTCTGCCATCGCCGCGGCTCGCGTAATTGATGA
CCTCAGCCGCGTGTCTTATCCTGAAGGCATCGCGAGCCCTCAACCCGACCTCAATACCAATGCCAAGGACGGAAA
GTTCCGGTGAGTCTTCTTCCACAGTCGTGTCTAGATTCTTCTTGACCCTTTCACACCGTAGGTATGATCGTGATT
TCCTCATGCAATTCATGGCAATCTGCAAAGAAAAACCAGACATGCTTCCTCCCCTCGACGCTATTGGATTGGAAC
CAATTGACCAAGCAAACCTTACTATGCAACGCGGGGGTTCTGGTCGTCATCGCCAATCGTCTGGCCCGTCTGCTG
TTCAACGCGGAAATTCAATTGGTCTCGGATTTGCATCTGCCCCTGGCTTTAGCAAGTCGAGCGGCCTCAATCCTT
TTGCTGCTGGTGGCATGGGCAACTTTACGACGACCGGCAAACTTACAAGCGACGAGCGTTTCCAAAACTCGTCCC
GCTCTGCTTCTGTTAGTGGTATGGGTGGATTTGGTGGCCGGCCTGTGGCTATGCAGCGGACGTCCAGTCAAGGTG
GTCCTGGCGGAGTTGCCAGCAATCGGACGCGGAGTCAGCGCGGGAAGCAACGCGAAAAGATGCCAGTTCAGCAAA
CTTCTAATGTTCATGGCAGTCAGCTTTCCAATTTCGAACCTGTTGCGCCTCTTAAAGTTTCCGAGAACCGTTGGG
ATAGAAAAGCCCTCCACGTTGAGGGAGACTCGCCAGAAGTGGTTGACCGCAAGGTCAGGGGTCTCCTCAATAAGT
TGACGATGGAGAGATTTGACTCGATCTCTGATCAAATCATTGAATGGGCTAATAAATCGGAGAAGGAGAAGGATG
GGAGAACCCTTATCCAGGTTATCCGTCTTGTCTTTGAGAAGGCGACTGATGAAGCTACGTGGTCGGAGATGTATG
CTCGATTATGTCGCAAGATGATGGAGCAGATCAGTACCAAGGTGCAGGATGATGGGATCAGGAATAATGAGGGCA
AGCCTATTGCTGGTGGTCAACTTTTCCGCAAATATCTTTTGAACAGATGTCAAGAGGACTTTGAGCGTGGTTGGG
TGACGAAAGAGGCGACTGCTGCTGCTGCTGCTACCAAAGCCATGGAAGATCAAGCTATCAAGGCTGCTCACGGGA
AGGGTGAGGAAGGTGGAGAGGACGAGGTTGCGCTGTATTCGGAAGAGTACTATGCGGCACAAAAGGCGAAGCGAC
AGGGTCTTGGTCTCATCAAATTCATCGGTGAACTATTCAAGTTGCAGATGCTGACAGAGCGTATCATGCATGAAT
GTGTGAAGAAGCTCTTGGGCAATGTTAATAATCCCGAGGAGGAGGAGATTGAGAGTTTATGCAAGCTCCTTTCTA
CTGTTGGTCAGAGTTTGGACACGCCGAAGGCTCATGGTCATATGGATGTTTATTTCAAACGTATGAGGGAGTTGG
CTGAGAGTACGAACGTTAGTTCTCGTATGCAGTTCATGCTTCAGGTGTGTTTTTTTTTCCTTATCGGAAGATTGT
GGGCTCATTGTGAATTACTAGGATTTGTTGGAATTCAGGCAGAGGAAATGGGTTGCGAGAAATGCTGTTGCCGCT
CCCACGACGATTGCTCAGATTCACGAAGCTGTATGTTTTTTTCTTTTATTGTCACTTCATCTATGTTAACTCACT
GACTTTACTTTAGGCTGCTAAAGAGAAGGCTGCCCAGGAGAAGGAATTATCGCAACGACAGATTAGCATGTCCCG
TGGTGGTTCGAGACGTGGCGGTGATCGTAACGAACAGCCTCCGGCGAACCCGGAGGGTTGGGCCGTTGCTGGCAA
CACAGCCAGGCCTCCCTCCAAGGTGGACCTTTCCAACTTTGGCAAGATCAATAAAGCCCCGCCTACGACTTTTGG
TCCTGGGAGTGTGTTTGCTGGTAAGAAAGATAAGCGCGAGTCACTGTCTCGGTCGAATTCGAGCGCGAATATGTT
CTCTATGCTTCAAAATGCTGAATCTGGAGCCGATAAGGGTATGAGCTTGTCATTTTTCTGTGTGTCATTGGATCT
AACTAGATTGTTTTTAGCTGCAGAAGCCCTGCCTCAGCGCAAGAAATTGGCCCTTCTACCTCGTACCAAACCCAT
TGAAAATGAAACTGAAACTGAAGCTCAGCAGCAAGAAAGTGACGAGGAGCAAGTTCAATCGCCGACAGCGGAAAT
GAACGACGAAGCTGCGCTGAAAAAGATTGATGAAGATTCCAAAGAATTGTTTGGTGTTCGGAATCTTTCTGAAGC
TGAGGTATACTTTTCGTCATTGCCTTCGCAGCATCATCACAAGCTGGTGGAGAAGTTGGTGTCGACCGCTGTGGA
ATCGAAAGAGGCTGATGCGCGATTGGTTTCGGATTTGTTTGGGATTGCTGCGTCTAAGAGTTCGTGCAGTCCCGC
AGCGTTCGAAGAGGGATTTGCGCCTGTTGCTGAGATTATTGTGGACCTTGCGATTGATGCTCCGAAGGCCTTTGA
CCTGTTTGCTATCATAGTTAAGGGGGCCTCATTAGATGAGGATCGACGGTCACGGTTAGCGTCGAAGTCGGAGGA
CAGTGAAAAACTTCTTTTGCTATTATCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail