Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|047200
Gene name
Locationscaffold_02:2069025..2070712
Strand+
Gene length (bp)1687
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00149 Metallophos Calcineurin-like phosphoesterase 2.7E-12 57 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40986|CDC1_YEAST Cell division control protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC1 PE=1 SV=2 9 356 3.0E-49
sp|Q9UUH0|YKIC_SCHPO Uncharacterized protein C630.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC630.12 PE=3 SV=1 23 382 4.0E-41
sp|Q0IHA5|MPPE1_XENLA Metallophosphoesterase 1 OS=Xenopus laevis GN=mppe1 PE=2 SV=1 19 382 4.0E-14
sp|Q9VLR9|MPPE1_DROME Metallophosphoesterase 1 homolog OS=Drosophila melanogaster GN=PGAP5 PE=2 SV=4 34 336 6.0E-14
sp|Q5ZK82|MPPE1_CHICK Metallophosphoesterase 1 OS=Gallus gallus GN=MPPE1 PE=2 SV=1 4 377 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40986|CDC1_YEAST Cell division control protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC1 PE=1 SV=2 9 356 3.0E-49
sp|Q9UUH0|YKIC_SCHPO Uncharacterized protein C630.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC630.12 PE=3 SV=1 23 382 4.0E-41
sp|Q0IHA5|MPPE1_XENLA Metallophosphoesterase 1 OS=Xenopus laevis GN=mppe1 PE=2 SV=1 19 382 4.0E-14
sp|Q9VLR9|MPPE1_DROME Metallophosphoesterase 1 homolog OS=Drosophila melanogaster GN=PGAP5 PE=2 SV=4 34 336 6.0E-14
sp|Q5ZK82|MPPE1_CHICK Metallophosphoesterase 1 OS=Gallus gallus GN=MPPE1 PE=2 SV=1 4 377 1.0E-11
sp|Q566Y9|MPPE1_DANRE Metallophosphoesterase 1 OS=Danio rerio GN=mppe1 PE=2 SV=1 8 384 2.0E-11
sp|Q80XL7|MPPE1_MOUSE Metallophosphoesterase 1 OS=Mus musculus GN=Mppe1 PE=2 SV=1 23 377 4.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 32 0.45

Transmembrane Domains

Domain # Start End Length
1 360 382 22
2 444 466 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|047200
MNFLPRNRRVVTLLRLFWLVLSLWYEHFVFQASVRSCTWPKPKAVDQQNIDGPPPSHILIIADPQILDHRSYPGR
PAFLTYLTRLVVDLNLRKNWRAAIAKNPDAVVFLGDMMDGGRMDMSDDEYEDYYSRFKDIFRMDKAIYQFYIPGN
HDTGLQSRSVFSPLARSRYISHFGPLNNRASISNHTLLFFDAPGFVQEDYERAGQRKSFAEWRPKVGGPFEFVRT
VGEVNDLDPAVLFTHIPLYRPDGKSCGPLREKGTIRPGVGFGYQNTLGKDSTSFVLHQMRPTVVFSGDDHDYCEH
THQSVISTPVNEVTIKSLSMAMNVRKPGFQLLSLFPATTWDNVNPTYAHVPCLLPDQLGIYQGVYIPCALVSLLI
VVVAAVMRGRTSDHDKKNIAKLPDPATNPPQNQTSVVCFGRRRRLLGLGCLFGNKGSRRASKRGLVQNILQDVLD
IAVFPISIFVIVTVLISL*
Coding >Agabi119p4|047200
ATGAATTTCTTGCCACGAAATCGTAGAGTAGTCACCCTACTCCGTCTTTTCTGGCTGGTCCTTTCTCTTTGGTAC
GAGCACTTTGTATTTCAAGCATCAGTAAGGTCATGTACTTGGCCCAAACCAAAAGCGGTCGACCAGCAAAACATC
GATGGCCCACCGCCCTCGCACATCCTCATCATCGCTGACCCTCAAATTCTTGACCACCGTTCCTACCCAGGTCGC
CCGGCGTTTCTGACCTACCTGACGCGCTTGGTTGTTGATCTCAACCTCAGAAAGAACTGGCGAGCGGCTATTGCC
AAGAACCCCGATGCAGTTGTGTTTCTCGGTGATATGATGGACGGCGGAAGGATGGACATGTCAGACGATGAATAT
GAGGACTATTATTCTCGTTTCAAGGATATCTTTCGCATGGACAAGGCTATATACCAGTTTTACATTCCTGGAAAT
CATGATACGGGGCTACAGTCTCGATCCGTATTCTCGCCTCTCGCGCGCTCACGCTATATATCCCATTTTGGACCT
TTAAACAATCGAGCGTCCATATCTAATCACACTCTCTTGTTCTTCGACGCCCCTGGATTTGTTCAAGAAGATTAC
GAACGTGCTGGACAACGAAAATCCTTTGCCGAATGGAGACCAAAAGTTGGTGGTCCTTTTGAATTCGTCAGAACA
GTGGGAGAAGTGAATGATCTTGATCCCGCCGTTTTATTCACTCACATCCCTCTCTATCGACCTGATGGCAAGTCC
TGTGGTCCATTGCGAGAAAAAGGTACTATTCGACCGGGTGTCGGCTTTGGGTACCAGAACACGTTGGGCAAGGAT
TCGACCTCTTTTGTGTTGCATCAGATGAGACCAACAGTAGTCTTCAGTGGTGATGATCACGACTATTGCGAACAC
ACTCATCAATCGGTCATTTCAACTCCAGTCAACGAAGTCACCATCAAATCGCTTTCCATGGCTATGAACGTTCGA
AAGCCTGGCTTTCAGCTTCTATCCCTGTTCCCCGCGACTACATGGGACAATGTCAATCCTACCTATGCCCATGTT
CCATGTCTGCTTCCCGACCAACTAGGAATCTACCAGGGCGTGTACATACCTTGCGCTCTTGTGTCCCTTCTTATC
GTGGTTGTCGCTGCTGTGATGCGCGGTCGAACAAGCGACCATGATAAAAAAAACATTGCCAAGTTACCGGATCCC
GCCACCAATCCTCCTCAAAACCAAACTTCCGTTGTATGTTTTGGTCGGCGACGCCGTCTCCTTGGTCTTGGTTGT
CTTTTTGGCAATAAAGGGTCTCGCAGAGCGTCGAAGCGTGGACTGGTACAGAACATTTTACAAGATGTATTGGAC
ATTGCTGTGTTTCCCATAAGTATATTCGTCATTGTCACTGTCCTTATTTCGCTATGA
Transcript >Agabi119p4|047200
ATGAATTTCTTGCCACGAAATCGTAGAGTAGTCACCCTACTCCGTCTTTTCTGGCTGGTCCTTTCTCTTTGGTAC
GAGCACTTTGTATTTCAAGCATCAGTAAGGTCATGTACTTGGCCCAAACCAAAAGCGGTCGACCAGCAAAACATC
GATGGCCCACCGCCCTCGCACATCCTCATCATCGCTGACCCTCAAATTCTTGACCACCGTTCCTACCCAGGTCGC
CCGGCGTTTCTGACCTACCTGACGCGCTTGGTTGTTGATCTCAACCTCAGAAAGAACTGGCGAGCGGCTATTGCC
AAGAACCCCGATGCAGTTGTGTTTCTCGGTGATATGATGGACGGCGGAAGGATGGACATGTCAGACGATGAATAT
GAGGACTATTATTCTCGTTTCAAGGATATCTTTCGCATGGACAAGGCTATATACCAGTTTTACATTCCTGGAAAT
CATGATACGGGGCTACAGTCTCGATCCGTATTCTCGCCTCTCGCGCGCTCACGCTATATATCCCATTTTGGACCT
TTAAACAATCGAGCGTCCATATCTAATCACACTCTCTTGTTCTTCGACGCCCCTGGATTTGTTCAAGAAGATTAC
GAACGTGCTGGACAACGAAAATCCTTTGCCGAATGGAGACCAAAAGTTGGTGGTCCTTTTGAATTCGTCAGAACA
GTGGGAGAAGTGAATGATCTTGATCCCGCCGTTTTATTCACTCACATCCCTCTCTATCGACCTGATGGCAAGTCC
TGTGGTCCATTGCGAGAAAAAGGTACTATTCGACCGGGTGTCGGCTTTGGGTACCAGAACACGTTGGGCAAGGAT
TCGACCTCTTTTGTGTTGCATCAGATGAGACCAACAGTAGTCTTCAGTGGTGATGATCACGACTATTGCGAACAC
ACTCATCAATCGGTCATTTCAACTCCAGTCAACGAAGTCACCATCAAATCGCTTTCCATGGCTATGAACGTTCGA
AAGCCTGGCTTTCAGCTTCTATCCCTGTTCCCCGCGACTACATGGGACAATGTCAATCCTACCTATGCCCATGTT
CCATGTCTGCTTCCCGACCAACTAGGAATCTACCAGGGCGTGTACATACCTTGCGCTCTTGTGTCCCTTCTTATC
GTGGTTGTCGCTGCTGTGATGCGCGGTCGAACAAGCGACCATGATAAAAAAAACATTGCCAAGTTACCGGATCCC
GCCACCAATCCTCCTCAAAACCAAACTTCCGTTGTATGTTTTGGTCGGCGACGCCGTCTCCTTGGTCTTGGTTGT
CTTTTTGGCAATAAAGGGTCTCGCAGAGCGTCGAAGCGTGGACTGGTACAGAACATTTTACAAGATGTATTGGAC
ATTGCTGTGTTTCCCATAAGTATATTCGTCATTGTCACTGTCCTTATTTCGCTATGA
Gene >Agabi119p4|047200
ATGAATTTCTTGCCACGAAATCGTAGAGTAGTCACCCTACTCCGTCTTTTCTGGCTGGTCCTTTCTCTTTGGTAC
GAGCACTTTGTATTTCAAGCATCAGTAAGGTCATGTACTTGGCCCAAACCAAAAGCGGTCGACCAGGTGAGTCGA
ACAAGTTGCTGGTCTAACAACCTTCATCCCGACATTCCATTACCAGCAAAACATCGATGGCCCACCGCCCTCGCA
CATCCTCATCATCGCTGACCCTCAAATTCTTGACCACCGTTCCTACCCAGGTCGCCCGGCGTTTCTGACCTACCT
GACGCGCTTGGTTGTTGATCTCAACCTCAGAAAGAACTGGCGAGCGGCTATTGCCAAGAACCCCGATGCAGTTGT
GTTTCTCGGTGATATGATGGACGGCGGAAGGATGGACATGTCAGACGATGAGTATGCACCATAACGCTGGCTTTT
GTAGTCCTGAAGCACCTCCTAACCTTCGTTTGTGTTGATTCCAGATATGAGGACTATTATTCTCGTTTCAAGGAT
ATCTTTCGCATGGACAAGGCTATATACCAGTTTTACATTCCTGGAAATCATGATACGGGGTATGAAGAATAAATC
TATCGCATCGGACGCAGTCTGACCATCTTACCAGGCTACAGTCTCGATCCGTATTCTCGCCTCTCGCGCGCTCAC
GCTATATATCCCATTTTGGACCTTTAAACAATCGAGCGTCCATATCTAATCACACTCTCTTGTTCTTCGACGCCC
CTGGATTTGTTCAAGAAGATTACGAACGTGCTGGACAACGAAAATCCTTTGCCGAATGGAGACCAAAAGTTGGTG
GTCCTTTTGAATTCGTCAGAACAGTGGGAGAAGGTGATTCCTCAGTCTACTTCGTACCTTTCAACTCATCCCTTA
GTTGTAAAAAACCAGTGAATGATCTTGATCCCGCCGTTTTATTCACTCACATCCCTCTCTATCGACCTGATGGCA
AGTCCTGTGGTCCATTGCGAGAAAAAGGTACTATTCGACCGGGTGTCGGCTTTGGGTACCAGAACACGTTGGGCA
AGGATTCGACCTCTTTTGTGTTGCATCAGATGAGACCAACAGTAGTCTTCAGGTAAATCAGGCCAAATACTTATT
CCGTCCCTTTATTAAACAACTCTCCAGTGGTGATGATCACGACTATTGCGAACACACTCATCAATCGGTCATTTC
AACTCCAGTCAACGAAGTCACCATCAAATCGCTTTCCATGGCTATGAACGTTCGAAAGCCTGGCTTTCAGCTTCT
ATCCCTGTTCCCCGCGACTACATGGGACAATGTCAATCCTACCTATGCCCATGTTCCATGTCTGCTTCCCGACCA
ACTAGGAATCTACCAGGGCGTGTACATACCTTGCGCTCTTGTGTCCCTTCTTATCGTGGTTGTCGCTGCTGTGAT
GCGCGGTCGAACAAGCGACCATGATAAAAAAAACATTGCCAAGTTACCGGATCCCGCCACCAATCCTCCTCAAAA
CCAAACTTCCGTTGTATGTTTTGGTCGGCGACGCCGTCTCCTTGGTCTTGGTTGTCTTTTTGGCAATAAAGGGTC
TCGCAGAGCGTCGAAGCGTGGACTGGTACAGAACATTTTACAAGATGTATTGGACATTGCTGTGTTTCCCATAAG
TATATTCGTCATTGTCACTGTCCTTATTTCGCTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail