Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|047030
Gene name
Locationscaffold_02:1968524..1973802
Strand-
Gene length (bp)5278
Transcript length (bp)4239
Coding sequence length (bp)4239
Protein length (aa) 1413

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 2.1E-30 516 718
PF12409 P5-ATPase P5-type ATPase cation transporter 6.4E-27 264 397
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 4.5E-08 735 1015
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 2.2E-06 1106 1148
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.0E-05 875 917

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 257 1375 0.0E+00
sp|Q12697|YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK9 PE=1 SV=1 257 1385 0.0E+00
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 256 1344 0.0E+00
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 256 1346 0.0E+00
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 433 1346 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 257 1375 0.0E+00
sp|Q12697|YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK9 PE=1 SV=1 257 1385 0.0E+00
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 256 1344 0.0E+00
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 256 1346 0.0E+00
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 433 1346 0.0E+00
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 424 1346 0.0E+00
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 265 1340 0.0E+00
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 271 1386 0.0E+00
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 433 1344 0.0E+00
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 384 1340 0.0E+00
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 264 1340 0.0E+00
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 256 1340 3.0E-171
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 272 1340 1.0E-168
sp|O14022|CTA5_SCHPO Cation-transporting ATPase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta5 PE=3 SV=1 389 1338 2.0E-126
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 390 1156 4.0E-98
sp|Q9HD20|AT131_HUMAN Manganese-transporting ATPase 13A1 OS=Homo sapiens GN=ATP13A1 PE=1 SV=2 437 1153 3.0E-94
sp|Q9EPE9|AT131_MOUSE Manganese-transporting ATPase 13A1 OS=Mus musculus GN=Atp13a1 PE=1 SV=2 437 1153 2.0E-93
sp|P90747|AT131_CAEEL Probable manganese-transporting ATPase catp-8 OS=Caenorhabditis elegans GN=catp-8 PE=3 SV=3 422 1153 4.0E-88
sp|P39986|ATC6_YEAST Manganese-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPF1 PE=1 SV=1 424 1153 4.0E-87
sp|Q9LT02|PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana GN=PDR2 PE=1 SV=1 437 1153 7.0E-84
sp|Q95050|ATX9_TETTH Probable cation-transporting ATPase 9 OS=Tetrahymena thermophila GN=TPA9 PE=2 SV=1 432 1344 3.0E-73
sp|Q95JN5|AT133_MACFA Probable cation-transporting ATPase 13A3 (Fragment) OS=Macaca fascicularis GN=ATP13A3 PE=2 SV=2 272 735 4.0E-70
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 482 1277 4.0E-39
sp|Q04956|ATX1_PLAFA Probable cation-transporting ATPase 1 OS=Plasmodium falciparum PE=3 SV=1 1095 1287 5.0E-32
sp|O43108|ATC1_YARLI Calcium-transporting ATPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PMR1 PE=3 SV=1 468 1264 9.0E-32
sp|Q04956|ATX1_PLAFA Probable cation-transporting ATPase 1 OS=Plasmodium falciparum PE=3 SV=1 785 1021 2.0E-28
sp|P37278|ATCL_SYNE7 Calcium-transporting ATPase OS=Synechococcus elongatus (strain PCC 7942) GN=pacL PE=1 SV=2 424 1343 7.0E-28
sp|P13586|ATC1_YEAST Calcium-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMR1 PE=1 SV=1 422 1296 2.0E-27
sp|Q04956|ATX1_PLAFA Probable cation-transporting ATPase 1 OS=Plasmodium falciparum PE=3 SV=1 574 771 6.0E-26
sp|O59868|ATC1_SCHPO Calcium-transporting ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmr1 PE=1 SV=1 436 1273 6.0E-25
sp|P37367|ATA1_SYNY3 Cation-transporting ATPase pma1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pma1 PE=3 SV=2 424 1264 1.0E-23
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 518 1284 2.0E-22
sp|P98194|AT2C1_HUMAN Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 419 1276 4.0E-22
sp|P57709|AT2C1_BOVIN Calcium-transporting ATPase type 2C member 1 OS=Bos taurus GN=ATP2C1 PE=2 SV=1 419 1276 4.0E-22
sp|Q5R5K5|AT2C1_PONAB Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii GN=ATP2C1 PE=2 SV=1 419 1276 5.0E-22
sp|Q04956|ATX1_PLAFA Probable cation-transporting ATPase 1 OS=Plasmodium falciparum PE=3 SV=1 429 575 8.0E-22
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 424 1354 9.0E-22
sp|Q92126|ATP4A_XENLA Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 518 1226 1.0E-21
sp|P04191|AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus GN=ATP2A1 PE=1 SV=1 424 1256 5.0E-21
sp|Q64578|AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus GN=Atp2a1 PE=1 SV=1 424 1256 6.0E-21
sp|P35317|AT1A_HYDVU Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 517 1273 7.0E-21
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 473 1226 9.0E-21
sp|Q03669|AT2A2_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus GN=ATP2A2 PE=2 SV=2 424 1256 2.0E-20
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 507 1268 2.0E-20
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 517 1279 4.0E-20
sp|P54708|AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 473 1226 4.0E-20
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 404 1182 9.0E-20
sp|P35315|ATC_TRYBB Probable calcium-transporting ATPase OS=Trypanosoma brucei brucei GN=TBA1 PE=3 SV=1 517 1250 9.0E-20
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 517 1226 1.0E-19
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 507 1323 1.0E-19
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 871 1228 2.0E-19
sp|Q64436|ATP4A_MOUSE Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 518 1287 7.0E-19
sp|O14983|AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 424 1256 9.0E-19
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 686 1167 1.0E-18
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 474 1286 2.0E-18
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 868 1167 6.0E-18
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 868 1167 8.0E-18
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 686 1167 9.0E-18
sp|Q64541|AT1A4_RAT Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 887 1267 1.0E-17
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 853 1162 2.0E-17
sp|P9WPS9|CTPF_MYCTU Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpF PE=1 SV=1 424 1019 3.0E-17
sp|P9WPS8|CTPF_MYCTO Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpF PE=2 SV=1 424 1019 3.0E-17
sp|P63688|CTPF_MYCBO Probable cation-transporting ATPase F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpF PE=3 SV=1 424 1019 3.0E-17
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 679 1350 3.0E-17
sp|Q9Z1W8|AT12A_MOUSE Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 473 1226 3.0E-17
sp|Q9SY55|ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 454 1226 3.0E-17
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 873 1161 3.0E-17
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 887 1267 5.0E-17
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 532 1318 1.0E-16
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 723 1246 2.0E-16
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 532 1287 2.0E-16
sp|P09572|AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 517 1279 2.0E-16
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 873 1161 2.0E-16
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 872 1250 3.0E-16
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 481 1313 5.0E-16
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 424 753 6.0E-16
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 532 1266 7.0E-16
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 871 1167 8.0E-16
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 871 1161 8.0E-16
sp|Q9LY32|PMA7_ARATH ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 424 766 8.0E-16
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 873 1161 1.0E-15
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 871 1167 1.0E-15
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 881 1273 2.0E-15
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 871 1167 2.0E-15
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 532 1029 2.0E-15
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 871 1250 3.0E-15
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 875 1162 3.0E-15
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 871 1227 4.0E-15
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 875 1162 4.0E-15
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 733 1162 4.0E-15
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 476 1386 9.0E-15
sp|Q13733|AT1A4_HUMAN Sodium/potassium-transporting ATPase subunit alpha-4 OS=Homo sapiens GN=ATP1A4 PE=1 SV=3 887 1267 9.0E-15
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 727 1224 9.0E-15
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 902 1279 1.0E-14
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 733 1162 2.0E-14
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 875 1162 2.0E-14
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 875 1162 4.0E-14
sp|Q92030|AT1A1_ANGAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Anguilla anguilla GN=atp1a1 PE=2 SV=1 902 1273 4.0E-14
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 424 810 4.0E-14
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 532 1266 4.0E-14
sp|Q92123|AT1A1_XENLA Sodium/potassium-transporting ATPase subunit alpha-1 OS=Xenopus laevis GN=atp1a1 PE=2 SV=1 902 1279 4.0E-14
sp|P28774|AT1B_ARTSF Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 966 1267 6.0E-14
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 518 1271 6.0E-14
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 733 1162 6.0E-14
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 902 1279 7.0E-14
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 902 1279 8.0E-14
sp|Q9YH26|AT1A1_OREMO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 902 1273 1.0E-13
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 821 1161 1.0E-13
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 902 1279 1.0E-13
sp|A2VDL6|AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 902 1279 1.0E-13
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 902 1279 1.0E-13
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 902 1279 1.0E-13
sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 532 1268 2.0E-13
sp|Q5RCD8|AT1A2_PONAB Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 902 1279 2.0E-13
sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 424 763 2.0E-13
sp|D2WKD8|AT1A2_PIG Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 887 1279 2.0E-13
sp|P39986|ATC6_YEAST Manganese-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPF1 PE=1 SV=1 1134 1340 3.0E-13
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 902 1279 3.0E-13
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 871 1161 3.0E-13
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 871 1161 3.0E-13
sp|P50993|AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 902 1279 3.0E-13
sp|Q58623|Y1226_METJA Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 421 785 3.0E-13
sp|P25489|AT1A1_CATCO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 896 1290 4.0E-13
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 902 1279 4.0E-13
sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 902 1267 4.0E-13
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 902 1279 5.0E-13
sp|Q8R429|AT2A1_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus GN=Atp2a1 PE=1 SV=1 424 1023 5.0E-13
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 902 1279 5.0E-13
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 424 1019 5.0E-13
sp|P06686|AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 902 1279 6.0E-13
sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 902 1279 6.0E-13
sp|Q0VCY0|AT2A1_BOVIN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Bos taurus GN=ATP2A1 PE=1 SV=1 424 1019 6.0E-13
sp|P16615|AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 424 1028 6.0E-13
sp|P05025|AT1A_TORCA Sodium/potassium-transporting ATPase subunit alpha OS=Torpedo californica PE=1 SV=1 902 1279 6.0E-13
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 875 1261 8.0E-13
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 875 1252 8.0E-13
sp|P20647|AT2A2_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Oryctolagus cuniculus GN=ATP2A2 PE=2 SV=2 424 1028 9.0E-13
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 902 1279 1.0E-12
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 902 1226 1.0E-12
sp|Q80XR2|AT2C1_MOUSE Calcium-transporting ATPase type 2C member 1 OS=Mus musculus GN=Atp2c1 PE=1 SV=2 1075 1276 2.0E-12
sp|O55143|AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus GN=Atp2a2 PE=1 SV=2 424 1039 2.0E-12
sp|P11607|AT2A2_PIG Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa GN=ATP2A2 PE=1 SV=1 424 1041 2.0E-12
sp|Q64566|AT2C1_RAT Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus GN=Atp2c1 PE=2 SV=1 1075 1276 2.0E-12
sp|O46674|AT2A2_CANLF Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Canis lupus familiaris GN=ATP2A2 PE=2 SV=1 424 1039 3.0E-12
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 424 779 3.0E-12
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 856 1161 3.0E-12
sp|P30714|AT1A1_RHIMB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rhinella marina GN=ATP1A1 PE=1 SV=2 902 1279 3.0E-12
sp|O75185|AT2C2_HUMAN Calcium-transporting ATPase type 2C member 2 OS=Homo sapiens GN=ATP2C2 PE=1 SV=2 421 1281 4.0E-12
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 476 1033 4.0E-12
sp|P11507|AT2A2_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus GN=Atp2a2 PE=1 SV=1 424 1039 4.0E-12
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 875 1216 4.0E-12
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 848 1228 4.0E-12
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 788 1162 5.0E-12
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 872 1230 7.0E-12
sp|P13607|ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 893 1289 7.0E-12
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 872 1230 8.0E-12
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 424 763 8.0E-12
sp|Q00779|AT2A2_FELCA Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Felis catus GN=ATP2A2 PE=2 SV=1 424 1039 8.0E-12
sp|P58312|AT1A3_OREMO Sodium/potassium-transporting ATPase subunit alpha-3 OS=Oreochromis mossambicus GN=atp1a3 PE=2 SV=1 965 1279 1.0E-11
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 902 1279 1.0E-11
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 476 763 1.0E-11
sp|Q7PPA5|ATC1_ANOGA Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae GN=Ca-P60A PE=3 SV=5 424 1019 1.0E-11
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 424 753 1.0E-11
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 424 763 1.0E-11
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 1097 1235 2.0E-11
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 424 763 2.0E-11
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 1097 1235 2.0E-11
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 424 753 3.0E-11
sp|O53114|CTPI_MYCLE Probable cation-transporting ATPase I OS=Mycobacterium leprae (strain TN) GN=ctpI PE=3 SV=1 1107 1235 3.0E-11
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 424 753 4.0E-11
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 424 763 5.0E-11
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 424 810 5.0E-11
sp|Q8R4C1|AT2C2_RAT Calcium-transporting ATPase type 2C member 2 OS=Rattus norvegicus GN=Atp2c2 PE=2 SV=1 1105 1281 6.0E-11
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 865 1273 6.0E-11
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 424 763 7.0E-11
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 875 1216 7.0E-11
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 733 1162 7.0E-11
sp|P50997|AT1A1_CANLF Sodium/potassium-transporting ATPase subunit alpha-1 OS=Canis lupus familiaris GN=ATP1A1 PE=2 SV=1 902 1279 9.0E-11
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 875 1161 9.0E-11
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 872 1161 1.0E-10
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 515 753 1.0E-10
sp|A7L9Z8|AT2C2_MOUSE Calcium-transporting ATPase type 2C member 2 OS=Mus musculus GN=Atp2c2 PE=2 SV=1 1105 1320 1.0E-10
sp|Q292Q0|ATC1_DROPS Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura GN=Ca-P60A PE=3 SV=2 424 1019 1.0E-10
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 865 1234 1.0E-10
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 1075 1266 2.0E-10
sp|P54679|PMA1_DICDI Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 424 753 2.0E-10
sp|P13585|AT2A1_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Gallus gallus GN=ATP2A1 PE=2 SV=2 424 1019 2.0E-10
sp|Q92105|AT2A1_PELES Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Pelophylax esculentus GN=ATP2A1 PE=2 SV=1 422 1019 2.0E-10
sp|P0ABB8|ATMA_ECOLI Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) GN=mgtA PE=1 SV=1 459 751 2.0E-10
sp|P0ABB9|ATMA_ECO57 Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli O157:H7 GN=mgtA PE=3 SV=1 459 751 2.0E-10
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 476 763 2.0E-10
sp|Q92036|AT12A_RHIMB Potassium-transporting ATPase alpha chain 2 OS=Rhinella marina GN=ATP12A PE=2 SV=1 902 1226 3.0E-10
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 424 763 3.0E-10
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 872 1165 3.0E-10
sp|Q8R4C1|AT2C2_RAT Calcium-transporting ATPase type 2C member 2 OS=Rattus norvegicus GN=Atp2c2 PE=2 SV=1 359 749 5.0E-10
sp|Q9LT02|PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana GN=PDR2 PE=1 SV=1 1156 1340 6.0E-10
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 1080 1268 6.0E-10
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 872 1230 8.0E-10
sp|A7L9Z8|AT2C2_MOUSE Calcium-transporting ATPase type 2C member 2 OS=Mus musculus GN=Atp2c2 PE=2 SV=1 424 749 9.0E-10
sp|P36640|ATMA_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 459 751 9.0E-10
sp|D0ZTB2|ATMA_SALT1 Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 459 751 9.0E-10
sp|Q9HD20|AT131_HUMAN Manganese-transporting ATPase 13A1 OS=Homo sapiens GN=ATP13A1 PE=1 SV=2 1157 1344 1.0E-09
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 905 1200 1.0E-09
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 905 1200 1.0E-09
sp|Q9EPE9|AT131_MOUSE Manganese-transporting ATPase 13A1 OS=Mus musculus GN=Atp13a1 PE=1 SV=2 1157 1344 2.0E-09
sp|P19156|ATP4A_PIG Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 964 1287 2.0E-09
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 873 1056 3.0E-09
sp|P27112|ATP4A_RABIT Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 964 1287 3.0E-09
sp|P50996|ATP4A_CANLF Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 964 1287 3.0E-09
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 886 1286 3.0E-09
sp|Q64518|AT2A3_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus GN=Atp2a3 PE=1 SV=3 1100 1280 3.0E-09
sp|P20648|ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 964 1287 3.0E-09
sp|P09626|ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 964 1287 3.0E-09
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 1018 1250 3.0E-09
sp|P22036|ATMB_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 424 757 3.0E-09
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 905 1216 4.0E-09
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 1075 1266 4.0E-09
sp|P18596|AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus GN=Atp2a3 PE=1 SV=2 1100 1280 4.0E-09
sp|Q9YGL9|AT2A3_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus GN=ATP2A3 PE=2 SV=1 1105 1280 4.0E-09
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 535 754 6.0E-09
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 886 1286 6.0E-09
sp|O23087|ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 1107 1355 6.0E-09
sp|Q93084|AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 1100 1280 7.0E-09
sp|P35316|ATC_ARTSF Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana PE=2 SV=1 1103 1250 7.0E-09
sp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1 698 1019 9.0E-09
sp|P70083|AT2A1_MAKNI Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Makaira nigricans GN=atp2a1 PE=2 SV=2 422 1019 9.0E-09
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 535 754 1.0E-08
sp|Q9XES1|ECA4_ARATH Calcium-transporting ATPase 4, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA4 PE=2 SV=2 1108 1260 1.0E-08
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 1116 1340 2.0E-08
sp|Q292Q0|ATC1_DROPS Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura GN=Ca-P60A PE=3 SV=2 1103 1250 2.0E-08
sp|P35316|ATC_ARTSF Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana PE=2 SV=1 424 753 2.0E-08
sp|P92939|ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 1108 1304 2.0E-08
sp|Q42883|ECAP_SOLLC Calcium-transporting ATPase, endoplasmic reticulum-type OS=Solanum lycopersicum GN=LCA1 PE=2 SV=1 1107 1302 2.0E-08
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 1097 1236 2.0E-08
sp|P90747|AT131_CAEEL Probable manganese-transporting ATPase catp-8 OS=Caenorhabditis elegans GN=catp-8 PE=3 SV=3 1156 1344 3.0E-08
sp|P22700|ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster GN=Ca-P60A PE=1 SV=2 424 1012 3.0E-08
sp|P22700|ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster GN=Ca-P60A PE=1 SV=2 1103 1250 3.0E-08
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 905 1229 4.0E-08
sp|Q64566|AT2C1_RAT Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus GN=Atp2c1 PE=2 SV=1 419 812 5.0E-08
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 905 1234 5.0E-08
sp|Q7PPA5|ATC1_ANOGA Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae GN=Ca-P60A PE=3 SV=5 1105 1250 6.0E-08
sp|P13587|ATN1_YEAST Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 424 748 7.0E-08
sp|Q43128|PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 905 1200 7.0E-08
sp|P20647|AT2A2_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Oryctolagus cuniculus GN=ATP2A2 PE=2 SV=2 1104 1256 8.0E-08
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 905 1200 8.0E-08
sp|P09626|ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 518 753 9.0E-08
sp|Q01896|ATN2_YEAST Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 424 748 9.0E-08
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 424 748 9.0E-08
sp|P16615|AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 1104 1256 1.0E-07
sp|P27112|ATP4A_RABIT Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 518 753 1.0E-07
sp|O55143|AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus GN=Atp2a2 PE=1 SV=2 1104 1256 2.0E-07
sp|P11607|AT2A2_PIG Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa GN=ATP2A2 PE=1 SV=1 1104 1256 2.0E-07
sp|O46674|AT2A2_CANLF Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Canis lupus familiaris GN=ATP2A2 PE=2 SV=1 1104 1256 2.0E-07
sp|P11507|AT2A2_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus GN=Atp2a2 PE=1 SV=1 1104 1256 2.0E-07
sp|Q00779|AT2A2_FELCA Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Felis catus GN=ATP2A2 PE=2 SV=1 1104 1256 2.0E-07
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 905 1200 2.0E-07
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 905 1200 2.0E-07
sp|P50996|ATP4A_CANLF Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 518 753 2.0E-07
sp|P78036|ATCL_MYCPN Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 518 754 2.0E-07
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 952 1210 2.0E-07
sp|P23980|PMA2_SOLLC Plasma membrane ATPase 2 (Fragment) OS=Solanum lycopersicum GN=LHA2 PE=3 SV=1 905 1200 2.0E-07
sp|P9WPS9|CTPF_MYCTU Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpF PE=1 SV=1 1108 1182 3.0E-07
sp|P9WPS8|CTPF_MYCTO Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpF PE=2 SV=1 1108 1182 3.0E-07
sp|P63688|CTPF_MYCBO Probable cation-transporting ATPase F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpF PE=3 SV=1 1108 1182 3.0E-07
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 1107 1250 3.0E-07
sp|Q8R429|AT2A1_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus GN=Atp2a1 PE=1 SV=1 1095 1256 3.0E-07
sp|Q0VCY0|AT2A1_BOVIN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Bos taurus GN=ATP2A1 PE=1 SV=1 1095 1256 3.0E-07
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 1099 1234 3.0E-07
sp|P19156|ATP4A_PIG Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 518 753 3.0E-07
sp|P70083|AT2A1_MAKNI Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Makaira nigricans GN=atp2a1 PE=2 SV=2 1109 1354 3.0E-07
sp|Q07421|PMA1_AJECA Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 422 753 3.0E-07
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 1099 1234 4.0E-07
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 905 1200 5.0E-07
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 905 1234 6.0E-07
sp|Q92105|AT2A1_PELES Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Pelophylax esculentus GN=ATP2A1 PE=2 SV=1 1105 1256 6.0E-07
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 1094 1200 6.0E-07
sp|P20648|ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 518 753 6.0E-07
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 1099 1234 7.0E-07
sp|P13585|AT2A1_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Gallus gallus GN=ATP2A1 PE=2 SV=2 1109 1256 7.0E-07
sp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1 1081 1252 7.0E-07
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 1106 1200 8.0E-07
sp|P47317|ATCL_MYCGE Probable cation-transporting P-type ATPase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pacL PE=3 SV=1 877 1021 9.0E-07
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 423 744 1.0E-06
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 462 753 1.0E-06
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 415 815 1.0E-06
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 873 1161 1.0E-06
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 1099 1244 2.0E-06
sp|P30714|AT1A1_RHIMB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rhinella marina GN=ATP1A1 PE=1 SV=2 517 753 2.0E-06
sp|P22036|ATMB_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 1105 1206 2.0E-06
sp|P9WPT0|CTPE_MYCTO Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 1109 1182 2.0E-06
sp|P9WPT1|CTPE_MYCTU Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 1109 1182 2.0E-06
sp|P0A505|CTPE_MYCBO Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 1109 1182 2.0E-06
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 1042 1201 2.0E-06
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 453 754 3.0E-06
sp|P78036|ATCL_MYCPN Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 1103 1213 3.0E-06
sp|P47317|ATCL_MYCGE Probable cation-transporting P-type ATPase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pacL PE=3 SV=1 498 754 3.0E-06
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 858 1019 3.0E-06
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 1109 1200 4.0E-06
sp|P19657|PMA2_YEAST Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 1109 1200 4.0E-06
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 517 753 5.0E-06
sp|P0ABB8|ATMA_ECOLI Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) GN=mgtA PE=1 SV=1 1072 1206 5.0E-06
sp|P0ABB9|ATMA_ECO57 Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli O157:H7 GN=mgtA PE=3 SV=1 1072 1206 5.0E-06
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 1099 1162 5.0E-06
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 733 1019 5.0E-06
sp|P36640|ATMA_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 1105 1206 6.0E-06
sp|D0ZTB2|ATMA_SALT1 Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 1105 1206 6.0E-06
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 1109 1182 7.0E-06
sp|Q9LY32|PMA7_ARATH ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 1109 1200 8.0E-06
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 1081 1252 8.0E-06
sp|Q93084|AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 437 753 8.0E-06
sp|Q64541|AT1A4_RAT Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 517 753 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006812 cation transport Yes
GO:0140358 P-type transmembrane transporter activity Yes
GO:0019829 ATPase-coupled cation transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0140657 ATP-dependent activity No
GO:0022857 transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022853 active ion transmembrane transporter activity No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0008324 cation transmembrane transporter activity No
GO:0051179 localization No
GO:0006810 transport No
GO:0006811 ion transport No
GO:0051234 establishment of localization No
GO:0015399 primary active transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0015075 ion transmembrane transporter activity No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

Domain # Start End Length
1 478 497 19
2 656 678 22
3 693 715 22
4 1194 1216 22
5 1220 1242 22
6 1259 1281 22
7 1311 1333 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|047030
MSPVAGPSTNSPYDYTEGASAIDINEAMSNRKLSRRDSQYSSYFDAEGEGAVFSGPGHTVNPSSVSRMSNLELGR
RSSDNWSRTRRQSHDSSSRHRLNRRSSGDSRISWQSAGRSENQEDEDAFLRSDDEGSELGQDRKPRKRVSSPQRQ
SVIWKSSTFDLTKVFEHVLVTDEGEERWGYSSSEEEESDPEPPDVVPDSASIAPSMQYDSEPSTPPRPSHGLPLL
TMESVFDGEARIDIDVATTLLNAPPPGPPSRQTLYIADEDSTICFIGYEVIRWRAWLWKLSCVISLGILSLLGHW
FPRLWLRWVAREKAFVESANGFVVVESAYRNITLQPIHILDYRHHISTVFPPDVTSGQHNESYRSSLERKMDEHL
DSQGGFLKKLLVVDYRYTRYALDPRTGLFAMVKDWRDPAWTGVAVVHGGVSGDIAKQRIVIFGKNEIDVEGKSIS
ALLFDEIIHPFYIFQIASIFLWSLDDYYYYAFCIALISCASIASTLVETRKTINRMREMSRYTCKLVVLRNDEWI
ELDSSGLVPGDVVNLSDSECSMIPADLFLLTGDAIINESMLTGESVPVSKIPMKDEDVSQWGKEKTENPKCFLYG
GTKIVRIRGYAHDESGKPATALVARTGFNTTKGALVRSMLFPKPIGFKFYRDSIRFIGVLAGIAGIGFCFSAIQF
VRIGVPFHTIVVRALDLVTVVVPPALPATLAIGTSFAITRLRKTGIYCTAPSRVNVAGKINVCCFDKTGTLTEDG
LDVLGVRGLDRNMQMFGELLEDVYDLPLGNSKASLLHALATCHSLKLVDDEVIGDPLDAKMFEFTKWTLEEGRVS
GTGVIKSKGMVIEQAALVQTVVRPPGSAQFRLEDALKGAARHAHFLELGVIRTFEFVSSLRRMSVIVKRLKSSSM
EIYVKGAPEVMADICEKESFPQDYDDLLSYYTRRGYRVIAMAGKSVEGLSWLKAQRMKREQAESKLRFLGLIIFE
NRLKPATASTIQQLRTAHLACRMITGDNPLTAVSVARECSLINQAVHVFAPTFRRGNVSTPSSKIEWTSMDDPLW
KLDAYSLKPLTPAPHHMVESDEIGYHDYSLVVSGDIFRWMINYAPLETLQRMLVKTQIFARMSPDEKNEIVERLQ
NLGYTVLMCGDGANDCAALKAADVGISLSEAEASVAAPFTTTTADIGCVVEVIKEGRAALVTSFSCFKYMALYSL
IQFTSVTLLYSFASSLGDFQFLYIDLFIIIPIAVTMGRTLPFPQIHPKRPTASLVSKRVLASIIGQIILTSGFQL
WGFLWVKTQSWYTPPPANDPTSDGNHLESTNYENTVLFLISCFQYILVAAVFSIGPPYRKSMWTNAWLITAKTSS
RVAHASDASHVGKSNNFSGRIWQCSSVINFRAMGISDGRRYDRDGDALVATRAKANAGRKGI*
Coding >Agabi119p4|047030
ATGTCGCCTGTTGCAGGTCCAAGTACTAATTCCCCATACGACTATACCGAGGGTGCATCTGCGATCGACATCAAT
GAAGCTATGTCCAACAGAAAACTTTCACGGCGGGATTCTCAATACAGTTCTTACTTCGACGCTGAGGGAGAAGGT
GCTGTTTTTTCTGGCCCCGGCCATACAGTCAATCCAAGCAGTGTCTCACGTATGTCGAATCTGGAGCTGGGGAGG
AGAAGTAGTGATAATTGGTCGCGTACCCGGAGGCAAAGTCACGATTCTTCATCTCGGCATCGGTTGAATAGACGG
TCGAGCGGGGATAGTCGTATTTCATGGCAGTCAGCAGGCCGGAGCGAGAACCAAGAGGACGAGGACGCCTTCCTT
CGGAGCGACGATGAGGGAAGTGAACTTGGTCAGGATAGAAAGCCGAGAAAACGGGTTTCTTCTCCACAAAGACAA
TCCGTAATCTGGAAATCGTCGACTTTCGATCTCACAAAGGTCTTCGAGCATGTACTGGTCACGGACGAGGGAGAA
GAGCGCTGGGGATATTCTTCCTCAGAAGAAGAAGAATCTGACCCGGAGCCTCCGGACGTCGTCCCCGACAGTGCC
TCTATAGCACCGAGTATGCAATATGACTCGGAACCTTCAACCCCTCCACGACCAAGTCACGGTTTACCTCTCCTT
ACCATGGAATCTGTCTTCGATGGAGAAGCTCGCATCGATATCGACGTCGCGACCACACTTCTCAACGCTCCACCC
CCCGGTCCACCGAGCCGACAAACATTGTATATTGCAGATGAAGACAGTACAATTTGTTTTATTGGTTACGAAGTT
ATCCGGTGGCGTGCATGGCTGTGGAAGCTCAGTTGCGTTATCTCCCTTGGTATCTTATCATTGCTTGGCCACTGG
TTTCCTCGCTTGTGGTTACGTTGGGTTGCTCGTGAAAAAGCTTTTGTTGAATCGGCCAATGGGTTTGTTGTTGTC
GAGTCGGCATATAGAAATATCACTTTACAACCCATTCACATTTTGGACTATCGTCATCACATTTCTACCGTATTT
CCTCCCGACGTGACCAGCGGCCAACATAACGAGTCGTACCGATCGAGTCTGGAACGAAAGATGGATGAACACTTG
GATTCGCAGGGCGGTTTCTTGAAGAAACTTTTGGTGGTGGACTATCGTTATACTCGATATGCGCTTGATCCTAGG
ACTGGTTTGTTTGCTATGGTAAAAGACTGGCGCGATCCCGCTTGGACTGGTGTCGCTGTTGTTCACGGCGGTGTA
TCAGGGGACATCGCGAAGCAACGCATCGTTATCTTTGGAAAGAATGAAATCGATGTCGAAGGAAAATCTATATCG
GCATTATTATTCGACGAAATCATTCACCCATTCTATATTTTTCAAATTGCTAGCATCTTTCTTTGGTCTCTGGAT
GATTACTACTATTATGCTTTCTGTATTGCTCTTATCTCATGCGCGAGTATCGCCTCGACACTTGTGGAGACCCGC
AAGACAATCAATCGTATGCGTGAAATGTCTCGTTATACCTGTAAATTGGTTGTGCTTCGAAATGATGAATGGATT
GAACTCGACTCCTCGGGACTGGTACCTGGAGATGTGGTGAATCTGTCGGATTCCGAATGTTCAATGATACCAGCT
GATCTTTTCCTCCTCACTGGGGATGCTATCATCAATGAGAGTATGTTGACCGGTGAAAGTGTGCCTGTTAGTAAA
ATTCCCATGAAAGATGAAGATGTCAGCCAATGGGGGAAAGAGAAAACGGAAAACCCGAAGTGCTTCTTGTATGGA
GGCACGAAAATAGTCAGGATTCGAGGATACGCTCATGATGAATCAGGAAAACCTGCGACTGCACTGGTGGCTAGA
ACAGGGTTCAATACCACCAAAGGAGCGCTTGTACGATCTATGCTTTTCCCCAAGCCTATTGGCTTCAAATTCTAT
CGCGATTCCATTCGCTTCATTGGTGTCCTGGCGGGCATTGCTGGCATTGGCTTCTGTTTCAGTGCAATTCAATTC
GTAAGGATTGGGGTACCATTTCACACCATAGTTGTCCGCGCTCTGGATCTCGTCACCGTGGTCGTGCCTCCAGCT
TTGCCCGCCACTCTTGCCATCGGAACTAGTTTCGCTATCACTCGCCTTCGCAAAACAGGCATCTATTGTACTGCA
CCCAGCCGGGTTAATGTCGCCGGAAAAATCAACGTATGTTGCTTCGATAAAACAGGGACTTTGACCGAAGATGGC
CTAGACGTTCTCGGCGTGCGAGGCCTTGATCGCAATATGCAAATGTTTGGCGAGTTACTCGAAGACGTTTACGAT
CTTCCCCTTGGCAACAGTAAAGCATCTTTACTGCATGCCCTTGCGACCTGTCATTCTTTAAAACTCGTTGATGAC
GAAGTTATCGGTGATCCGCTAGACGCGAAAATGTTTGAGTTTACGAAGTGGACGCTGGAAGAGGGGCGCGTATCT
GGAACTGGGGTGATCAAGTCGAAAGGGATGGTGATTGAGCAAGCTGCTCTCGTGCAAACTGTTGTGAGGCCGCCT
GGATCGGCTCAGTTCCGATTGGAGGATGCACTTAAAGGTGCTGCCAGACATGCTCACTTCTTAGAATTGGGTGTT
ATCAGGACATTTGAATTCGTTTCCTCATTACGGAGGATGAGCGTAATCGTAAAAAGGCTGAAAAGTTCTAGTATG
GAAATCTACGTGAAAGGTGCACCAGAAGTCATGGCTGATATTTGCGAAAAGGAATCTTTTCCTCAAGACTACGAC
GATCTCTTGTCGTACTATACAAGGCGTGGATATCGTGTTATCGCGATGGCCGGCAAAAGTGTTGAAGGTTTATCG
TGGTTAAAGGCGCAGCGTATGAAACGTGAACAAGCGGAATCTAAGCTGCGTTTCCTGGGCCTGATCATCTTTGAG
AACAGACTGAAGCCAGCAACCGCATCAACCATCCAACAGCTACGAACAGCCCATCTCGCATGTCGGATGATCACT
GGCGATAATCCATTGACGGCTGTGAGTGTTGCTCGGGAGTGTTCATTGATCAATCAGGCTGTGCATGTTTTTGCA
CCAACGTTCAGGAGAGGCAATGTTTCTACTCCTTCATCCAAGATAGAATGGACCTCCATGGATGACCCGCTCTGG
AAACTCGACGCGTACAGCCTTAAGCCTCTGACACCGGCCCCTCATCATATGGTTGAATCCGATGAGATTGGTTAC
CACGATTACTCTCTTGTTGTGAGTGGGGATATATTCCGCTGGATGATCAACTATGCCCCTCTGGAAACGCTGCAG
CGTATGCTCGTAAAAACTCAAATCTTTGCTCGGATGTCACCTGATGAAAAAAATGAAATTGTCGAGAGACTGCAA
AATCTGGGTTATACGGTGCTTATGTGTGGTGATGGGGCTAACGATTGTGCAGCTCTCAAAGCTGCCGATGTTGGG
ATCTCGCTTTCGGAGGCCGAAGCTAGTGTTGCGGCTCCATTCACAACCACGACAGCTGATATTGGATGTGTAGTA
GAGGTTATCAAGGAAGGACGTGCCGCGCTCGTCACGAGTTTTAGTTGCTTCAAATACATGGCATTGTATTCCTTG
ATTCAGTTTACCTCTGTAACCCTTTTATATTCATTTGCTTCTTCACTGGGGGACTTTCAGTTCCTTTATATCGAT
CTTTTCATCATTATCCCAATTGCCGTCACCATGGGCCGGACATTACCGTTTCCGCAAATCCATCCGAAGCGTCCG
ACAGCAAGTTTGGTATCGAAAAGGGTGCTTGCAAGCATTATAGGACAAATCATACTTACAAGCGGCTTTCAACTG
TGGGGTTTCCTTTGGGTGAAGACGCAATCATGGTATACGCCTCCTCCTGCAAATGATCCTACCTCGGATGGCAAC
CATCTTGAATCTACGAACTATGAAAATACGGTTTTATTCCTGATCTCTTGTTTCCAATATATCTTGGTGGCGGCC
GTATTTAGCATCGGCCCACCGTATCGTAAGTCCATGTGGACAAATGCCTGGCTAATCACCGCCAAAACCTCTTCA
AGAGTTGCTCACGCTTCAGATGCTTCCCATGTCGGCAAGAGTAACAATTTTAGTGGTCGTATTTGGCAATGTAGC
AGCGTCATTAATTTTCGAGCAATGGGGATCTCAGACGGTAGGCGGTATGATAGGGACGGTGATGCGCTGGTGGCA
ACGAGGGCGAAGGCGAATGCTGGGAGGAAAGGTATATAA
Transcript >Agabi119p4|047030
ATGTCGCCTGTTGCAGGTCCAAGTACTAATTCCCCATACGACTATACCGAGGGTGCATCTGCGATCGACATCAAT
GAAGCTATGTCCAACAGAAAACTTTCACGGCGGGATTCTCAATACAGTTCTTACTTCGACGCTGAGGGAGAAGGT
GCTGTTTTTTCTGGCCCCGGCCATACAGTCAATCCAAGCAGTGTCTCACGTATGTCGAATCTGGAGCTGGGGAGG
AGAAGTAGTGATAATTGGTCGCGTACCCGGAGGCAAAGTCACGATTCTTCATCTCGGCATCGGTTGAATAGACGG
TCGAGCGGGGATAGTCGTATTTCATGGCAGTCAGCAGGCCGGAGCGAGAACCAAGAGGACGAGGACGCCTTCCTT
CGGAGCGACGATGAGGGAAGTGAACTTGGTCAGGATAGAAAGCCGAGAAAACGGGTTTCTTCTCCACAAAGACAA
TCCGTAATCTGGAAATCGTCGACTTTCGATCTCACAAAGGTCTTCGAGCATGTACTGGTCACGGACGAGGGAGAA
GAGCGCTGGGGATATTCTTCCTCAGAAGAAGAAGAATCTGACCCGGAGCCTCCGGACGTCGTCCCCGACAGTGCC
TCTATAGCACCGAGTATGCAATATGACTCGGAACCTTCAACCCCTCCACGACCAAGTCACGGTTTACCTCTCCTT
ACCATGGAATCTGTCTTCGATGGAGAAGCTCGCATCGATATCGACGTCGCGACCACACTTCTCAACGCTCCACCC
CCCGGTCCACCGAGCCGACAAACATTGTATATTGCAGATGAAGACAGTACAATTTGTTTTATTGGTTACGAAGTT
ATCCGGTGGCGTGCATGGCTGTGGAAGCTCAGTTGCGTTATCTCCCTTGGTATCTTATCATTGCTTGGCCACTGG
TTTCCTCGCTTGTGGTTACGTTGGGTTGCTCGTGAAAAAGCTTTTGTTGAATCGGCCAATGGGTTTGTTGTTGTC
GAGTCGGCATATAGAAATATCACTTTACAACCCATTCACATTTTGGACTATCGTCATCACATTTCTACCGTATTT
CCTCCCGACGTGACCAGCGGCCAACATAACGAGTCGTACCGATCGAGTCTGGAACGAAAGATGGATGAACACTTG
GATTCGCAGGGCGGTTTCTTGAAGAAACTTTTGGTGGTGGACTATCGTTATACTCGATATGCGCTTGATCCTAGG
ACTGGTTTGTTTGCTATGGTAAAAGACTGGCGCGATCCCGCTTGGACTGGTGTCGCTGTTGTTCACGGCGGTGTA
TCAGGGGACATCGCGAAGCAACGCATCGTTATCTTTGGAAAGAATGAAATCGATGTCGAAGGAAAATCTATATCG
GCATTATTATTCGACGAAATCATTCACCCATTCTATATTTTTCAAATTGCTAGCATCTTTCTTTGGTCTCTGGAT
GATTACTACTATTATGCTTTCTGTATTGCTCTTATCTCATGCGCGAGTATCGCCTCGACACTTGTGGAGACCCGC
AAGACAATCAATCGTATGCGTGAAATGTCTCGTTATACCTGTAAATTGGTTGTGCTTCGAAATGATGAATGGATT
GAACTCGACTCCTCGGGACTGGTACCTGGAGATGTGGTGAATCTGTCGGATTCCGAATGTTCAATGATACCAGCT
GATCTTTTCCTCCTCACTGGGGATGCTATCATCAATGAGAGTATGTTGACCGGTGAAAGTGTGCCTGTTAGTAAA
ATTCCCATGAAAGATGAAGATGTCAGCCAATGGGGGAAAGAGAAAACGGAAAACCCGAAGTGCTTCTTGTATGGA
GGCACGAAAATAGTCAGGATTCGAGGATACGCTCATGATGAATCAGGAAAACCTGCGACTGCACTGGTGGCTAGA
ACAGGGTTCAATACCACCAAAGGAGCGCTTGTACGATCTATGCTTTTCCCCAAGCCTATTGGCTTCAAATTCTAT
CGCGATTCCATTCGCTTCATTGGTGTCCTGGCGGGCATTGCTGGCATTGGCTTCTGTTTCAGTGCAATTCAATTC
GTAAGGATTGGGGTACCATTTCACACCATAGTTGTCCGCGCTCTGGATCTCGTCACCGTGGTCGTGCCTCCAGCT
TTGCCCGCCACTCTTGCCATCGGAACTAGTTTCGCTATCACTCGCCTTCGCAAAACAGGCATCTATTGTACTGCA
CCCAGCCGGGTTAATGTCGCCGGAAAAATCAACGTATGTTGCTTCGATAAAACAGGGACTTTGACCGAAGATGGC
CTAGACGTTCTCGGCGTGCGAGGCCTTGATCGCAATATGCAAATGTTTGGCGAGTTACTCGAAGACGTTTACGAT
CTTCCCCTTGGCAACAGTAAAGCATCTTTACTGCATGCCCTTGCGACCTGTCATTCTTTAAAACTCGTTGATGAC
GAAGTTATCGGTGATCCGCTAGACGCGAAAATGTTTGAGTTTACGAAGTGGACGCTGGAAGAGGGGCGCGTATCT
GGAACTGGGGTGATCAAGTCGAAAGGGATGGTGATTGAGCAAGCTGCTCTCGTGCAAACTGTTGTGAGGCCGCCT
GGATCGGCTCAGTTCCGATTGGAGGATGCACTTAAAGGTGCTGCCAGACATGCTCACTTCTTAGAATTGGGTGTT
ATCAGGACATTTGAATTCGTTTCCTCATTACGGAGGATGAGCGTAATCGTAAAAAGGCTGAAAAGTTCTAGTATG
GAAATCTACGTGAAAGGTGCACCAGAAGTCATGGCTGATATTTGCGAAAAGGAATCTTTTCCTCAAGACTACGAC
GATCTCTTGTCGTACTATACAAGGCGTGGATATCGTGTTATCGCGATGGCCGGCAAAAGTGTTGAAGGTTTATCG
TGGTTAAAGGCGCAGCGTATGAAACGTGAACAAGCGGAATCTAAGCTGCGTTTCCTGGGCCTGATCATCTTTGAG
AACAGACTGAAGCCAGCAACCGCATCAACCATCCAACAGCTACGAACAGCCCATCTCGCATGTCGGATGATCACT
GGCGATAATCCATTGACGGCTGTGAGTGTTGCTCGGGAGTGTTCATTGATCAATCAGGCTGTGCATGTTTTTGCA
CCAACGTTCAGGAGAGGCAATGTTTCTACTCCTTCATCCAAGATAGAATGGACCTCCATGGATGACCCGCTCTGG
AAACTCGACGCGTACAGCCTTAAGCCTCTGACACCGGCCCCTCATCATATGGTTGAATCCGATGAGATTGGTTAC
CACGATTACTCTCTTGTTGTGAGTGGGGATATATTCCGCTGGATGATCAACTATGCCCCTCTGGAAACGCTGCAG
CGTATGCTCGTAAAAACTCAAATCTTTGCTCGGATGTCACCTGATGAAAAAAATGAAATTGTCGAGAGACTGCAA
AATCTGGGTTATACGGTGCTTATGTGTGGTGATGGGGCTAACGATTGTGCAGCTCTCAAAGCTGCCGATGTTGGG
ATCTCGCTTTCGGAGGCCGAAGCTAGTGTTGCGGCTCCATTCACAACCACGACAGCTGATATTGGATGTGTAGTA
GAGGTTATCAAGGAAGGACGTGCCGCGCTCGTCACGAGTTTTAGTTGCTTCAAATACATGGCATTGTATTCCTTG
ATTCAGTTTACCTCTGTAACCCTTTTATATTCATTTGCTTCTTCACTGGGGGACTTTCAGTTCCTTTATATCGAT
CTTTTCATCATTATCCCAATTGCCGTCACCATGGGCCGGACATTACCGTTTCCGCAAATCCATCCGAAGCGTCCG
ACAGCAAGTTTGGTATCGAAAAGGGTGCTTGCAAGCATTATAGGACAAATCATACTTACAAGCGGCTTTCAACTG
TGGGGTTTCCTTTGGGTGAAGACGCAATCATGGTATACGCCTCCTCCTGCAAATGATCCTACCTCGGATGGCAAC
CATCTTGAATCTACGAACTATGAAAATACGGTTTTATTCCTGATCTCTTGTTTCCAATATATCTTGGTGGCGGCC
GTATTTAGCATCGGCCCACCGTATCGTAAGTCCATGTGGACAAATGCCTGGCTAATCACCGCCAAAACCTCTTCA
AGAGTTGCTCACGCTTCAGATGCTTCCCATGTCGGCAAGAGTAACAATTTTAGTGGTCGTATTTGGCAATGTAGC
AGCGTCATTAATTTTCGAGCAATGGGGATCTCAGACGGTAGGCGGTATGATAGGGACGGTGATGCGCTGGTGGCA
ACGAGGGCGAAGGCGAATGCTGGGAGGAAAGGTATATAA
Gene >Agabi119p4|047030
ATGTCGCCTGTTGCAGGTCCAAGTACTAATTCCCCATACGACTATACCGAGGGTGCATCTGCGATCGACATCAAT
GAAGCTATGTCCAACAGAAAACTTTCACGGCGGGATTCTCAATACAGTTCTTACTTCGACGCTGAGGGAGAAGGT
GCTGTTTTTTCTGGCCCCGGCCATACAGTCAATCCAAGCAGTGTCTCACGTATGTCGAATCTGGAGCTGGGGAGG
AGAAGTAGTGATAATTGGTCGCGTACCCGGAGGCAAAGTCACGATTCTTCATCTCGGCATCGGTTGAATAGACGG
TCGAGCGGGGATAGTCGTATTTCATGGCAGTCAGCAGGCCGGAGCGAGAACCAAGAGGACGAGGACGCCTTCCTT
CGGAGCGACGATGAGGGAAGTGAACTTGGTCAGGATAGAAAGCCGAGAAAACGGGTTTCTTCTCCACAAAGACAA
TCCGTGTTTGAAAACTTTACAAACTTATTCAGTCGTTCGACTACTGCTGAAGAATCTGGAAATCGTCGACTTTCG
ATCTCACAAAGGTCTTCGGCAAGTTTACACTCACGCGGTAGCCGTCGAAGCCGCCGTACTAATGGTGCTTCAGAG
CATGTACTGGTCACGGACGAGGGAGAAGAGCGCTGGGGATATTCTTCCTCAGAAGAAGAAGAATCTGACCCGGAG
CCTCCGGACGTCGTCCCCGACAGTGCCTCTATAGCACCGAGTATGCAATATGACTCGGAACCTTCAACCCCTCCA
CGACCAAGTCACGGTTTACCTCTCCTTACCATGGAATCTGTCTTCGATGGAGAAGCTCGCATCGATATCGACGTC
GCGACCACACTTCTCAACGCTCCACCCCCCGGTCCACCGAGCCGACAAACATTGTATATTGCAGATGAAGACAGT
ACAATTTGTTTTATTGGTTACGAAGTTATCCGGTGGCGTGCATGGCTGTGGAAGCTCAGTTGCGTTATCTCCCTT
GGTATCTTATCATTGCTTGGCCACTGGTTTCCTCGCTTGTGGTTACGTTGGGTTGCTCGTGAAAAAGCTTTTGTT
GAATCGGCCAATGGGTTTGTTGTTGTCGAGGTGCGTATGTCGAAATTTGATTGTTTGCCTGTCAGGTCACTCATA
TAAAGGAAGTCGGCATATAGAAATATCACTTTACAACCCATTCACATTTTGGACTATCGTCATCACATTTCTACC
GTATTTCCTCCCGACGTGACCAGCGGCCAACATAACGAGTCGTACCGATCGAGTCTGGAACGAAAGATGGATGAA
CACTTGGATTCGCAGGGCGGTTTCTTGAAGAAACTTTTGGTGGTGGACTATCGTTATACTCGATATGCGCTTGAT
CCTAGGACTGGTTTGTTTGCTATGGTAAAGTAAGGTTTTCGACCCTCGTGCCTTGCTAATTTACTGATATGTCGG
TACAAGAGACTGGCGCGATCCCGCTTGGACTGGTGTCGCTGTTGTTCACGGCGGTGTATCAGGGGACATCGCGAA
GCAACGCATCGTTATCTTTGGAAAGAATGAAATCGATGTCGAAGGAAAATCTATATCGGCATTATTATTCGACGA
AGTTTGTATTTTCAGATCACTCGTGGTTTGCATCCTCATCTCCTTCGTAGATCATTCACCCATTCTATATTTTTC
AAATTGCTAGCATCTTTCTTTGGTCTCTGGATGATTACTACTATTATGCTTTCTGTATTGCTCTTATCTCATGCG
CGAGTATCGCCTCGACACTTGTGGAGACCCGCAAGGCAAGTGAACTTTCTTCTTCAGCAGGATCGGCCTAATTTT
TTCTTGTTTTAGACAATCAATCGTATGCGTGAAATGTCTCGTTATACCTGTAAATTGGTTGTGCTTCGAAATGAT
GAATGTACGTGGTATGCACCGGTCAATATTCAGCGGGTAATAATGATGGTTTACAGGGATTGAACTCGACTCCTC
GGGACTGGTACCTGGAGATGTGGTGAATCTGTCGGATTCCGAATGTTCAATGATACCAGCTGATCTTTTCCTCCT
CACTGGGGATGCTATCATCAATGAGAGTATGTTGACCGGTGAAAGTGTGCCTGTTAGTAAAATTCCCATGAAAGA
TGAAGATGTCAGCCAATGGGGGAAAGAGAAAACGGAAAACCCGAAGTGCTTCTTGTATGGAGGCACGAAAATAGT
CAGGATTCGAGGATACGCTCATGATGAATCAGGAAAACCTGCGACTGCACTGGTGGCTAGAACAGGTGTGTTTCT
TGTTCTGCGCAAAAAAATACGTTCTCAAAGTCTGCCAGGGTTCAATACCACCAAAGGAGCGCTTGTACGATCTAT
GCTTTTCCCCAAGCCTATTGGCTTCAAATTCTATCGCGATTCCATTCGCTTCATTGGTGTCCTGGCGGGCATTGC
TGGCATTGGCTTCTGTTTCAGTGCAATTCAATTCGTAAGGATTGGGGTAAGCTTTTCAATAGACACGTCCTACAT
GATGTTGATACGTCCCCTAGGTACCATTTCACACCATAGTTGTCCGCGCTCTGGATCTCGTCACCGTGGTCGTGC
CTCCAGCTTTGCCCGCCACTCTTGCCATCGGAACTAGTTTCGCTATCACTCGCCTTCGCAAAACAGGCATCTATT
GTACTGCACCCAGCCGGGTTAATGTCGCCGGAAAAATCAACGTATGTTGCTTCGATAAAACAGGGACTTTGACCG
AAGATGGCCTAGACGTTCTCGGCGTGCGAGGCCTTGATCGCAATATGCAAATGTTTGGCGAGTTACTCGAAGACG
TTTACGATCTTCCCCTTGGCAACAGTAAAGCATCTTTACTGCATGCCCTTGCGACCTGTCATTCTTTAAAACTCG
TTGATGACGAAGTTATCGGTGATCCGCTAGACGCGAAAATGTTTGAGTTTACGAAGTGGACGCTGGAAGAGGGGC
GCGTATCTGGAACTGGGGTGATCAAGTCGAAAGGGATGGTGATTGAGCAAGCTGCTCTCGTGCAAACTGTTGTGA
GGCCGCCTGGATCGGCTCAGTTCCGATTGGAGGATGCACTTAAAGGTGCTGCCAGAGTTCGTATTTCCATCAAAT
TTTAGGTGTTAAATGACTTATGCCTACGATGTTAGCATGCTCACTTCTTAGAATTGGGTGTTATCAGGACATTTG
AATTCGTTTCCTCATTACGGAGGATGAGCGTAATCGTAAAAAGGCTGAAAAGTTCTAGTATGGAAATCTACGTGA
AAGGTGCACCAGAAGTCATGGCTGATATTTGCGAAAAGGAATCTTGTACGGTTTCATGGGCTCCCACTTCTACCA
TCTGACCCACCAATCGCCATTTAGTTCCTCAAGACTACGACGATCTCTTGTCGTACTATACAAGGCGTGGATATC
GTGTTATCGCGATGGCCGGCAAAAGTGTTGAAGGTTTATCGTGGTTAAAGGCGCAGCGTATGAAACGGTGGGTCT
TCCCAAAAGGCTTTCGAGAGGCGAAATTGATGGTTCCTTATTGGAAGTGAACAAGCGGAATCTAAGCTGCGTTTC
CTGGGCCTGATCATCTTTGAGAACAGACTGAAGCCAGCAACCGCATCAACCATCCAACAGCTACGAACAGCCCAT
CTCGCATGTCGGATGATCACTGGCGATAATCCATTGACGGCTGTGAGTGTTGCTCGGGAGTGTTCATTGATCAAT
CAGGCTGTGCATGTTTTTGCACCAACGTTCAGGAGAGGTATGTTCATTTGCACGAAATACGAACTTTCGTCTCAC
TGTTTCATAGGCAATGTTTCTACTCCTTCATCCAAGATAGAATGGACCTCCATGGATGACCCGCTCTGGAAACTC
GACGCGTACAGCCTTAAGCCTCTGACACCGGCCCCTCATCATATGGTTGAATCCGATGAGATTGGTTACCACGAT
TACTCTCTTGTTGTGAGTGGGGATATATTCCGCTGGATGATCAACTATGCCCCTCTGGAAACGCTGCAGCGTGTA
CGTATTGAGAACTGCAAAGGATAAAATATGTCAATCTCATTATTTTCAGATGCTCGTAAAAACTCAAATCTTTGC
TCGGATGTCACCTGATGAAAAAAATGAAATTGTCGAGAGACTGCAAAATCTGGGTTATACGGTGCTTATGTGTGG
TGATGGGGCTAACGATTGTGCAGCTCTCAAAGCTGCCGATGTTGGGATCTCGCTTTCGGAGGCCGAAGCTAGTGT
TGCGGCTCCATTCACAACCACGACAGCTGATATTGGATGTGTAGTAGAGGTTATCAAGGAAGGACGTGCCGCGCT
CGTCACGAGTTTTAGTTGCTTCAAATACATGTGAGTATCTCCGTACAAGACTGAACGAGCACTTGATTATCGTTC
TTCTAGGGCATTGTATTCCTTGATTCAGTTTACCTCTGTAACCCTTTTATATTCATTTGCTTCTTCACTGGGGGA
CTTTCAGGTATTTACCTTTTTGTTATGAAGATCTTCAAAGGTTGGCTGACGCGGTTATTATTTCATCAGTTCCTT
TATATCGATCTTTTCATCATTATCCCAATTGCCGTCACCAGTGAGTTAAATCATTTCAAAGTGATTTCAGACAAG
TCATACCATTGTTTCAGTGGGCCGGACATTACCGTTTCCGCAAATCCATCCGAAGCGTCCGACAGCAAGTTTGGT
ATCGAAAAGGGTGCTTGCAAGCATTATAGGACAAATCATACTTACAAGCGGCTTTCAACTGTGGGGTTTCCTTTG
GGTGAAGACGCAATCATGGTGATTAGATTTTATACTTCCAGCGGACAAGGGTTCAAGTTCTAACTGTGCAAAGGT
ATACGCCTCCTCCTGCAAATGATCCTACCTCGGATGGCAACCATCTTGAATCTACGAACTATGAAAATACGGTTT
TATTCCTGATCTCTTGTTTCCAATATATCTTGGTGGCGGCCGTATTTAGCATCGGCCCACCGTATCGTAAGTCCA
TGTGGACAAATGGTGCGTGAAGGTACAATGACAGTGTTGGAGTCTCTGACGAGTATTGAATAGCCTGGCTAATGT
ATGCAATGACAATCCTGTCGGGATTTAATGTACTGGTGCTGATAGCACCGCCAAAACCTCTTCAAGAGTTGCTCA
CGCTTCAGATGCTTCCCATGTCGGCAAGAGTAACAATTTTAGTGGTCGTATTTGGCAATGTAGCAGCGTCATTAA
TTTTCGAGCAATGGGGATCTCAGACGGTAGGCGGTATGATAGGGACGGTGATGCGCTGGTGGCAACGAGGGCGAA
GGCGAATGCTGGGAGGAAAGGTATATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail