Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|046850
Gene name
Locationscaffold_02:1919104..1920692
Strand-
Gene length (bp)1588
Transcript length (bp)879
Coding sequence length (bp)879
Protein length (aa) 293

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01226 Form_Nir_trans Formate/nitrite transporter 1.6E-74 12 258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P35839|FDHC_METFO Probable formate transporter OS=Methanobacterium formicicum GN=fdhC PE=3 SV=1 8 261 4.0E-47
sp|Q50568|FDHC_METTF Probable formate transporter OS=Methanothermobacter thermautotrophicus GN=fdhC PE=3 SV=1 8 263 9.0E-47
sp|O05399|YRHG_BACSU Uncharacterized transporter YrhG OS=Bacillus subtilis (strain 168) GN=yrhG PE=3 SV=1 8 254 3.0E-42
sp|P38750|YHA8_YEAST Uncharacterized transporter YHL008C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL008C PE=1 SV=1 1 251 1.0E-30
sp|P43756|FOCA_HAEIN Probable formate transporter OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=focA PE=3 SV=1 7 259 9.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P35839|FDHC_METFO Probable formate transporter OS=Methanobacterium formicicum GN=fdhC PE=3 SV=1 8 261 4.0E-47
sp|Q50568|FDHC_METTF Probable formate transporter OS=Methanothermobacter thermautotrophicus GN=fdhC PE=3 SV=1 8 263 9.0E-47
sp|O05399|YRHG_BACSU Uncharacterized transporter YrhG OS=Bacillus subtilis (strain 168) GN=yrhG PE=3 SV=1 8 254 3.0E-42
sp|P38750|YHA8_YEAST Uncharacterized transporter YHL008C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL008C PE=1 SV=1 1 251 1.0E-30
sp|P43756|FOCA_HAEIN Probable formate transporter OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=focA PE=3 SV=1 7 259 9.0E-28
sp|P0AC23|FOCA_ECOLI Probable formate transporter 1 OS=Escherichia coli (strain K12) GN=focA PE=1 SV=1 7 263 2.0E-24
sp|P0AC24|FOCA_ECOL6 Probable formate transporter 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=focA PE=3 SV=1 7 263 2.0E-24
sp|P0AC25|FOCA_ECO57 Probable formate transporter 1 OS=Escherichia coli O157:H7 GN=focA PE=1 SV=1 7 263 2.0E-24
sp|P77733|FOCB_ECOLI Probable formate transporter 2 OS=Escherichia coli (strain K12) GN=focB PE=3 SV=1 2 263 3.0E-21
sp|P39608|YWCJ_BACSU Uncharacterized transporter YwcJ OS=Bacillus subtilis (strain 168) GN=ywcJ PE=3 SV=1 1 250 7.0E-19
sp|P25926|NIRC_SALTY Nitrite transporter NirC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nirC PE=3 SV=2 60 254 9.0E-19
sp|P0AC27|NIRC_SHIFL Nitrite transporter NirC OS=Shigella flexneri GN=nirC PE=3 SV=1 60 254 4.0E-18
sp|P0AC26|NIRC_ECOLI Nitrite transporter NirC OS=Escherichia coli (strain K12) GN=nirC PE=1 SV=1 60 254 4.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 32 54 22
2 69 91 22
3 112 134 22
4 196 218 22
5 239 261 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|046850
MDNRSTLKPAQVAHIMVANAVAKHKDRYENIFWKAFAAGVMLAFGNLLSQIISGGSPALNSSNPGLVKILGGAVF
PVGLIMIFLNGYELLTSNMLYFPMAVCTRAVPLWGLALNWLIVFFGNLVGSLFFGAILVRYSGVMDAPPFADFVR
SFAIHKAKDPEWHQIFLRGIACNWLVSVAVWQAAGAKDTLSRIVAIWIPIFIFVAAGYDHVIANMFSVPLGIMFH
ADLTTAEYIRKSLIAAFLGNVVGALFVGLPAVYMYLSEWGTVGYGWSRVEKVQETNGSSLDSAAKHV*
Coding >Agabi119p4|046850
ATGGATAATAGGAGTACTCTGAAGCCTGCGCAGGTGGCGCATATTATGGTGGCTAATGCTGTGGCCAAACACAAA
GACAGATATGAAAATATCTTTTGGAAAGCGTTTGCGGCAGGCGTCATGTTAGCCTTTGGAAACCTCTTATCACAA
ATCATTTCAGGCGGTTCTCCTGCTCTCAACTCATCCAATCCTGGCCTCGTCAAAATCCTCGGAGGAGCAGTGTTC
CCTGTCGGTTTGATAATGATCTTCCTCAATGGTTATGAACTTCTCACGAGTAACATGCTTTATTTCCCGATGGCT
GTCTGTACACGAGCTGTGCCACTATGGGGTCTAGCCCTCAACTGGTTAATTGTCTTCTTCGGTAACCTTGTCGGA
AGTTTGTTCTTCGGTGCCATCCTCGTACGCTATTCCGGTGTCATGGACGCGCCACCTTTCGCGGACTTCGTTCGC
TCATTCGCAATTCATAAGGCCAAGGACCCTGAATGGCACCAGATCTTCCTTCGTGGGATTGCGTGTAATTGGCTG
GTTTCAGTAGCAGTATGGCAAGCTGCAGGAGCTAAAGATACTCTATCAAGGATTGTGGCAATCTGGATCCCAATT
TTCATTTTCGTCGCCGCAGGCTATGATCACGTAATCGCAAACATGTTTTCTGTCCCCTTGGGAATAATGTTCCAT
GCCGATTTGACAACGGCTGAGTATATCAGAAAGTCACTTATCGCTGCATTTCTCGGAAACGTCGTCGGCGCCTTG
TTCGTCGGACTGCCAGCAGTCTATATGTATCTCAGTGAATGGGGAACTGTAGGGTACGGTTGGTCCAGGGTTGAG
AAAGTTCAGGAGACGAACGGAAGTAGTTTGGATAGTGCCGCGAAGCATGTATGA
Transcript >Agabi119p4|046850
ATGGATAATAGGAGTACTCTGAAGCCTGCGCAGGTGGCGCATATTATGGTGGCTAATGCTGTGGCCAAACACAAA
GACAGATATGAAAATATCTTTTGGAAAGCGTTTGCGGCAGGCGTCATGTTAGCCTTTGGAAACCTCTTATCACAA
ATCATTTCAGGCGGTTCTCCTGCTCTCAACTCATCCAATCCTGGCCTCGTCAAAATCCTCGGAGGAGCAGTGTTC
CCTGTCGGTTTGATAATGATCTTCCTCAATGGTTATGAACTTCTCACGAGTAACATGCTTTATTTCCCGATGGCT
GTCTGTACACGAGCTGTGCCACTATGGGGTCTAGCCCTCAACTGGTTAATTGTCTTCTTCGGTAACCTTGTCGGA
AGTTTGTTCTTCGGTGCCATCCTCGTACGCTATTCCGGTGTCATGGACGCGCCACCTTTCGCGGACTTCGTTCGC
TCATTCGCAATTCATAAGGCCAAGGACCCTGAATGGCACCAGATCTTCCTTCGTGGGATTGCGTGTAATTGGCTG
GTTTCAGTAGCAGTATGGCAAGCTGCAGGAGCTAAAGATACTCTATCAAGGATTGTGGCAATCTGGATCCCAATT
TTCATTTTCGTCGCCGCAGGCTATGATCACGTAATCGCAAACATGTTTTCTGTCCCCTTGGGAATAATGTTCCAT
GCCGATTTGACAACGGCTGAGTATATCAGAAAGTCACTTATCGCTGCATTTCTCGGAAACGTCGTCGGCGCCTTG
TTCGTCGGACTGCCAGCAGTCTATATGTATCTCAGTGAATGGGGAACTGTAGGGTACGGTTGGTCCAGGGTTGAG
AAAGTTCAGGAGACGAACGGAAGTAGTTTGGATAGTGCCGCGAAGCATGTATGA
Gene >Agabi119p4|046850
ATGGATAATAGGAGTACTCTGAAGCCTGCGCAGGTGGCGCATATTATGGTGGCTAATGCTGTGGCCAAACACAAA
GACAGATATGAAAATATCTTTTGGAAAGCGGTTAGTAGTATCCTACCTATGAGGATTCCACGACACTTACAAATC
ACAAATCGCCCTCTTCATCCAGTTTGCGGCAGGCGTCATGTTAGCCTTTGGAAACCTCTTATCACAAATCATTTC
AGGCGGTTCTCCTGCTCTCAACTCATCCAATCCTGGCCTCGTCAAAATCCTCGGAGGAGCAGTGTTCCCTGTCGG
TTTGATAATGTAAGAACCACTATGGTCTTTCGAATCCTCAGTGTTGGGTTTGATGTGTGTGGAACTTTTTACCCA
GGATCTTCCTCAATGGTTATGAACTTCTCACGAGTAACATGCTTGTAAGTAAACCAAGTTAATTCGCGTTCCATC
GGTGGCTTACATGCGACTTCATATTAGTATTTCCCGATGGCTGTCTGTACACGAGCTGTGCCACTATGGGGTCTA
GCCCTCAACTGGTTAATTGGTCCGTATTACTTTCTGATTTTCTCAATGGTACCGACTGATATCCGCATAGTCTTC
TTCGGTAACCTTGTCGGAAGTTTGTTCTTCGGTGCCATCCTCGTACGCTGTACGCCATTCCCCAGGAGTTCTCCT
TTTTCCATTTAAACTCATACCTCTTATTTTCAGATTCCGGTGTCATGGACGCGCCACCTTTCGCGGACTTCGTTC
GCTCATTCGCAATGTAAGATTCTGCATCCGAGCATTTTGTACTAAGATTAGAAGAGATGTTTGCTGACCTCTCGT
GATTCCAGTCATAAGGCCAAGGACCCTGAATGGCACCAGATCTTCCTTCGTGGGATTGCGTGTAATTGGCTGGTT
TCAGTAGCAGTATGGGTAAGTAAAAGGAACATCAGGAACGAAAGGGATGAGTCTGATATCTTTTTTCAGCAAGCT
GCAGGAGCTAAAGATACTCTATCAAGGGTAGGTGATATAGCGGTTCCTAGGTTTTCAGAACTGATTCATCATGTC
AACGCTATTTCAAAAACAGATTGTGGCAATCTGGATCCCAATTTTCGTACGTCCCATGTTTTCTGAAAACGAAAT
GCCTTTCTGACGAGAAAACATATCAGATTTTCGTCGCCGCAGGCTATGATCACGGTAAGTGTCTATGTGGAACAT
TCAAATCGCCGAGCTGAATCGCCCCATTTAGTAATCGCAAACATGTTTTCTGTCCCCTTGGGAATAATGTTCCAT
GCCGATGCAAGTAGTCTCTGATCCCTATTTCATACCGGAAACTTACCTGTGCTGTTTCAGTTGACAACGGCTGAG
TATATCAGAAAGTGAGTCTGATGTTCTTACTGTTGGCATAATAGGATACTGCTAACGTATGACTAGGTCACTTAT
CGCTGCATTTCTCGGAAACGTCGTCGGCGCCTTGTTCGTCGGACTGCCAGCAGTCTATATGTATCTCAGTGAATG
GGGAACTGTAGGGTACGGTTGGTCCAGGGTTGAGAAAGTTCAGGAGACGAACGGAAGTAGTTTGGATAGTGCCGC
GAAGCATGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail