Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|046700
Gene name
Locationscaffold_02:1879348..1880422
Strand+
Gene length (bp)1074
Transcript length (bp)762
Coding sequence length (bp)762
Protein length (aa) 254

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03834 Rad10 Binding domain of DNA repair protein Ercc1 (rad10/Swi10) 2.1E-42 17 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1LZ75|ERCC1_BOVIN DNA excision repair protein ERCC-1 OS=Bos taurus GN=ERCC1 PE=2 SV=1 13 210 5.0E-59
sp|P07992|ERCC1_HUMAN DNA excision repair protein ERCC-1 OS=Homo sapiens GN=ERCC1 PE=1 SV=1 13 210 3.0E-57
sp|P07903|ERCC1_MOUSE DNA excision repair protein ERCC-1 OS=Mus musculus GN=Ercc1 PE=2 SV=2 13 210 3.0E-55
sp|Q06182|SWI10_SCHPO Mating-type switching protein swi10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swi10 PE=3 SV=1 7 217 2.0E-54
sp|Q9MA98|ERCC1_ARATH DNA excision repair protein ERCC-1 OS=Arabidopsis thaliana GN=ERCC1 PE=2 SV=1 16 216 3.0E-47
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1LZ75|ERCC1_BOVIN DNA excision repair protein ERCC-1 OS=Bos taurus GN=ERCC1 PE=2 SV=1 13 210 5.0E-59
sp|P07992|ERCC1_HUMAN DNA excision repair protein ERCC-1 OS=Homo sapiens GN=ERCC1 PE=1 SV=1 13 210 3.0E-57
sp|P07903|ERCC1_MOUSE DNA excision repair protein ERCC-1 OS=Mus musculus GN=Ercc1 PE=2 SV=2 13 210 3.0E-55
sp|Q06182|SWI10_SCHPO Mating-type switching protein swi10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swi10 PE=3 SV=1 7 217 2.0E-54
sp|Q9MA98|ERCC1_ARATH DNA excision repair protein ERCC-1 OS=Arabidopsis thaliana GN=ERCC1 PE=2 SV=1 16 216 3.0E-47
sp|Q55GG6|ERCC1_DICDI DNA excision repair protein ERCC-1 OS=Dictyostelium discoideum GN=ercc1 PE=3 SV=1 16 210 2.0E-20
sp|P06838|RAD10_YEAST DNA repair protein RAD10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD10 PE=1 SV=1 15 126 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0003684 damaged DNA binding Yes
GO:0006281 DNA repair Yes
GO:0051716 cellular response to stimulus No
GO:0044260 cellular macromolecule metabolic process No
GO:0044238 primary metabolic process No
GO:0006950 response to stress No
GO:0005488 binding No
GO:0043227 membrane-bounded organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0050896 response to stimulus No
GO:0046483 heterocycle metabolic process No
GO:0003676 nucleic acid binding No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0044237 cellular metabolic process No
GO:0043229 intracellular organelle No
GO:0008150 biological_process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0003677 DNA binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901363 heterocyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0043226 organelle No
GO:0097159 organic cyclic compound binding No
GO:0006259 DNA metabolic process No
GO:0033554 cellular response to stress No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|046700
MSSARVPPVVVPASGNNIIVNPCQRGNPVLECIRNVGKEFGDIAADYQVGRTTGVLFLSLRYHRLHPEYIHSRVE
KLGHSYDHRFLLILCDITEHRDPIRELTKSCLINNITIIVAFSNDEVGHYLSVYKQFESKPPDMIKERVDKDYHA
ILRGALTNIPKVNKTDVETLRSTFGSFANISRATPNQLRNLPGFGQVKVKNIENAFNKPFRNDTTTKLSQLTSTQ
TTQPQPQEPLRGTGNIAQQVLSPTSSDS*
Coding >Agabi119p4|046700
ATGTCCTCTGCTCGTGTGCCCCCAGTCGTTGTCCCCGCTTCTGGCAACAATATTATAGTCAATCCTTGCCAGAGG
GGCAATCCCGTTCTAGAATGTATTCGGAACGTAGGCAAGGAATTCGGTGATATAGCCGCTGACTATCAAGTTGGC
AGAACCACTGGAGTCTTGTTCCTCAGCCTTCGCTATCACCGCCTCCATCCGGAGTATATTCACAGCCGCGTTGAG
AAGCTTGGGCATTCTTACGATCATCGTTTCCTCCTTATCCTATGTGATATTACAGAGCATAGAGATCCAATACGA
GAGCTCACAAAGTCATGTCTCATCAACAACATTACTATCATCGTTGCTTTCTCGAATGATGAAGTGGGCCACTAT
CTATCCGTATACAAGCAATTCGAGTCGAAACCGCCAGACATGATCAAAGAGCGTGTTGACAAGGATTATCATGCT
ATCCTCCGCGGTGCCCTCACCAATATACCCAAAGTCAACAAAACAGACGTTGAGACACTCCGCTCGACGTTTGGT
AGTTTTGCTAACATTTCAAGAGCAACACCCAATCAACTTCGTAACCTCCCTGGTTTTGGTCAAGTCAAGGTCAAG
AACATTGAAAATGCTTTCAATAAGCCATTTCGCAATGACACCACCACCAAGTTGTCACAGCTGACATCAACACAA
ACTACTCAGCCTCAACCACAAGAACCCCTCCGAGGTACAGGCAATATAGCGCAACAGGTGTTATCGCCCACCTCG
TCCGATTCGTGA
Transcript >Agabi119p4|046700
ATGTCCTCTGCTCGTGTGCCCCCAGTCGTTGTCCCCGCTTCTGGCAACAATATTATAGTCAATCCTTGCCAGAGG
GGCAATCCCGTTCTAGAATGTATTCGGAACGTAGGCAAGGAATTCGGTGATATAGCCGCTGACTATCAAGTTGGC
AGAACCACTGGAGTCTTGTTCCTCAGCCTTCGCTATCACCGCCTCCATCCGGAGTATATTCACAGCCGCGTTGAG
AAGCTTGGGCATTCTTACGATCATCGTTTCCTCCTTATCCTATGTGATATTACAGAGCATAGAGATCCAATACGA
GAGCTCACAAAGTCATGTCTCATCAACAACATTACTATCATCGTTGCTTTCTCGAATGATGAAGTGGGCCACTAT
CTATCCGTATACAAGCAATTCGAGTCGAAACCGCCAGACATGATCAAAGAGCGTGTTGACAAGGATTATCATGCT
ATCCTCCGCGGTGCCCTCACCAATATACCCAAAGTCAACAAAACAGACGTTGAGACACTCCGCTCGACGTTTGGT
AGTTTTGCTAACATTTCAAGAGCAACACCCAATCAACTTCGTAACCTCCCTGGTTTTGGTCAAGTCAAGGTCAAG
AACATTGAAAATGCTTTCAATAAGCCATTTCGCAATGACACCACCACCAAGTTGTCACAGCTGACATCAACACAA
ACTACTCAGCCTCAACCACAAGAACCCCTCCGAGGTACAGGCAATATAGCGCAACAGGTGTTATCGCCCACCTCG
TCCGATTCGTGA
Gene >Agabi119p4|046700
ATGTCCTCTGCTCGTGTGCCCCCAGTCGTTGTCCCCGCTTCTGGCAACAATATTATAGTCAATCCTTGCCAGGTT
TGCCGCGCTTATATTCCTAAAACCAGAACCTGACACTGGTCAGAGGGGCAATCCCGTTCTAGAATGTATTCGGAA
CGTAGGCAAGGAATTCGGTGATATAGCCGCTGACTATCAAGTTGGCAGAACCACTGGAGTCTTGTTCCTCAGGTG
AATGTGAATCTGCTGCATTTGATCCTAGATTTGATCCTCACATCTGCATAGCCTTCGCTATCACCGCCTCCATCC
GGAGTATATTCACAGCCGCGTTGAGAAGCTTGGGCATTCTTACGATCATCGTTTCCTCCTTATCCTATGTGATAT
TGTACGCGCCCAACAGTTTGAACTTCTTCCTAACTAATAGTTGCCTCTAGACAGAGCATAGAGATCCAATACGAG
AGCTCACAAAGGTCAGACCGTCACTCCCCCACATGCCTTAATCTTCCCTCATCTTGACACAGTCATGTCTCATCA
ACAACATTACTATCATCGTTGCTTTCTCGTACGCTCCTGTACTTCTATGCCTTGAATGTCATCTCAATCAAGCCA
TTTCGTTTCAGGAATGATGAAGTGGGCCACTATCTATCCGTATACAAGCAATTCGAGTCGAAACCGCCAGACATG
ATCAAAGAGCGTGTTGACAAGGATTATCATGCTATCCTCCGCGGTGCCCTCACCAATATACCCAAAGTCAACAAA
ACAGACGTTGAGACACTCCGCTCGACGTTTGGTGTATGTTCCTAGAACTCTCAAAAAAAGTTTAGCTCGGTCCTG
ACCGCCAGACAGAGTTTTGCTAACATTTCAAGAGCAACACCCAATCAACTTCGTAACCTCCCTGGTTTTGGTCAA
GTCAAGGTCAAGAACATTGAAAATGCTTTCAATAAGCCATTTCGCAATGACACCACCACCAAGTTGTCACAGCTG
ACATCAACACAAACTACTCAGCCTCAACCACAAGAACCCCTCCGAGGTACAGGCAATATAGCGCAACAGGTGTTA
TCGCCCACCTCGTCCGATTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail