Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|046370
Gene name
Locationscaffold_02:1803099..1805219
Strand-
Gene length (bp)2120
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01148 CTP_transf_1 Cytidylyltransferase family 3.0E-23 215 401
PF01148 CTP_transf_1 Cytidylyltransferase family 6.3E-29 455 535

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P381|CDSH_SCHPO Putative phosphatidate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13A2.03 PE=1 SV=1 157 575 1.0E-111
sp|P38221|CDS1_YEAST Phosphatidate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDS1 PE=1 SV=1 150 577 1.0E-99
sp|O04928|CDS1_ARATH Phosphatidate cytidylyltransferase 1 OS=Arabidopsis thaliana GN=CDS1 PE=1 SV=1 204 574 7.0E-77
sp|P53439|CDSA_CAEEL Phosphatidate cytidylyltransferase OS=Caenorhabditis elegans GN=cdgs-1 PE=3 SV=2 150 577 2.0E-75
sp|O35052|CDS1_RAT Phosphatidate cytidylyltransferase 1 OS=Rattus norvegicus GN=Cds1 PE=1 SV=2 168 579 1.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P381|CDSH_SCHPO Putative phosphatidate cytidylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC13A2.03 PE=1 SV=1 157 575 1.0E-111
sp|P38221|CDS1_YEAST Phosphatidate cytidylyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDS1 PE=1 SV=1 150 577 1.0E-99
sp|O04928|CDS1_ARATH Phosphatidate cytidylyltransferase 1 OS=Arabidopsis thaliana GN=CDS1 PE=1 SV=1 204 574 7.0E-77
sp|P53439|CDSA_CAEEL Phosphatidate cytidylyltransferase OS=Caenorhabditis elegans GN=cdgs-1 PE=3 SV=2 150 577 2.0E-75
sp|O35052|CDS1_RAT Phosphatidate cytidylyltransferase 1 OS=Rattus norvegicus GN=Cds1 PE=1 SV=2 168 579 1.0E-74
sp|P98191|CDS1_MOUSE Phosphatidate cytidylyltransferase 1 OS=Mus musculus GN=Cds1 PE=1 SV=2 168 579 2.0E-74
sp|Q92903|CDS1_HUMAN Phosphatidate cytidylyltransferase 1 OS=Homo sapiens GN=CDS1 PE=2 SV=2 168 579 2.0E-73
sp|O95674|CDS2_HUMAN Phosphatidate cytidylyltransferase 2 OS=Homo sapiens GN=CDS2 PE=1 SV=1 148 577 7.0E-73
sp|P56079|CDSA_DROME Phosphatidate cytidylyltransferase, photoreceptor-specific OS=Drosophila melanogaster GN=CdsA PE=1 SV=2 134 538 4.0E-72
sp|O04940|CDS1_SOLTU Phosphatidate cytidylyltransferase 1 OS=Solanum tuberosum GN=CDS1 PE=1 SV=1 204 574 5.0E-72
sp|O49639|CDS2_ARATH Phosphatidate cytidylyltransferase 2 OS=Arabidopsis thaliana GN=CDS2 PE=1 SV=1 204 576 1.0E-71
sp|A0JNC1|CDS2_BOVIN Phosphatidate cytidylyltransferase 2 OS=Bos taurus GN=CDS2 PE=2 SV=1 155 577 2.0E-71
sp|Q99L43|CDS2_MOUSE Phosphatidate cytidylyltransferase 2 OS=Mus musculus GN=Cds2 PE=1 SV=1 169 577 1.0E-70
sp|Q91XU8|CDS2_RAT Phosphatidate cytidylyltransferase 2 OS=Rattus norvegicus GN=Cds2 PE=1 SV=1 169 578 2.0E-69
sp|Q1PE48|CDS3_ARATH Phosphatidate cytidylyltransferase 3 OS=Arabidopsis thaliana GN=CDS3 PE=1 SV=1 157 572 2.0E-64
sp|Q55D90|CDSA_DICDI Probable phosphatidate cytidylyltransferase OS=Dictyostelium discoideum GN=cdsA PE=3 SV=1 192 572 3.0E-62
sp|Q95ZE3|CDS1_ENCCU Phosphatidate cytidylyltransferase OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDS1 PE=3 SV=1 316 573 4.0E-36
sp|Q68WV5|CDSA_RICTY Phosphatidate cytidylyltransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=cdsA PE=3 SV=1 458 524 8.0E-09
sp|Q92I31|CDSA_RICCN Phosphatidate cytidylyltransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=cdsA PE=3 SV=1 468 524 1.0E-08
sp|Q9ZDA8|CDSA_RICPR Phosphatidate cytidylyltransferase OS=Rickettsia prowazekii (strain Madrid E) GN=cdsA PE=3 SV=1 468 520 2.0E-08
sp|Q4ULR7|CDSA_RICFE Phosphatidate cytidylyltransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=cdsA PE=3 SV=1 468 524 2.0E-07
sp|Q1RII7|CDSA_RICBR Phosphatidate cytidylyltransferase OS=Rickettsia bellii (strain RML369-C) GN=cdsA PE=3 SV=1 452 524 3.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 218 240 22
2 281 303 22
3 316 338 22
4 358 380 22
5 392 414 22
6 474 496 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|046370
MSRQSNVHSLFSSPAFSALEVEPGEDTEEEELPEEFEERPAETKPSKAALKKAARQVHREEKLRKRAEAKKRRVE
DRQHSPISDTVPTFEATSNGSVLPHIPPSAVSASSNVEEVTPSPQSTPLVSPQLEPEVMAEPVLEPTGECVSVHD
QPVYEPERPSSTTNAGKTPEEVDVEKVEPEAMLISHDGTTATEVQHQQDATADVEKLKKRQNALTRTIWTLIMIG
GFIGLLLMGHVYMMILVMVCQTVAYREVTALFGLATTELSTQDKQSLKDKDPWSKTLNWYFFAVTNYFLYGESII
YYFKHVVFADPQLVPFITNHRMISFTLYVIGFMGFVMSLKKGFLKQQFGLFCWVHMTLLMIVVSSHFVVNNILEG
LIWFWVPASLVICNDVFAYIWGITIGLFALFWGTLFMRFNYMICPVHDLGISAWNSTQCKPNPVFVWRELPLWHP
FAIFMSTLLGRTITAIPYAPYHLHLLLMACFASLVAPFGGFFASGFKRAFKIKDFGHSIPGHGGMTDRMDCQFLM
GVFTYVYYSSLIREHHVTVGTILQTIVSGLTVDEQIELVADLHRYLETQGIVVP*
Coding >Agabi119p4|046370
ATGAGCAGACAGTCCAACGTCCACAGTCTCTTCTCAAGCCCTGCGTTTTCCGCTCTAGAAGTAGAGCCTGGAGAA
GACACAGAGGAAGAAGAGTTACCCGAAGAATTTGAAGAAAGACCAGCAGAAACCAAGCCTTCAAAAGCCGCCCTT
AAGAAGGCTGCCCGGCAAGTGCATCGTGAGGAAAAACTGCGAAAGCGAGCAGAGGCAAAGAAACGACGAGTGGAG
GACCGTCAGCACTCTCCAATTTCAGATACTGTACCCACCTTCGAGGCTACCTCAAACGGCTCTGTTCTACCACAC
ATTCCACCGTCAGCTGTTTCTGCATCCTCTAATGTTGAGGAGGTAACCCCCTCTCCCCAGTCCACACCTTTGGTC
TCGCCTCAGCTGGAGCCAGAGGTTATGGCTGAACCGGTCCTTGAGCCTACCGGGGAATGTGTCTCTGTTCATGAC
CAACCGGTATATGAACCGGAAAGGCCTTCTAGCACAACGAACGCTGGTAAAACTCCGGAAGAAGTGGATGTCGAG
AAGGTTGAACCCGAAGCCATGCTTATTTCACATGATGGCACAACAGCCACTGAGGTGCAACACCAACAAGACGCC
ACCGCTGACGTTGAAAAGTTAAAAAAACGTCAGAATGCTCTGACGAGGACCATATGGACTCTTATCATGATTGGT
GGATTTATTGGACTTCTGCTTATGGGCCATGTTTATATGATGATACTTGTGATGGTTTGCCAGACCGTGGCATAT
CGCGAGGTCACGGCACTCTTTGGTCTTGCTACAACTGAACTTAGTACCCAAGACAAACAGTCCTTAAAAGACAAA
GATCCCTGGAGTAAAACTTTGAACTGGTACTTCTTTGCCGTCACCAACTATTTCTTATACGGAGAGAGTATCATA
TATTACTTCAAGCATGTAGTCTTCGCCGATCCTCAACTTGTACCCTTCATTACGAACCACCGCATGATCAGTTTC
ACTCTCTATGTCATTGGCTTCATGGGCTTCGTCATGTCGCTGAAAAAAGGCTTTTTGAAGCAGCAGTTTGGTTTG
TTTTGTTGGGTGCACATGACTCTCTTGATGATCGTCGTTTCAAGCCACTTTGTCGTCAACAATATCCTCGAAGGG
CTGATCTGGTTCTGGGTTCCTGCGTCGCTTGTCATCTGTAATGACGTCTTTGCCTACATCTGGGGTATCACAATT
GGCCTTTTCGCGCTTTTTTGGGGTACGCTCTTCATGCGTTTCAACTACATGATTTGCCCTGTCCATGACCTGGGT
ATCAGTGCTTGGAACTCGACCCAGTGCAAGCCTAACCCCGTTTTCGTCTGGCGAGAACTACCGTTGTGGCATCCA
TTTGCCATTTTCATGTCCACTCTGCTTGGTCGTACCATCACTGCGATACCGTATGCTCCTTACCACCTCCACCTT
CTGTTGATGGCATGTTTTGCGTCACTTGTTGCTCCTTTTGGAGGGTTTTTTGCCTCAGGGTTCAAACGTGCTTTC
AAAATCAAAGACTTTGGTCACAGTATCCCGGGACATGGCGGAATGACCGACCGAATGGATTGCCAATTCCTCATG
GGTGTTTTCACATATGTTTACTATAGCAGTCTCATTCGTGAGCACCATGTCACAGTTGGCACTATTCTACAGACC
ATCGTCAGTGGTCTTACCGTTGATGAGCAAATTGAGCTTGTTGCGGATCTACATCGCTATTTGGAGACGCAGGGT
ATTGTCGTACCATGA
Transcript >Agabi119p4|046370
ATGAGCAGACAGTCCAACGTCCACAGTCTCTTCTCAAGCCCTGCGTTTTCCGCTCTAGAAGTAGAGCCTGGAGAA
GACACAGAGGAAGAAGAGTTACCCGAAGAATTTGAAGAAAGACCAGCAGAAACCAAGCCTTCAAAAGCCGCCCTT
AAGAAGGCTGCCCGGCAAGTGCATCGTGAGGAAAAACTGCGAAAGCGAGCAGAGGCAAAGAAACGACGAGTGGAG
GACCGTCAGCACTCTCCAATTTCAGATACTGTACCCACCTTCGAGGCTACCTCAAACGGCTCTGTTCTACCACAC
ATTCCACCGTCAGCTGTTTCTGCATCCTCTAATGTTGAGGAGGTAACCCCCTCTCCCCAGTCCACACCTTTGGTC
TCGCCTCAGCTGGAGCCAGAGGTTATGGCTGAACCGGTCCTTGAGCCTACCGGGGAATGTGTCTCTGTTCATGAC
CAACCGGTATATGAACCGGAAAGGCCTTCTAGCACAACGAACGCTGGTAAAACTCCGGAAGAAGTGGATGTCGAG
AAGGTTGAACCCGAAGCCATGCTTATTTCACATGATGGCACAACAGCCACTGAGGTGCAACACCAACAAGACGCC
ACCGCTGACGTTGAAAAGTTAAAAAAACGTCAGAATGCTCTGACGAGGACCATATGGACTCTTATCATGATTGGT
GGATTTATTGGACTTCTGCTTATGGGCCATGTTTATATGATGATACTTGTGATGGTTTGCCAGACCGTGGCATAT
CGCGAGGTCACGGCACTCTTTGGTCTTGCTACAACTGAACTTAGTACCCAAGACAAACAGTCCTTAAAAGACAAA
GATCCCTGGAGTAAAACTTTGAACTGGTACTTCTTTGCCGTCACCAACTATTTCTTATACGGAGAGAGTATCATA
TATTACTTCAAGCATGTAGTCTTCGCCGATCCTCAACTTGTACCCTTCATTACGAACCACCGCATGATCAGTTTC
ACTCTCTATGTCATTGGCTTCATGGGCTTCGTCATGTCGCTGAAAAAAGGCTTTTTGAAGCAGCAGTTTGGTTTG
TTTTGTTGGGTGCACATGACTCTCTTGATGATCGTCGTTTCAAGCCACTTTGTCGTCAACAATATCCTCGAAGGG
CTGATCTGGTTCTGGGTTCCTGCGTCGCTTGTCATCTGTAATGACGTCTTTGCCTACATCTGGGGTATCACAATT
GGCCTTTTCGCGCTTTTTTGGGGTACGCTCTTCATGCGTTTCAACTACATGATTTGCCCTGTCCATGACCTGGGT
ATCAGTGCTTGGAACTCGACCCAGTGCAAGCCTAACCCCGTTTTCGTCTGGCGAGAACTACCGTTGTGGCATCCA
TTTGCCATTTTCATGTCCACTCTGCTTGGTCGTACCATCACTGCGATACCGTATGCTCCTTACCACCTCCACCTT
CTGTTGATGGCATGTTTTGCGTCACTTGTTGCTCCTTTTGGAGGGTTTTTTGCCTCAGGGTTCAAACGTGCTTTC
AAAATCAAAGACTTTGGTCACAGTATCCCGGGACATGGCGGAATGACCGACCGAATGGATTGCCAATTCCTCATG
GGTGTTTTCACATATGTTTACTATAGCAGTCTCATTCGTGAGCACCATGTCACAGTTGGCACTATTCTACAGACC
ATCGTCAGTGGTCTTACCGTTGATGAGCAAATTGAGCTTGTTGCGGATCTACATCGCTATTTGGAGACGCAGGGT
ATTGTCGTACCATGA
Gene >Agabi119p4|046370
ATGAGCAGACAGTCCAACGTCCACAGTCTCTTCTCAAGCCCTGCGTTTTCCGCTCTAGAAGTAGAGCCTGGAGAA
GACACAGAGGAAGAAGAGTTACCCGAAGAATTTGAAGAAAGGTTTGTCCAGCACATCACTTTCTATGACCGCCTT
CATAACTTATGAGTGATAGACCAGCAGAAACCAAGCCTTCAAAAGCCGCCCTTAAGAAGGCTGCCCGGCAAGTGC
ATCGTGAGGAAAAACTGCGAAAGCGAGCAGAGGCAAAGAAACGACGAGTGGAGGACCGTCAGCACTCTCCAATTT
CAGATACTGTACCCACCTTCGAGGCTACCTCAAACGGCTCTGTTCTACCACACATTCCACCGTCAGCTGTTTCTG
CATCCTCTAATGTTGAGGAGGTAACCCCCTCTCCCCAGTCCACACCTTTGGTCTCGCCTCAGCTGGAGCCAGAGG
TTATGGCTGAACCGGTCCTTGAGCCTACCGGGGAATGTGTCTCTGTTCATGACCAACCGGTATATGAACCGGAAA
GGCCTTCTAGCACAACGAACGCTGGTAAAACTCCGGAAGAAGTGGATGTCGAGAAGGTTGAACCCGAAGCCATGC
TTATTTCACATGATGGCACAACAGCCACTGAGGTGCAACACCAACAAGACGCCACCGCTGACGTTGAAAAGTTAA
AAAAACGTCAGAATGCTCTGACGAGGACCATATGGACTCTTATCATGATTGGTGGATTTATTGGTGAGAAAGGCC
ATATCTGACTGTATTCGATAGGACGCTTATTCCATTACCAGGACTTCTGCTTATGGGCCATGTTTATATGATGAT
ACTTGTGATGGTTTGCCAGACCGTGGCATATCGCGAGGTCACGGCACTCTTTGGTCTTGCTACAACTGAACTTAG
TACCCAAGACAAACAGTCCTTAAAAGACAAAGATCCCTGGAGTAAAACTTTGAACTGGTACTTCTTTGCCGTCAC
CAACTATTTCTTATACGGAGAGAGTATCATATATTACTTCAAGGTACGTCATCAAAAGTCTCTTCGACTCTGCTG
ACCATATTACCAGCATGTAGTCTTCGCCGATCCTCAACTTGTACCCTTCATTACGAACCACCGCATGATCAGTTT
CACTCTCTATGTCATTGGCTTCATGGGCTTCGTCATGTCGCTGAAAAAAGGCTTTTTGAAGCAGCAGTTTGGTTT
GTTTTGTTGGGTGCACATGACTCTCTTGATGATCGTCGTTTCAAGGTGCAGTCATTACTTTTACCCGTCTTCAGT
TTACTCATTGTGGTTTCTAGCCACTTTGTCGTCAACAATATCCTCGAAGGGCTGATCTGGTTCTGGGTTCCTGCG
TCGCTTGTCATCTGTAATGACGTCTTTGCCTACATCTGGGGTATCACAATTGGCCGTACGCCACTTATTCAACTG
TCACCGAAAAAAACAGTGGAAGGTTTTGTCGGTGCTTTTTTCAGTACCTTAGTTTTCGCGCTTTTTTGGGGTACG
CTCTTCATGCGTTTCAACTACATGATTTGCCCTGTCCATGACCTGGGTATCAGTGCTTGGAACTCGACCCAGTGC
AAGCCTAACCCCGTTTTCGTCTGGCGAGAACTACCGTTGTGGCATCCATTTGCCATTTTCATGTCCACTCTGGTA
TGTTTCTTTGGCCTGAGAGCTACTTTGCTTGCTGACGGTAGTTCAAGCTTGGTCGTACCATCACTGCGATACCGT
ATGCTCCTTACCACCTCCACCTTCTGTTGATGGCATGTTTTGCGTCACTTGTTGCTCCTTTTGGAGGGTTTTTTG
CCTCAGGGTTCAAACGTGCTTTCAAAATCAAAGACTTTGGTCACAGTATCCCGGGACATGGCGGAATGACCGACC
GAATGGATTGCCAGTGAGTATCGAGAGCTCTGGCTTGGCACTTGACAAAGCAGCTCAATTTACCTTGCAGATTCC
TCATGGGTGTTTTCACATATGTTTACTATAGCAGTCTCATTCGTGAGCACCATGTCACAGTTGGCACTATTCTAC
AGACCATCGTCAGTGGTCTTACCGTTGATGAGCAAATTGAGCTTGTTGCGGATCTACATCGCTATTTGGAGACGC
AGGGTATTGTCGTACCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail