Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|046300
Gene name
Locationscaffold_02:1789196..1790264
Strand+
Gene length (bp)1068
Transcript length (bp)900
Coding sequence length (bp)900
Protein length (aa) 300

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08651 DASH_Duo1 DASH complex subunit Duo1 2.4E-19 107 180

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0072686 mitotic spindle Yes
GO:0042729 DASH complex Yes
GO:0000278 mitotic cell cycle Yes
GO:0043229 intracellular organelle No
GO:0032991 protein-containing complex No
GO:0043226 organelle No
GO:0005819 spindle No
GO:0043228 non-membrane-bounded organelle No
GO:0007049 cell cycle No
GO:0140513 nuclear protein-containing complex No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|046300
MWDPDVSDMTFSADGSRLLSESSLMASESTSSSHTRHEQGELSLSDLSLRDRDDIMSKPFSLLAQPEPVTPPQQT
STLGEVEDEGEGYEETSLEHTEKRTGKAREEKLQNDVFILKKLNASFSAFNEAMEATGSINDRIAIQLAQTDALL
NKYIEILYRSEDVSRLIFDEDWQGAEADEEDLERERAEAIERARREEEERKLTLQREKERREREEREKKEREERE
RLEQEKRDRLAARGGSRGVRRTTSTRGTGRVTRGAAGSSRQSMIRPPTSGTSTNKTTTGSSRGGGAPARGVRRP*
Coding >Agabi119p4|046300
ATGTGGGATCCTGATGTGTCTGATATGACTTTCAGTGCAGATGGGTCACGGCTGCTATCCGAATCGTCCCTGATG
GCGTCGGAGTCCACATCATCATCGCACACCAGACATGAACAAGGCGAACTATCTCTGTCAGATTTATCGCTGAGA
GATAGAGATGACATCATGAGCAAACCCTTCAGTTTACTTGCACAGCCGGAACCTGTGACTCCACCTCAACAGACG
AGCACGCTAGGTGAAGTTGAAGACGAAGGTGAAGGGTATGAGGAGACAAGTCTAGAACACACAGAGAAGCGGACG
GGGAAGGCAAGGGAGGAGAAATTGCAGAACGATGTATTTATTCTCAAAAAGCTCAACGCATCCTTTTCTGCCTTT
AATGAGGCAATGGAAGCGACGGGAAGTATCAATGATAGGATAGCGATTCAACTGGCTCAAACTGATGCATTACTC
AATAAATATATTGAGATATTGTACAGATCTGAAGACGTTTCGCGACTGATATTTGATGAAGATTGGCAAGGGGCT
GAAGCAGACGAGGAGGATCTTGAACGGGAACGTGCTGAAGCCATTGAACGCGCCCGGCGAGAAGAGGAAGAACGG
AAATTAACCTTGCAGAGAGAAAAGGAGCGGCGTGAACGCGAGGAACGCGAAAAGAAAGAGAGAGAAGAACGAGAA
CGACTCGAACAGGAGAAGCGCGATCGGCTTGCGGCGCGAGGAGGCTCGAGAGGGGTGCGAAGGACTACTTCTACG
CGTGGGACGGGCAGGGTAACACGGGGCGCGGCGGGCAGTTCCAGGCAGAGCATGATAAGACCACCGACGAGCGGG
ACGTCCACCAACAAGACGACGACGGGATCGAGTCGTGGAGGAGGAGCGCCTGCTCGAGGAGTAAGAAGACCCTAA
Transcript >Agabi119p4|046300
ATGTGGGATCCTGATGTGTCTGATATGACTTTCAGTGCAGATGGGTCACGGCTGCTATCCGAATCGTCCCTGATG
GCGTCGGAGTCCACATCATCATCGCACACCAGACATGAACAAGGCGAACTATCTCTGTCAGATTTATCGCTGAGA
GATAGAGATGACATCATGAGCAAACCCTTCAGTTTACTTGCACAGCCGGAACCTGTGACTCCACCTCAACAGACG
AGCACGCTAGGTGAAGTTGAAGACGAAGGTGAAGGGTATGAGGAGACAAGTCTAGAACACACAGAGAAGCGGACG
GGGAAGGCAAGGGAGGAGAAATTGCAGAACGATGTATTTATTCTCAAAAAGCTCAACGCATCCTTTTCTGCCTTT
AATGAGGCAATGGAAGCGACGGGAAGTATCAATGATAGGATAGCGATTCAACTGGCTCAAACTGATGCATTACTC
AATAAATATATTGAGATATTGTACAGATCTGAAGACGTTTCGCGACTGATATTTGATGAAGATTGGCAAGGGGCT
GAAGCAGACGAGGAGGATCTTGAACGGGAACGTGCTGAAGCCATTGAACGCGCCCGGCGAGAAGAGGAAGAACGG
AAATTAACCTTGCAGAGAGAAAAGGAGCGGCGTGAACGCGAGGAACGCGAAAAGAAAGAGAGAGAAGAACGAGAA
CGACTCGAACAGGAGAAGCGCGATCGGCTTGCGGCGCGAGGAGGCTCGAGAGGGGTGCGAAGGACTACTTCTACG
CGTGGGACGGGCAGGGTAACACGGGGCGCGGCGGGCAGTTCCAGGCAGAGCATGATAAGACCACCGACGAGCGGG
ACGTCCACCAACAAGACGACGACGGGATCGAGTCGTGGAGGAGGAGCGCCTGCTCGAGGAGTAAGAAGACCCTAA
Gene >Agabi119p4|046300
ATGTGGGATCCTGATGTGTCTGATATGACTTTCAGTGCAGATGGGTCACGGCTGCTATCCGAATCGTCCCTGATG
GCGTCGGAGTCCACATCATCATCGCACACCAGACATGAACAAGGCGAACTATCTCTGTCAGATTTATCGCTGAGA
GATAGAGATGACATCATGAGCAAACCCTTCAGTTTACTTGCACAGCCGGAACCTGTGACTCCACCTCAACAGACG
AGCACGCTAGGTGAAGTTGAAGACGAAGGTGAAGGGTATGAGGAGACAAGTCTAGAACACACAGAGAAGCGGACG
GGGAAGGCAAGGGAGGAGAAATTGCAGAACGATGTATTTATTCTCAAAAAGCTCAACGCATCCTTTTCTGCCTTT
AATGAGGCAATGGAAGCGACGGGAAGTATCAATGATGTACGCAGTTTTTCCAAAATCACTTGCTGTTGATTGACA
CGATATATATTCTAACAGAGGATAGCGATTCAACTGGCTCAAACTGATGCATTACTCAATAAATATATTGAGATA
TTGTACAGATCTGAAGACGTTTCGCGACTGATATTTGATGAAGATTGGCAAGGGGCTGAAGCAGTTAGTGTTGAG
CTATATCTCATTCTTGATCAATTGAGCGTTTGGCACCCAGGACGAGGAGGATCTTGAACGGGAACGTGCTGAAGC
CATTGAACGCGCCCGGCGAGAAGAGGAAGAACGGAAATTAACCTTGCAGAGAGAAAAGGAGCGGCGTGAACGCGA
GGAACGCGAAAAGAAAGAGAGAGAAGAACGAGAACGACTCGAACAGGAGAAGCGCGATCGGCTTGCGGCGCGAGG
AGGCTCGAGAGGGGTGCGAAGGACTACTTCTACGCGTGGGACGGGCAGGGTAACACGGGGCGCGGCGGGCAGTTC
CAGGCAGAGTACGTCCATATAGCCCATTTGTGAGTCAAAGGCCTGACTGTATCTGTGAATATTCTAGGCATGATA
AGACCACCGACGAGCGGGACGTCCACCAACAAGACGACGACGGGATCGAGTCGTGGAGGAGGAGCGCCTGCTCGA
GGAGTAAGAAGACCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail