Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|046260
Gene name
Locationscaffold_02:1776818..1778947
Strand+
Gene length (bp)2129
Transcript length (bp)1716
Coding sequence length (bp)1716
Protein length (aa) 572

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 3.5E-11 437 482
PF17123 zf-RING_11 RING-like zinc finger 3.2E-07 438 467
PF12861 zf-ANAPC11 Anaphase-promoting complex subunit 11 RING-H2 finger 5.3E-06 437 486

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0WPW5|RMR4_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 4 OS=Arabidopsis thaliana GN=RMR4 PE=2 SV=1 431 484 1.0E-10
sp|Q8SV35|Y733_ENCCU Uncharacterized RING finger protein ECU07_0330 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0330 PE=3 SV=2 401 482 4.0E-10
sp|Q9M622|RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana GN=RMR1 PE=2 SV=1 436 500 4.0E-10
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 437 490 5.0E-10
sp|F4HZZ4|RMR6_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 6 OS=Arabidopsis thaliana GN=RMR6 PE=3 SV=2 437 484 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0WPW5|RMR4_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 4 OS=Arabidopsis thaliana GN=RMR4 PE=2 SV=1 431 484 1.0E-10
sp|Q8SV35|Y733_ENCCU Uncharacterized RING finger protein ECU07_0330 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0330 PE=3 SV=2 401 482 4.0E-10
sp|Q9M622|RMR1_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Arabidopsis thaliana GN=RMR1 PE=2 SV=1 436 500 4.0E-10
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 437 490 5.0E-10
sp|F4HZZ4|RMR6_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 6 OS=Arabidopsis thaliana GN=RMR6 PE=3 SV=2 437 484 1.0E-09
sp|Q69U49|RMR2_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=RMR1 PE=2 SV=2 437 484 2.0E-09
sp|Q8VZ14|RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana GN=RMR2 PE=2 SV=1 437 484 2.0E-09
sp|Q9SG96|ATL72_ARATH RING-H2 finger protein ATL72 OS=Arabidopsis thaliana GN=ATL72 PE=2 SV=1 433 486 3.0E-09
sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 436 493 4.0E-09
sp|F4HZZ5|RMR5_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 5 OS=Arabidopsis thaliana GN=RMR5 PE=2 SV=1 437 484 4.0E-09
sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 436 483 5.0E-09
sp|Q91XF4|RN167_MOUSE E3 ubiquitin-protein ligase RNF167 OS=Mus musculus GN=Rnf167 PE=2 SV=1 436 483 5.0E-09
sp|Q10R93|RMR1_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0167500 PE=2 SV=1 438 484 7.0E-09
sp|Q5XIL0|RN167_RAT E3 ubiquitin-protein ligase RNF167 OS=Rattus norvegicus GN=Rnf167 PE=2 SV=1 436 483 7.0E-09
sp|Q9ZV53|ATL49_ARATH Putative RING-H2 finger protein ATL49 OS=Arabidopsis thaliana GN=ATL49 PE=3 SV=1 438 487 9.0E-09
sp|P87119|MU145_SCHPO RING finger protein mug145 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug145 PE=1 SV=1 438 485 9.0E-09
sp|Q9FHG8|ATL50_ARATH Putative RING-H2 finger protein ATL50 OS=Arabidopsis thaliana GN=ATL50 PE=3 SV=1 421 482 9.0E-09
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 436 483 1.0E-08
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 436 483 1.0E-08
sp|Q641J8|RF12A_XENLA E3 ubiquitin-protein ligase RNF12-A OS=Xenopus laevis GN=rnf12-a PE=1 SV=1 436 493 1.0E-08
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 436 483 1.0E-08
sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 436 493 1.0E-08
sp|Q0VD51|RNF13_BOVIN E3 ubiquitin-protein ligase RNF13 OS=Bos taurus GN=RNF13 PE=2 SV=1 436 483 1.0E-08
sp|Q5RCV8|RNF13_PONAB E3 ubiquitin-protein ligase RNF13 OS=Pongo abelii GN=RNF13 PE=2 SV=1 436 483 1.0E-08
sp|O43567|RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens GN=RNF13 PE=1 SV=1 436 483 1.0E-08
sp|Q07G42|RNF12_XENTR E3 ubiquitin-protein ligase RNF12 OS=Xenopus tropicalis GN=rnf12 PE=2 SV=1 436 493 2.0E-08
sp|Q7T037|RF12B_XENLA E3 ubiquitin-protein ligase RNF12-B OS=Xenopus laevis GN=rnf12-b PE=2 SV=1 436 493 2.0E-08
sp|Q9FLC6|ATL73_ARATH RING-H2 finger protein ATL73 OS=Arabidopsis thaliana GN=ATL73 PE=2 SV=1 429 486 2.0E-08
sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=1 SV=3 420 503 2.0E-08
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 438 501 3.0E-08
sp|Q9FG21|ATL71_ARATH Putative RING-H2 finger protein ATL71 OS=Arabidopsis thaliana GN=ATL71 PE=3 SV=1 424 482 4.0E-08
sp|Q5M974|RN181_XENTR E3 ubiquitin-protein ligase RNF181 OS=Xenopus tropicalis GN=rnf181 PE=2 SV=1 438 485 4.0E-08
sp|Q8BGI1|RNF24_MOUSE RING finger protein 24 OS=Mus musculus GN=Rnf24 PE=2 SV=1 436 502 6.0E-08
sp|Q8GW38|ATL47_ARATH RING-H2 finger protein ATL47 OS=Arabidopsis thaliana GN=ATL47 PE=2 SV=1 396 496 8.0E-08
sp|Q9LM69|ATL80_ARATH RING-H2 finger protein ATL80 OS=Arabidopsis thaliana GN=ATL80 PE=2 SV=1 429 486 9.0E-08
sp|Q14B02|RN133_MOUSE E3 ubiquitin-protein ligase RNF133 OS=Mus musculus GN=Rnf133 PE=1 SV=1 427 531 9.0E-08
sp|Q66J97|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C OS=Xenopus laevis GN=rnf111-c PE=2 SV=1 438 485 1.0E-07
sp|Q5SPX3|RN215_MOUSE RING finger protein 215 OS=Mus musculus GN=Rnf215 PE=2 SV=1 434 497 1.0E-07
sp|Q9P7E1|YOF7_SCHPO Uncharacterized RING finger protein P4H10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP4H10.07 PE=1 SV=1 408 489 1.0E-07
sp|Q6AY01|RN133_RAT E3 ubiquitin-protein ligase RNF133 OS=Rattus norvegicus GN=Rnf133 PE=2 SV=1 427 531 1.0E-07
sp|Q90ZT7|R111A_XENLA E3 ubiquitin-protein ligase arkadia-A (Fragment) OS=Xenopus laevis GN=rnf111-a PE=2 SV=1 438 485 1.0E-07
sp|Q93Z92|RING4_ARATH E3 ubiquitin-protein ligase At4g11680 OS=Arabidopsis thaliana GN=At4g11680 PE=2 SV=1 423 490 1.0E-07
sp|Q8AWW4|RN128_XENLA E3 ubiquitin-protein ligase RNF128 OS=Xenopus laevis GN=rnf128 PE=2 SV=2 436 570 1.0E-07
sp|Q9Y6U7|RN215_HUMAN RING finger protein 215 OS=Homo sapiens GN=RNF215 PE=3 SV=2 434 497 1.0E-07
sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 436 513 2.0E-07
sp|Q9LT17|BBR_ARATH E3 ubiquitin ligase BIG BROTHER-related OS=Arabidopsis thaliana GN=BBR PE=2 SV=1 436 481 2.0E-07
sp|Q9LS99|ATL77_ARATH RING-H2 finger protein ATL77 OS=Arabidopsis thaliana GN=ATL77 PE=2 SV=1 404 483 2.0E-07
sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 424 486 2.0E-07
sp|Q94BY6|ATL75_ARATH RING-H2 finger protein ATL75 OS=Arabidopsis thaliana GN=ATL75 PE=2 SV=1 402 483 2.0E-07
sp|Q8GT75|NIP1_ARATH NEP1-interacting protein 1 OS=Arabidopsis thaliana GN=NIP1 PE=1 SV=2 435 485 2.0E-07
sp|Q9Y225|RNF24_HUMAN RING finger protein 24 OS=Homo sapiens GN=RNF24 PE=1 SV=1 436 496 2.0E-07
sp|Q08D68|ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis GN=znrf3 PE=1 SV=1 438 486 3.0E-07
sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 438 486 3.0E-07
sp|A5WWA0|ZNRF3_DANRE E3 ubiquitin-protein ligase ZNRF3 OS=Danio rerio GN=znrf3 PE=1 SV=2 438 486 3.0E-07
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 438 486 3.0E-07
sp|Q8GYT9|SIS3_ARATH E3 ubiquitin-protein ligase SIS3 OS=Arabidopsis thaliana GN=SIS3 PE=2 SV=2 438 501 3.0E-07
sp|Q6NRX0|RN149_XENLA E3 ubiquitin-protein ligase RNF149 OS=Xenopus laevis GN=rnf149 PE=2 SV=1 436 486 3.0E-07
sp|Q9H0F5|RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 438 484 4.0E-07
sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 438 486 4.0E-07
sp|Q9SZL4|ATL18_ARATH RING-H2 finger protein ATL18 OS=Arabidopsis thaliana GN=ATL18 PE=2 SV=1 438 487 4.0E-07
sp|Q9FKX5|NIPL1_ARATH NEP1-interacting protein-like 1 OS=Arabidopsis thaliana GN=ATL27 PE=2 SV=1 427 485 5.0E-07
sp|Q9M313|ATL68_ARATH RING-H2 finger protein ATL68 OS=Arabidopsis thaliana GN=ATL68 PE=2 SV=1 434 483 5.0E-07
sp|Q8LC69|ATL8_ARATH RING-H2 finger protein ATL8 OS=Arabidopsis thaliana GN=ATL8 PE=2 SV=2 429 487 5.0E-07
sp|Q9DBU5|RNF6_MOUSE E3 ubiquitin-protein ligase RNF6 OS=Mus musculus GN=Rnf6 PE=1 SV=1 436 489 5.0E-07
sp|Q8BI21|RNF38_MOUSE E3 ubiquitin-protein ligase RNF38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 438 484 6.0E-07
sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 438 484 7.0E-07
sp|O82353|ATL67_ARATH RING-H2 finger protein ATL67 OS=Arabidopsis thaliana GN=ATL67 PE=2 SV=1 437 483 7.0E-07
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 438 484 7.0E-07
sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 438 484 8.0E-07
sp|Q67YI6|ATL65_ARATH RING-H2 finger protein ATL65 OS=Arabidopsis thaliana GN=ATL65 PE=2 SV=2 438 493 8.0E-07
sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 438 484 9.0E-07
sp|Q8RXX9|ATL6_ARATH E3 ubiquitin-protein ligase ATL6 OS=Arabidopsis thaliana GN=ATL6 PE=1 SV=2 434 511 9.0E-07
sp|Q9XF63|ATL3_ARATH RING-H2 finger protein ATL3 OS=Arabidopsis thaliana GN=ATL3 PE=2 SV=1 438 487 9.0E-07
sp|Q9VE61|RN181_DROME E3 ubiquitin-protein ligase RNF181 homolog OS=Drosophila melanogaster GN=CG7694 PE=2 SV=1 422 485 1.0E-06
sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=1 SV=1 423 499 1.0E-06
sp|Q8LBA0|NIPL2_ARATH NEP1-interacting protein-like 2 OS=Arabidopsis thaliana GN=ATL24 PE=1 SV=2 428 483 1.0E-06
sp|Q5EAE9|ATL43_ARATH RING-H2 finger protein ATL43 OS=Arabidopsis thaliana GN=ATL43 PE=2 SV=2 438 494 1.0E-06
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 438 482 1.0E-06
sp|Q9SJJ7|ATL57_ARATH RING-H2 finger protein ATL57 OS=Arabidopsis thaliana GN=ATL57 PE=2 SV=1 422 484 2.0E-06
sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 438 486 2.0E-06
sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 438 486 2.0E-06
sp|Q9C7E9|ATL20_ARATH RING-H2 finger protein ATL20 OS=Arabidopsis thaliana GN=ATL20 PE=2 SV=2 438 483 2.0E-06
sp|Q9FL42|ATL69_ARATH Putative RING-H2 finger protein ATL69 OS=Arabidopsis thaliana GN=ATL69 PE=3 SV=1 438 483 2.0E-06
sp|Q9SUS4|RHA1A_ARATH RING-H2 zinc finger protein RHA1a OS=Arabidopsis thaliana GN=RHA1A PE=2 SV=1 436 486 2.0E-06
sp|Q9Y3C5|RNF11_HUMAN RING finger protein 11 OS=Homo sapiens GN=RNF11 PE=1 SV=1 438 495 3.0E-06
sp|Q08DI6|RNF11_BOVIN RING finger protein 11 OS=Bos taurus GN=RNF11 PE=2 SV=1 438 495 3.0E-06
sp|Q9QYK7|RNF11_MOUSE RING finger protein 11 OS=Mus musculus GN=Rnf11 PE=1 SV=1 438 495 3.0E-06
sp|Q9SK92|ATL15_ARATH E3 ubiquitin-protein ligase ATL15 OS=Arabidopsis thaliana GN=ATL15 PE=1 SV=1 433 488 3.0E-06
sp|Q9ZT49|ATL45_ARATH RING-H2 finger protein ATL45 OS=Arabidopsis thaliana GN=ATL45 PE=2 SV=1 438 486 3.0E-06
sp|Q8W571|ATL32_ARATH RING-H2 finger protein ATL32 OS=Arabidopsis thaliana GN=ATL32 PE=2 SV=3 438 536 3.0E-06
sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 436 486 3.0E-06
sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 436 486 3.0E-06
sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 438 486 3.0E-06
sp|Q9ZT50|RHA2A_ARATH E3 ubiquitin-protein ligase RHA2A OS=Arabidopsis thaliana GN=RHA2A PE=1 SV=1 438 487 4.0E-06
sp|Q9SUS5|RHA1B_ARATH E3 ubiquitin-protein ligase RHA1B OS=Arabidopsis thaliana GN=RHA1B PE=2 SV=1 436 486 4.0E-06
sp|P0CH30|RING1_GOSHI E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum GN=RING1 PE=1 SV=1 438 485 4.0E-06
sp|Q5RF74|RN128_PONAB E3 ubiquitin-protein ligase RNF128 OS=Pongo abelii GN=RNF128 PE=2 SV=1 436 519 4.0E-06
sp|Q9LUL6|ATL61_ARATH Putative RING-H2 finger protein ATL61 OS=Arabidopsis thaliana GN=ATL61 PE=3 SV=1 438 483 4.0E-06
sp|Q8BP31|RN122_MOUSE RING finger protein 122 OS=Mus musculus GN=Rnf122 PE=2 SV=1 436 483 5.0E-06
sp|Q9H9V4|RN122_HUMAN RING finger protein 122 OS=Homo sapiens GN=RNF122 PE=2 SV=2 436 483 5.0E-06
sp|Q9ZV51|ATL56_ARATH RING-H2 finger protein ATL56 OS=Arabidopsis thaliana GN=ATL56 PE=2 SV=1 438 503 5.0E-06
sp|Q8TEB7|RN128_HUMAN E3 ubiquitin-protein ligase RNF128 OS=Homo sapiens GN=RNF128 PE=1 SV=1 436 519 5.0E-06
sp|Q9SL78|ATL12_ARATH Putative RING-H2 finger protein ATL12 OS=Arabidopsis thaliana GN=ATL12 PE=3 SV=1 438 541 5.0E-06
sp|Q9CY62|RN181_MOUSE E3 ubiquitin-protein ligase RNF181 OS=Mus musculus GN=Rnf181 PE=1 SV=1 438 501 6.0E-06
sp|Q9D9X6|ZSWM2_MOUSE E3 ubiquitin-protein ligase Zswim2 OS=Mus musculus GN=Zswim2 PE=1 SV=1 438 483 6.0E-06
sp|Q9LZV8|ATL74_ARATH RING-H2 finger protein ATL74 OS=Arabidopsis thaliana GN=ATL74 PE=2 SV=1 438 486 6.0E-06
sp|Q9LRB7|EL5_ORYSJ E3 ubiquitin-protein ligase EL5 OS=Oryza sativa subsp. japonica GN=EL5.1 PE=1 SV=1 438 482 6.0E-06
sp|Q5XF85|ATL42_ARATH E3 ubiquitin-protein ligase ATL42 OS=Arabidopsis thaliana GN=ATL42 PE=1 SV=2 438 497 6.0E-06
sp|Q9D304|RN128_MOUSE E3 ubiquitin-protein ligase RNF128 OS=Mus musculus GN=Rnf128 PE=1 SV=1 436 519 7.0E-06
sp|P87237|YC0C_SCHPO Uncharacterized RING finger protein C4G3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4G3.12c PE=3 SV=1 407 482 7.0E-06
sp|Q9M0C3|ATL14_ARATH RING-H2 finger protein ATL14 OS=Arabidopsis thaliana GN=ATL14 PE=2 SV=1 434 482 7.0E-06
sp|O55176|PJA1_MOUSE E3 ubiquitin-protein ligase Praja-1 OS=Mus musculus GN=Pja1 PE=1 SV=3 432 485 7.0E-06
sp|Q80U04|PJA2_MOUSE E3 ubiquitin-protein ligase Praja-2 OS=Mus musculus GN=Pja2 PE=1 SV=2 432 485 7.0E-06
sp|O43164|PJA2_HUMAN E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens GN=PJA2 PE=1 SV=4 432 485 7.0E-06
sp|Q8L9T5|ATL2_ARATH RING-H2 finger protein ATL2 OS=Arabidopsis thaliana GN=ATL2 PE=2 SV=2 438 501 7.0E-06
sp|Q8WVZ7|RN133_HUMAN E3 ubiquitin-protein ligase RNF133 OS=Homo sapiens GN=RNF133 PE=2 SV=1 436 526 7.0E-06
sp|Q5R4R1|PJA2_PONAB E3 ubiquitin-protein ligase Praja-2 OS=Pongo abelii GN=PJA2 PE=2 SV=1 432 485 7.0E-06
sp|P87139|YDM9_SCHPO Uncharacterized RING finger protein C57A7.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.09 PE=1 SV=1 392 484 8.0E-06
sp|Q9FGJ6|ATL79_ARATH RING-H2 finger protein ATL79 OS=Arabidopsis thaliana GN=ATL79 PE=2 SV=1 431 487 8.0E-06
sp|P0C035|ATL60_ARATH RING-H2 finger protein ATL60 OS=Arabidopsis thaliana GN=ATL60 PE=2 SV=1 438 490 8.0E-06
sp|Q63364|PJA2_RAT E3 ubiquitin-protein ligase Praja-2 OS=Rattus norvegicus GN=Pja2 PE=2 SV=1 432 485 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0061630 ubiquitin protein ligase activity Yes
GO:0005680 anaphase-promoting complex Yes
GO:0097602 cullin family protein binding Yes
GO:0008270 zinc ion binding Yes
GO:0031145 anaphase-promoting complex-dependent catabolic process Yes
GO:0005488 binding No
GO:0005515 protein binding No
GO:0044265 cellular macromolecule catabolic process No
GO:0043169 cation binding No
GO:0140096 catalytic activity, acting on a protein No
GO:0046872 metal ion binding No
GO:0019538 protein metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0004842 ubiquitin-protein transferase activity No
GO:0044238 primary metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:1990234 transferase complex No
GO:0009056 catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process No
GO:0032991 protein-containing complex No
GO:0061659 ubiquitin-like protein ligase activity No
GO:0008152 metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0019941 modification-dependent protein catabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0030163 protein catabolic process No
GO:0008150 biological_process No
GO:0046914 transition metal ion binding No
GO:1902494 catalytic complex No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0043167 ion binding No
GO:0044237 cellular metabolic process No
GO:1901575 organic substance catabolic process No
GO:0000152 nuclear ubiquitin ligase complex No
GO:0006508 proteolysis No
GO:0009057 macromolecule catabolic process No
GO:0044248 cellular catabolic process No
GO:0071704 organic substance metabolic process No
GO:0000151 ubiquitin ligase complex No
GO:0140513 nuclear protein-containing complex No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0010498 proteasomal protein catabolic process No
GO:0019787 ubiquitin-like protein transferase activity No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:0140535 intracellular protein-containing complex No
GO:0009987 cellular process No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

Domain # Start End Length
1 246 268 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|046260
MVLLLLLLAALAAAYIPASPTNSTQDAIAGGLNITDISKLRLQWYSNGNYVENISYQLAGNGTSGISKGILIHFS
EESVNETIPPTSAPWIAMVSCDANATDASMDVDIFTLARDKGAVAALLYSLRSLACVINPEYANPATFDQVFDIF
STQSKTSARLIDYQFGQLAPANSSITKYDSQRLNNTAEAVRDSIQAGHATRPGFLYAELRAYNATGDTNDPVVTG
SNSGDSTGSGTGSKNTALAMIVLYAITGCVSALFCIVIISGAVRALRHPERYGPRARIGLDGPPQGRARGLTRAI
LDTFPIVKFGGSRDRPVDSAMDTANSIKDMEAQDISQWELLDITDAKRESTFKLDEVNATVGCTASQAIEMDDEK
TRLSRSSTPGPCSPQILPSREEDRGEGSSTPKPTSSKPQLSDKPGMMPVRHDLSPEAMGRETCPICIVDFEKGDD
IRVLPCEGKHRFHPECVDQWLLQLSSSCPICRQDFMALADMMSYEDDRESQELGIDGFEPDSPDEDRRSYHQSLS
PQRSASSPGSSRFSRYLHFASGRRNRRQQREQGAPVQEELVQEQSR*
Coding >Agabi119p4|046260
ATGGTACTCCTTCTCCTCCTCCTTGCCGCACTCGCCGCCGCCTATATCCCAGCCTCTCCCACAAATTCTACCCAG
GACGCCATTGCTGGTGGACTCAACATCACCGACATATCCAAACTTCGCCTCCAGTGGTATTCAAACGGTAATTAC
GTTGAAAACATCTCTTATCAACTCGCTGGCAATGGTACTAGTGGTATCAGTAAGGGCATTTTGATTCATTTTTCC
GAAGAGTCCGTCAATGAAACGATCCCACCGACGTCTGCACCCTGGATTGCAATGGTCTCTTGCGATGCCAACGCC
ACCGATGCATCAATGGATGTCGATATCTTCACCCTGGCACGCGACAAGGGTGCAGTCGCAGCTTTGTTGTATTCT
CTGCGTTCGCTCGCTTGTGTAATTAATCCAGAATATGCGAACCCGGCAACTTTCGATCAGGTCTTCGATATTTTT
TCGACCCAAAGCAAAACCAGCGCCCGCCTCATTGATTATCAGTTCGGTCAGCTGGCACCGGCGAACAGCAGCATC
ACCAAATATGATTCACAGCGCCTCAATAACACGGCGGAGGCTGTTAGAGACTCCATTCAGGCCGGTCATGCCACG
CGGCCAGGGTTTCTGTACGCGGAATTGCGAGCATACAATGCTACCGGAGATACGAACGATCCTGTCGTCACTGGT
TCGAATAGTGGGGACTCGACTGGGAGTGGCACTGGTTCCAAAAATACTGCGCTTGCAATGATAGTTCTCTATGCG
ATCACCGGGTGTGTCTCCGCCCTTTTTTGCATTGTGATCATTTCAGGAGCCGTTCGTGCACTACGTCATCCTGAA
CGTTACGGACCCCGGGCCAGAATCGGCTTAGATGGTCCACCACAGGGTCGCGCCAGGGGTCTCACTCGTGCCATA
CTTGACACGTTTCCTATTGTCAAGTTTGGAGGGAGCCGTGACAGACCAGTTGATTCCGCCATGGATACGGCAAAT
TCTATTAAGGATATGGAGGCTCAGGACATCAGCCAGTGGGAGCTTCTGGACATTACGGACGCTAAGAGGGAGAGC
ACATTTAAACTCGATGAGGTCAATGCAACTGTGGGTTGTACGGCCAGTCAGGCCATTGAAATGGACGATGAGAAG
ACTAGGCTATCGCGGTCTTCGACGCCAGGCCCTTGTTCTCCACAGATTTTACCTTCTCGAGAAGAGGACCGTGGA
GAAGGATCTTCTACCCCGAAACCGACTTCTTCAAAGCCTCAACTGTCTGACAAACCGGGTATGATGCCCGTACGA
CATGACTTGAGCCCCGAGGCGATGGGGCGCGAGACGTGTCCTATCTGTATTGTCGATTTTGAGAAAGGCGACGAC
ATACGAGTATTGCCCTGTGAAGGCAAACACCGATTTCATCCAGAATGTGTCGACCAATGGTTGCTCCAGTTGTCC
AGTTCTTGCCCTATATGTCGTCAAGATTTCATGGCGCTTGCTGACATGATGTCATATGAAGACGACAGAGAAAGC
CAAGAACTTGGTATTGATGGTTTTGAACCAGATTCACCGGACGAAGACAGGCGCTCATACCATCAATCTCTGAGC
CCACAGCGGTCCGCCTCCTCACCTGGAAGTAGTCGATTCTCGCGGTACCTGCATTTCGCATCTGGCAGACGTAAT
CGACGCCAGCAGAGAGAACAAGGCGCCCCAGTGCAGGAGGAATTAGTGCAAGAACAGAGTCGATAG
Transcript >Agabi119p4|046260
ATGGTACTCCTTCTCCTCCTCCTTGCCGCACTCGCCGCCGCCTATATCCCAGCCTCTCCCACAAATTCTACCCAG
GACGCCATTGCTGGTGGACTCAACATCACCGACATATCCAAACTTCGCCTCCAGTGGTATTCAAACGGTAATTAC
GTTGAAAACATCTCTTATCAACTCGCTGGCAATGGTACTAGTGGTATCAGTAAGGGCATTTTGATTCATTTTTCC
GAAGAGTCCGTCAATGAAACGATCCCACCGACGTCTGCACCCTGGATTGCAATGGTCTCTTGCGATGCCAACGCC
ACCGATGCATCAATGGATGTCGATATCTTCACCCTGGCACGCGACAAGGGTGCAGTCGCAGCTTTGTTGTATTCT
CTGCGTTCGCTCGCTTGTGTAATTAATCCAGAATATGCGAACCCGGCAACTTTCGATCAGGTCTTCGATATTTTT
TCGACCCAAAGCAAAACCAGCGCCCGCCTCATTGATTATCAGTTCGGTCAGCTGGCACCGGCGAACAGCAGCATC
ACCAAATATGATTCACAGCGCCTCAATAACACGGCGGAGGCTGTTAGAGACTCCATTCAGGCCGGTCATGCCACG
CGGCCAGGGTTTCTGTACGCGGAATTGCGAGCATACAATGCTACCGGAGATACGAACGATCCTGTCGTCACTGGT
TCGAATAGTGGGGACTCGACTGGGAGTGGCACTGGTTCCAAAAATACTGCGCTTGCAATGATAGTTCTCTATGCG
ATCACCGGGTGTGTCTCCGCCCTTTTTTGCATTGTGATCATTTCAGGAGCCGTTCGTGCACTACGTCATCCTGAA
CGTTACGGACCCCGGGCCAGAATCGGCTTAGATGGTCCACCACAGGGTCGCGCCAGGGGTCTCACTCGTGCCATA
CTTGACACGTTTCCTATTGTCAAGTTTGGAGGGAGCCGTGACAGACCAGTTGATTCCGCCATGGATACGGCAAAT
TCTATTAAGGATATGGAGGCTCAGGACATCAGCCAGTGGGAGCTTCTGGACATTACGGACGCTAAGAGGGAGAGC
ACATTTAAACTCGATGAGGTCAATGCAACTGTGGGTTGTACGGCCAGTCAGGCCATTGAAATGGACGATGAGAAG
ACTAGGCTATCGCGGTCTTCGACGCCAGGCCCTTGTTCTCCACAGATTTTACCTTCTCGAGAAGAGGACCGTGGA
GAAGGATCTTCTACCCCGAAACCGACTTCTTCAAAGCCTCAACTGTCTGACAAACCGGGTATGATGCCCGTACGA
CATGACTTGAGCCCCGAGGCGATGGGGCGCGAGACGTGTCCTATCTGTATTGTCGATTTTGAGAAAGGCGACGAC
ATACGAGTATTGCCCTGTGAAGGCAAACACCGATTTCATCCAGAATGTGTCGACCAATGGTTGCTCCAGTTGTCC
AGTTCTTGCCCTATATGTCGTCAAGATTTCATGGCGCTTGCTGACATGATGTCATATGAAGACGACAGAGAAAGC
CAAGAACTTGGTATTGATGGTTTTGAACCAGATTCACCGGACGAAGACAGGCGCTCATACCATCAATCTCTGAGC
CCACAGCGGTCCGCCTCCTCACCTGGAAGTAGTCGATTCTCGCGGTACCTGCATTTCGCATCTGGCAGACGTAAT
CGACGCCAGCAGAGAGAACAAGGCGCCCCAGTGCAGGAGGAATTAGTGCAAGAACAGAGTCGATAG
Gene >Agabi119p4|046260
ATGGTACTCCTTCTCCTCCTCCTTGCCGCACTCGCCGCCGCCTATATCCCAGCCTCTCCCACAAATTCTACCCAG
GACGCCATTGCTGGTGGACTCAACATCACCGACATATCCAAACTTCGCCTCCAGTGGTATTCAAACGGGTCCGTG
CCCACCCCCTTTCTCCAGCAGAGACTTCTCACAGTGTTGCAGTAATTACGTTGAAAACATCTCTTATCAACTCGC
TGGCAATGGTACTAGTGGTATCAGTAAGGTACACCGCGGCTCCCATCTCCTTTGTCTCGCTTTCCTCATTTCCCC
GTCTTTCCAAAGGGCATTTTGATTCATTTTTCCGAAGAGTCCGTCAATGAAACGATCCCACCGAGTGCGCCTTCC
GAAAAACCCTCGTAGTGCCAATGTTGATCAGAAGATTTAGCGTCTGCACCCTGGATTGCAATGGTCTCTTGCGAT
GCCAACGCCACCGATGCATCAATGGATGTCGATATCTTCACCCTGGCACGCGACAAGGGTGCAGTCGCAGCTGTA
TGTTTATCTCGGCTTAGCCGACATATCTTTTACTCACGACATGTCGTCACCCATTTAGTTGTTGTATTCTCTGCG
TTCGCTCGCTTGTGTAATTAATCCAGAATATGCGAACCCGGCAACTTTCGATCAGGTCTTCGATATTTTTTCGAC
CCAAAGCAAAACCAGCGCCCGCCTCATTGATTATCAGTTCGGTCAGCTGGCACCGGCGAACAGCAGCATCACCAA
ATATGATTCACAGCGCCTCAATAACACGGCGGAGGCTGTTAGAGACTCCATTCAGGCCGGTCATGCCACGCGGCC
AGGGTTTCTGTACGCGGAATTGCGAGCATACAATGCTACCGGAGATACGAACGATCCTGTCGTCACTGGTTCGAA
TAGTGGGGACTCGACTGGGAGTGGCACTGGTTCCAAAAATACTGCGCTTGCAATGTGAGTTTCAGTCGTCGATGC
AAACCTCAGCCAACTGATGAACTATGTATGGCTTTTTGATCCCTATCAGGATAGTTCTCTATGCGATCACCGGGT
GTGTCTCCGCCCTTTTTTGCATTGTGATCATTTCAGGAGTACGTTCTGTTTTTCTCCATGCAACCCATCATCATT
AACTTCGTTCTCCTTAATGATCAGGCCGTTCGTGCACTACGTCATCCTGAACGTTACGGACCCCGGGCCAGAATC
GGCTTAGATGGTCCACCACAGGGTCGCGCCAGGGGTCTCACTCGTGCCATACTTGACACGTTTCCTATTGTCAAG
TTTGGAGGGAGCCGTGACAGACCAGTTGATTCCGCCATGGATACGGCAAATTCTATTAAGGATATGGAGGCTCAG
GACATCAGCCAGTGGGAGCTTCTGGACATTACGGACGCTAAGAGGGAGAGCACATTTAAACTCGATGAGGTCAAT
GCAACTGTGGGTTGTACGGCCAGTCAGGCCATTGAAATGGACGATGAGAAGACTAGGCTATCGCGGTCTTCGACG
CCAGGCCCTTGTTCTCCACAGATTTTACCTTCTCGAGAAGAGGACCGTGGAGAAGGATCTTCTACCCCGAAACCG
ACTTCTTCAAAGCCTCAACTGTCTGACAAACCGGGTATGATGCCCGTACGACATGACTTGAGCCCCGAGGCGATG
GGGCGCGAGACGTGTCCTATCTGTATTGTCGATTTTGAGAAAGGCGACGACATACGAGTATTGCCCTGTGAAGGC
AAACACCGATTTCATCCAGAATGTGTCGACCAATGGTTGCTCCAGTTGTCCAGTTCTTGCCCTATATGTCGTCAA
GGTGTGTTAATCAGTTGCAACACATCGTTCTCTTTGCCATCTACTGATGCAATCTTATGACAGATTTCATGGCGC
TTGCTGACATGATGTCATATGAAGACGACAGAGAAAGCCAAGAACTTGGTATTGATGGTTTTGAACCAGATTCAC
CGGACGAAGACAGGCGCTCATACCATCAATCTCTGAGCCCACAGCGGTCCGCCTCCTCACCTGGAAGTAGTCGAT
TCTCGCGGTACCTGCATTTCGCATCTGGCAGACGTAATCGACGCCAGCAGAGAGAACAAGGCGCCCCAGTGCAGG
AGGAATTAGTGCAAGAACAGAGTCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail