Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|046250
Gene name
Locationscaffold_02:1775039..1776706
Strand+
Gene length (bp)1667
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01979 Amidohydro_1 Amidohydrolase family 2.8E-30 67 452

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32375|ALN_YEAST Allantoinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL1 PE=3 SV=2 6 458 1.0E-141
sp|Q54SV3|ALN1_DICDI Probable allantoinase 1 OS=Dictyostelium discoideum GN=allB1 PE=3 SV=1 67 455 3.0E-126
sp|P40757|ALN_LITCT Allantoinase, mitochondrial OS=Lithobates catesbeiana GN=ALN PE=1 SV=1 27 413 2.0E-116
sp|B9FDB8|ALN_ORYSJ Probable allantoinase OS=Oryza sativa subsp. japonica GN=ALN PE=2 SV=1 61 462 4.0E-114
sp|Q9RKU5|ALLB_STRCO Allantoinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=allB PE=3 SV=1 62 469 4.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32375|ALN_YEAST Allantoinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL1 PE=3 SV=2 6 458 1.0E-141
sp|Q54SV3|ALN1_DICDI Probable allantoinase 1 OS=Dictyostelium discoideum GN=allB1 PE=3 SV=1 67 455 3.0E-126
sp|P40757|ALN_LITCT Allantoinase, mitochondrial OS=Lithobates catesbeiana GN=ALN PE=1 SV=1 27 413 2.0E-116
sp|B9FDB8|ALN_ORYSJ Probable allantoinase OS=Oryza sativa subsp. japonica GN=ALN PE=2 SV=1 61 462 4.0E-114
sp|Q9RKU5|ALLB_STRCO Allantoinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=allB PE=3 SV=1 62 469 4.0E-114
sp|Q82LL4|ALLB_STRAW Allantoinase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=allB PE=3 SV=1 5 469 1.0E-113
sp|Q94AP0|ALN_ARATH Allantoinase OS=Arabidopsis thaliana GN=ALN PE=1 SV=1 61 453 6.0E-112
sp|Q55C91|ALN2_DICDI Probable allantoinase 2 OS=Dictyostelium discoideum GN=allB2 PE=3 SV=1 65 455 2.0E-107
sp|Q1J391|ALLB_DEIGD Allantoinase OS=Deinococcus geothermalis (strain DSM 11300) GN=allB PE=3 SV=1 61 453 5.0E-84
sp|Q7CR08|ALLB_SALTY Allantoinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=allB PE=3 SV=1 61 469 8.0E-81
sp|Q8XGS6|ALLB_SALTI Allantoinase OS=Salmonella typhi GN=allB PE=3 SV=1 61 469 8.0E-81
sp|B5BD11|ALLB_SALPK Allantoinase OS=Salmonella paratyphi A (strain AKU_12601) GN=allB PE=3 SV=1 61 469 8.0E-81
sp|Q5PCG0|ALLB_SALPA Allantoinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=allB PE=3 SV=1 61 469 8.0E-81
sp|B4SXM8|ALLB_SALNS Allantoinase OS=Salmonella newport (strain SL254) GN=allB PE=3 SV=1 61 469 8.0E-81
sp|B4T9L5|ALLB_SALHS Allantoinase OS=Salmonella heidelberg (strain SL476) GN=allB PE=3 SV=1 61 469 8.0E-81
sp|B5QUT6|ALLB_SALEP Allantoinase OS=Salmonella enteritidis PT4 (strain P125109) GN=allB PE=3 SV=1 61 469 8.0E-81
sp|B5FLN3|ALLB_SALDC Allantoinase OS=Salmonella dublin (strain CT_02021853) GN=allB PE=3 SV=1 61 469 8.0E-81
sp|B5EYC3|ALLB_SALA4 Allantoinase OS=Salmonella agona (strain SL483) GN=allB PE=3 SV=1 61 469 8.0E-81
sp|Q57S43|ALLB_SALCH Allantoinase OS=Salmonella choleraesuis (strain SC-B67) GN=allB PE=3 SV=1 61 469 8.0E-81
sp|A9MW45|ALLB_SALPB Allantoinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=allB PE=3 SV=1 61 469 3.0E-80
sp|B5R646|ALLB_SALG2 Allantoinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=allB PE=3 SV=1 61 469 2.0E-79
sp|Q9KAH8|ALLB_BACHD Allantoinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=allB PE=1 SV=1 44 453 2.0E-79
sp|Q5WBJ6|ALLB_BACSK Allantoinase OS=Bacillus clausii (strain KSM-K16) GN=allB PE=3 SV=1 61 469 2.0E-79
sp|Q65LN0|ALLB_BACLD Allantoinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=allB PE=3 SV=1 58 469 5.0E-79
sp|A7ZIR8|ALLB_ECO24 Allantoinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=allB PE=3 SV=1 61 469 5.0E-79
sp|Q1RF23|ALLB_ECOUT Allantoinase OS=Escherichia coli (strain UTI89 / UPEC) GN=allB PE=3 SV=1 61 469 8.0E-79
sp|Q8FK60|ALLB_ECOL6 Allantoinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=allB PE=3 SV=1 61 469 8.0E-79
sp|Q0TKD0|ALLB_ECOL5 Allantoinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=allB PE=3 SV=1 61 469 8.0E-79
sp|A1A8H7|ALLB_ECOK1 Allantoinase OS=Escherichia coli O1:K1 / APEC GN=allB PE=3 SV=1 61 469 8.0E-79
sp|B7MQM2|ALLB_ECO81 Allantoinase OS=Escherichia coli O81 (strain ED1a) GN=allB PE=3 SV=1 61 469 8.0E-79
sp|B7ME34|ALLB_ECO45 Allantoinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=allB PE=3 SV=1 61 469 8.0E-79
sp|B7UKI9|ALLB_ECO27 Allantoinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=allB PE=3 SV=1 61 469 8.0E-79
sp|B1IZ89|ALLB_ECOLC Allantoinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=allB PE=3 SV=1 61 469 1.0E-78
sp|B1LKD0|ALLB_ECOSM Allantoinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=allB PE=3 SV=1 61 469 1.0E-78
sp|P77671|ALLB_ECOLI Allantoinase OS=Escherichia coli (strain K12) GN=allB PE=1 SV=1 61 469 2.0E-78
sp|B1XGB0|ALLB_ECODH Allantoinase OS=Escherichia coli (strain K12 / DH10B) GN=allB PE=3 SV=1 61 469 2.0E-78
sp|C4ZUW1|ALLB_ECOBW Allantoinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=allB PE=3 SV=1 61 469 2.0E-78
sp|B6I0G2|ALLB_ECOSE Allantoinase OS=Escherichia coli (strain SE11) GN=allB PE=3 SV=1 61 469 2.0E-78
sp|B7M4L5|ALLB_ECO8A Allantoinase OS=Escherichia coli O8 (strain IAI1) GN=allB PE=3 SV=1 61 469 2.0E-78
sp|B7L7D8|ALLB_ECO55 Allantoinase OS=Escherichia coli (strain 55989 / EAEC) GN=allB PE=3 SV=1 61 469 2.0E-78
sp|B7N966|ALLB_ECOLU Allantoinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=allB PE=3 SV=1 61 469 5.0E-78
sp|A7ZXG5|ALLB_ECOHS Allantoinase OS=Escherichia coli O9:H4 (strain HS) GN=allB PE=3 SV=1 61 469 5.0E-78
sp|Q82ZQ1|ALLB_ENTFA Allantoinase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=allB PE=3 SV=1 61 458 5.0E-77
sp|O32137|ALLB_BACSU Allantoinase OS=Bacillus subtilis (strain 168) GN=allB PE=2 SV=1 61 469 1.0E-76
sp|B8G120|ALLB_DESHD Allantoinase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=allB PE=3 SV=1 27 453 2.0E-76
sp|Q24PT9|ALLB_DESHY Allantoinase OS=Desulfitobacterium hafniense (strain Y51) GN=allB PE=3 SV=1 27 453 2.0E-75
sp|A7Z8F5|ALLB_BACMF Allantoinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=allB PE=3 SV=1 54 462 1.0E-74
sp|Q1AS71|ALLB_RUBXD Allantoinase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=allB PE=3 SV=1 61 469 2.0E-74
sp|Q9RV76|ALLB_DEIRA Allantoinase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=allB PE=3 SV=1 58 469 1.0E-70
sp|Q02C42|ALLB_SOLUE Allantoinase OS=Solibacter usitatus (strain Ellin6076) GN=allB PE=3 SV=1 61 456 7.0E-70
sp|Q03HB2|PYRC_PEDPA Dihydroorotase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=pyrC PE=3 SV=1 42 456 4.0E-43
sp|P81006|HYDL_ARTAU L-hydantoinase OS=Arthrobacter aurescens GN=lhyD PE=1 SV=1 38 455 9.0E-43
sp|Q6HES6|PYRC_BACHK Dihydroorotase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pyrC PE=3 SV=1 32 458 2.0E-42
sp|C1EPQ2|PYRC_BACC3 Dihydroorotase OS=Bacillus cereus (strain 03BB102) GN=pyrC PE=3 SV=1 32 458 2.0E-42
sp|B7JJX5|PYRC_BACC0 Dihydroorotase OS=Bacillus cereus (strain AH820) GN=pyrC PE=3 SV=1 32 458 3.0E-42
sp|Q81WF0|PYRC_BACAN Dihydroorotase OS=Bacillus anthracis GN=pyrC PE=1 SV=1 32 458 3.0E-42
sp|C3L738|PYRC_BACAC Dihydroorotase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pyrC PE=3 SV=1 32 458 3.0E-42
sp|C3P658|PYRC_BACAA Dihydroorotase OS=Bacillus anthracis (strain A0248) GN=pyrC PE=3 SV=1 32 458 3.0E-42
sp|Q636D8|PYRC_BACCZ Dihydroorotase OS=Bacillus cereus (strain ZK / E33L) GN=pyrC PE=3 SV=1 32 458 7.0E-42
sp|A0RHR0|PYRC_BACAH Dihydroorotase OS=Bacillus thuringiensis (strain Al Hakam) GN=pyrC PE=3 SV=1 32 458 7.0E-42
sp|B9IVW5|PYRC_BACCQ Dihydroorotase OS=Bacillus cereus (strain Q1) GN=pyrC PE=3 SV=1 32 458 7.0E-42
sp|B7HLM2|PYRC_BACC7 Dihydroorotase OS=Bacillus cereus (strain AH187) GN=pyrC PE=3 SV=1 32 458 7.0E-42
sp|Q732I1|PYRC_BACC1 Dihydroorotase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pyrC PE=3 SV=1 32 458 7.0E-42
sp|B7H6M4|PYRC_BACC4 Dihydroorotase OS=Bacillus cereus (strain B4264) GN=pyrC PE=3 SV=1 32 458 3.0E-41
sp|Q819S1|PYRC_BACCR Dihydroorotase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pyrC PE=3 SV=1 32 458 3.0E-41
sp|A7GRL3|PYRC_BACCN Dihydroorotase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pyrC PE=3 SV=1 39 458 4.0E-41
sp|Q5FJB8|PYRC_LACAC Dihydroorotase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pyrC PE=3 SV=1 61 455 9.0E-41
sp|A9VTC8|PYRC_BACWK Dihydroorotase OS=Bacillus weihenstephanensis (strain KBAB4) GN=pyrC PE=3 SV=1 47 458 2.0E-40
sp|B7IUP8|PYRC_BACC2 Dihydroorotase OS=Bacillus cereus (strain G9842) GN=pyrC PE=3 SV=1 32 458 4.0E-40
sp|Q1G867|PYRC_LACDA Dihydroorotase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=pyrC PE=3 SV=1 61 455 2.0E-39
sp|A8YVZ5|PYRC_LACH4 Dihydroorotase OS=Lactobacillus helveticus (strain DPC 4571) GN=pyrC PE=3 SV=1 61 455 3.0E-39
sp|Q047M6|PYRC_LACDB Dihydroorotase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=pyrC PE=3 SV=1 61 455 7.0E-39
sp|Q8PVF4|PYRC_METMA Dihydroorotase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pyrC PE=3 SV=1 21 469 2.0E-38
sp|O69809|HYDA_STRCO D-hydantoinase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=hyuA PE=3 SV=1 25 462 2.0E-38
sp|Q2NHZ6|PYRC_METST Dihydroorotase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=pyrC PE=3 SV=1 32 452 7.0E-38
sp|Q5WFJ0|PYRC_BACSK Dihydroorotase OS=Bacillus clausii (strain KSM-K16) GN=pyrC PE=3 SV=1 54 456 7.0E-38
sp|Q8TSA6|PYRC_METAC Dihydroorotase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pyrC PE=3 SV=1 21 469 8.0E-38
sp|Q5L0U5|PYRC_GEOKA Dihydroorotase OS=Geobacillus kaustophilus (strain HTA426) GN=pyrC PE=3 SV=1 54 455 1.0E-37
sp|B7GFA5|PYRC_ANOFW Dihydroorotase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=pyrC PE=3 SV=1 27 458 1.0E-37
sp|P46538|PYRC_BACCL Dihydroorotase OS=Bacillus caldolyticus GN=pyrC PE=3 SV=1 61 455 2.0E-37
sp|P77884|PYRC_LACPL Dihydroorotase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pyrC PE=3 SV=2 61 456 3.0E-37
sp|Q1WVB1|PYRC_LACS1 Dihydroorotase OS=Lactobacillus salivarius (strain UCC118) GN=pyrC PE=3 SV=1 61 456 8.0E-37
sp|A4IM31|PYRC_GEOTN Dihydroorotase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=pyrC PE=3 SV=1 54 455 1.0E-36
sp|Q2GL89|PYRC_ANAPZ Dihydroorotase OS=Anaplasma phagocytophilum (strain HZ) GN=pyrC PE=3 SV=1 61 456 2.0E-36
sp|Q38X26|PYRC_LACSS Dihydroorotase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pyrC PE=3 SV=1 47 455 2.0E-36
sp|Q5HPZ0|PYRC_STAEQ Dihydroorotase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pyrC PE=3 SV=1 29 456 6.0E-36
sp|Q74J32|PYRC_LACJO Dihydroorotase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=pyrC PE=3 SV=1 61 455 2.0E-35
sp|Q8CPJ6|PYRC_STAES Dihydroorotase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pyrC PE=3 SV=1 29 456 4.0E-35
sp|B9EB67|PYRC_MACCJ Dihydroorotase OS=Macrococcus caseolyticus (strain JCSC5402) GN=pyrC PE=3 SV=1 61 453 5.0E-35
sp|Q9K9V7|PYRC_BACHD Dihydroorotase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrC PE=3 SV=1 58 456 1.0E-34
sp|Q8R9R6|PYRC_CALS4 Dihydroorotase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pyrC PE=3 SV=1 54 455 4.0E-34
sp|Q043B0|PYRC_LACGA Dihydroorotase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=pyrC PE=3 SV=1 51 455 4.0E-34
sp|B0K2E8|PYRC_THEPX Dihydroorotase OS=Thermoanaerobacter sp. (strain X514) GN=pyrC PE=3 SV=1 61 456 5.0E-34
sp|B0KA35|PYRC_THEP3 Dihydroorotase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=pyrC PE=3 SV=1 61 456 5.0E-34
sp|C0R5K8|PYRC_WOLWR Dihydroorotase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=pyrC PE=3 SV=1 46 457 5.0E-34
sp|Q39US3|PYRC_GEOMG Dihydroorotase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pyrC PE=3 SV=2 26 455 1.0E-33
sp|Q45515|HYDA_GEOSE D-hydantoinase OS=Geobacillus stearothermophilus PE=1 SV=1 54 452 2.0E-33
sp|Q834E0|PYRC_ENTFA Dihydroorotase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pyrC PE=3 SV=1 54 457 3.0E-33
sp|Q1R7F8|PHYDA_ECOUT D-phenylhydantoinase OS=Escherichia coli (strain UTI89 / UPEC) GN=hyuA PE=3 SV=2 61 469 7.0E-33
sp|A1AF64|PHYDA_ECOK1 D-phenylhydantoinase OS=Escherichia coli O1:K1 / APEC GN=hyuA PE=3 SV=1 61 469 7.0E-33
sp|B7MM60|PHYDA_ECO45 D-phenylhydantoinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=hyuA PE=3 SV=1 61 469 7.0E-33
sp|Q3YRI2|PYRC_EHRCJ Dihydroorotase OS=Ehrlichia canis (strain Jake) GN=pyrC PE=3 SV=1 55 453 7.0E-33
sp|A0AJU2|PYRC_LISW6 Dihydroorotase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=pyrC PE=3 SV=1 61 453 7.0E-33
sp|B7UHS3|PHYDA_ECO27 D-phenylhydantoinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=hyuA PE=3 SV=1 61 469 1.0E-32
sp|Q97LN7|PYRC_CLOAB Dihydroorotase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pyrC PE=3 SV=1 26 454 1.0E-32
sp|B9M4S4|PYRC_GEODF Dihydroorotase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=pyrC PE=3 SV=1 58 456 1.0E-32
sp|B8DDR5|PYRC_LISMH Dihydroorotase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=pyrC PE=3 SV=1 61 455 2.0E-32
sp|Q8Y663|PYRC_LISMO Dihydroorotase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pyrC PE=3 SV=1 61 455 3.0E-32
sp|B2GD08|PYRC_LACF3 Dihydroorotase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=pyrC PE=3 SV=1 63 456 3.0E-32
sp|C0QJ54|PYRC_DESAH Dihydroorotase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=pyrC PE=3 SV=1 53 456 3.0E-32
sp|Q9KXR3|PYRC_STRCO Dihydroorotase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=pyrC PE=3 SV=1 58 450 3.0E-32
sp|Q92AH1|PYRC_LISIN Dihydroorotase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pyrC PE=3 SV=1 61 455 3.0E-32
sp|B5EB50|PYRC_GEOBB Dihydroorotase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=pyrC PE=3 SV=1 61 453 3.0E-32
sp|Q8FE90|PHYDA_ECOL6 D-phenylhydantoinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=hyuA PE=3 SV=2 61 469 4.0E-32
sp|Q0TDX8|PHYDA_ECOL5 D-phenylhydantoinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=hyuA PE=3 SV=1 61 469 4.0E-32
sp|B3E3I1|PYRC_GEOLS Dihydroorotase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=pyrC PE=3 SV=1 58 453 4.0E-32
sp|C5D8P8|PYRC_GEOSW Dihydroorotase OS=Geobacillus sp. (strain WCH70) GN=pyrC PE=3 SV=1 61 455 5.0E-32
sp|A5GF42|PYRC_GEOUR Dihydroorotase OS=Geobacter uraniireducens (strain Rf4) GN=pyrC PE=3 SV=1 58 453 5.0E-32
sp|A5D1A4|PYRC_PELTS Dihydroorotase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pyrC PE=3 SV=1 29 452 5.0E-32
sp|B7N7B8|PHYDA_ECOLU D-phenylhydantoinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=hyuA PE=3 SV=1 29 469 5.0E-32
sp|B1GYY7|PYRC_UNCTG Dihydroorotase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=pyrC PE=3 SV=1 61 453 7.0E-32
sp|P25995|PYRC_BACSU Dihydroorotase OS=Bacillus subtilis (strain 168) GN=pyrC PE=3 SV=2 59 455 7.0E-32
sp|B7NW14|PHYDA_ECO7I D-phenylhydantoinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=hyuA PE=3 SV=1 29 469 7.0E-32
sp|B7MZ27|PHYDA_ECO81 D-phenylhydantoinase OS=Escherichia coli O81 (strain ED1a) GN=hyuA PE=3 SV=1 61 469 7.0E-32
sp|P65907|PYRC_STAAW Dihydroorotase OS=Staphylococcus aureus (strain MW2) GN=pyrC PE=1 SV=1 21 454 8.0E-32
sp|Q6GA12|PYRC_STAAS Dihydroorotase OS=Staphylococcus aureus (strain MSSA476) GN=pyrC PE=3 SV=1 21 454 8.0E-32
sp|P65906|PYRC_STAAN Dihydroorotase OS=Staphylococcus aureus (strain N315) GN=pyrC PE=1 SV=1 21 454 8.0E-32
sp|P65905|PYRC_STAAM Dihydroorotase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pyrC PE=3 SV=1 21 454 8.0E-32
sp|Q5HGN1|PYRC_STAAC Dihydroorotase OS=Staphylococcus aureus (strain COL) GN=pyrC PE=3 SV=1 21 454 8.0E-32
sp|Q74DP4|PYRC_GEOSL Dihydroorotase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=pyrC PE=3 SV=1 26 455 9.0E-32
sp|Q6GHN4|PYRC_STAAR Dihydroorotase OS=Staphylococcus aureus (strain MRSA252) GN=pyrC PE=3 SV=1 21 454 1.0E-31
sp|C6DZ51|PYRC_GEOSM Dihydroorotase OS=Geobacter sp. (strain M21) GN=pyrC PE=3 SV=1 61 453 1.0E-31
sp|Q31WE3|PHYDA_SHIBS D-phenylhydantoinase OS=Shigella boydii serotype 4 (strain Sb227) GN=hyuA PE=3 SV=2 29 469 1.0E-31
sp|B1ITC8|PHYDA_ECOLC D-phenylhydantoinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=hyuA PE=3 SV=1 29 469 1.0E-31
sp|B7LYD8|PHYDA_ECO8A D-phenylhydantoinase OS=Escherichia coli O8 (strain IAI1) GN=hyuA PE=3 SV=1 29 469 1.0E-31
sp|Q8XD79|PHYDA_ECO57 D-phenylhydantoinase OS=Escherichia coli O157:H7 GN=hyuA PE=3 SV=2 29 469 1.0E-31
sp|A7ZQY1|PHYDA_ECO24 D-phenylhydantoinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=hyuA PE=3 SV=1 29 469 1.0E-31
sp|Q71YH9|PYRC_LISMF Dihydroorotase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pyrC PE=3 SV=1 61 455 1.0E-31
sp|Q46806|PHYDA_ECOLI D-phenylhydantoinase OS=Escherichia coli (strain K12) GN=hyuA PE=1 SV=2 29 469 2.0E-31
sp|B1XEG2|PHYDA_ECODH D-phenylhydantoinase OS=Escherichia coli (strain K12 / DH10B) GN=hyuA PE=3 SV=1 29 469 2.0E-31
sp|C5A0E6|PHYDA_ECOBW D-phenylhydantoinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=hyuA PE=3 SV=1 29 469 2.0E-31
sp|B7LF59|PHYDA_ECO55 D-phenylhydantoinase OS=Escherichia coli (strain 55989 / EAEC) GN=hyuA PE=3 SV=1 29 469 2.0E-31
sp|C1KWD6|PYRC_LISMC Dihydroorotase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=pyrC PE=3 SV=1 61 455 2.0E-31
sp|Q9HMH9|PYRC_HALSA Dihydroorotase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pyrC PE=3 SV=1 60 469 3.0E-31
sp|Q5GSJ0|PYRC_WOLTR Dihydroorotase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=pyrC PE=3 SV=1 67 456 3.0E-31
sp|B6I707|PHYDA_ECOSE D-phenylhydantoinase OS=Escherichia coli (strain SE11) GN=hyuA PE=3 SV=1 29 469 4.0E-31
sp|A8A415|PHYDA_ECOHS D-phenylhydantoinase OS=Escherichia coli O9:H4 (strain HS) GN=hyuA PE=3 SV=1 29 469 5.0E-31
sp|Q65JU9|PYRC_BACLD Dihydroorotase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pyrC PE=3 SV=1 59 453 6.0E-31
sp|Q2GH90|PYRC_EHRCR Dihydroorotase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=pyrC PE=3 SV=1 55 456 2.0E-30
sp|B1HQB9|PYRC_LYSSC Dihydroorotase OS=Lysinibacillus sphaericus (strain C3-41) GN=pyrC PE=3 SV=1 33 453 2.0E-30
sp|P96081|PYRC_THEAQ Dihydroorotase OS=Thermus aquaticus GN=pyrC PE=3 SV=1 61 454 2.0E-30
sp|Q9UXV6|PYRC_PYRAB Dihydroorotase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pyrC PE=3 SV=1 66 466 3.0E-30
sp|Q2LVI3|PYRC_SYNAS Dihydroorotase OS=Syntrophus aciditrophicus (strain SB) GN=pyrC PE=3 SV=1 61 456 3.0E-30
sp|B2KCN5|PYRC_ELUMP Dihydroorotase OS=Elusimicrobium minutum (strain Pei191) GN=pyrC PE=3 SV=1 11 451 6.0E-30
sp|A4XKT2|PYRC_CALS8 Dihydroorotase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=pyrC PE=3 SV=1 26 452 1.0E-29
sp|O57740|PYRC_PYRHO Dihydroorotase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pyrC PE=3 SV=1 66 466 1.0E-29
sp|Q9RVC3|PYRC_DEIRA Dihydroorotase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pyrC PE=3 SV=1 70 456 1.0E-29
sp|C0ZG41|PYRC_BREBN Dihydroorotase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=pyrC PE=3 SV=1 60 453 2.0E-29
sp|B2V5I6|PYRC_SULSY Dihydroorotase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=pyrC PE=3 SV=1 36 453 3.0E-29
sp|A3DE07|PYRC_CLOTH Dihydroorotase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=pyrC PE=3 SV=1 36 452 5.0E-29
sp|A8FD15|PYRC_BACP2 Dihydroorotase OS=Bacillus pumilus (strain SAFR-032) GN=pyrC PE=3 SV=1 61 455 7.0E-29
sp|Q8U4A0|PYRC_PYRFU Dihydroorotase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pyrC PE=3 SV=2 27 466 3.0E-28
sp|A1AS12|PYRC_PELPD Dihydroorotase OS=Pelobacter propionicus (strain DSM 2379) GN=pyrC PE=3 SV=1 61 455 4.0E-28
sp|P48795|PYRC_LACLE Dihydroorotase OS=Lactobacillus leichmannii GN=pyrC PE=3 SV=1 53 453 4.0E-28
sp|Q9CCR4|PYRC_MYCLE Dihydroorotase OS=Mycobacterium leprae (strain TN) GN=pyrC PE=3 SV=1 53 451 4.0E-28
sp|Q18C47|PYRC_PEPD6 Dihydroorotase OS=Peptoclostridium difficile (strain 630) GN=pyrC PE=3 SV=1 61 454 5.0E-28
sp|Q9I676|HYDA_PSEAE D-hydantoinase/dihydropyrimidinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=dht PE=3 SV=1 61 469 6.0E-28
sp|B9MS22|PYRC_CALBD Dihydroorotase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=pyrC PE=3 SV=1 26 452 6.0E-28
sp|Q9CGM7|PYRC_LACLA Dihydroorotase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=pyrC PE=3 SV=2 58 453 1.0E-27
sp|Q6AF87|PYRC_LEIXX Dihydroorotase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=pyrC PE=3 SV=1 58 466 1.0E-27
sp|Q3A449|PYRC_PELCD Dihydroorotase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pyrC PE=3 SV=1 58 453 6.0E-27
sp|Q8VTT5|HYDA_RALPI D-hydantoinase OS=Ralstonia pickettii GN=hyuA PE=1 SV=1 61 469 1.0E-26
sp|Q01V55|PYRC_SOLUE Dihydroorotase OS=Solibacter usitatus (strain Ellin6076) GN=pyrC PE=3 SV=1 58 457 2.0E-26
sp|O66990|PYRC_AQUAE Dihydroorotase OS=Aquifex aeolicus (strain VF5) GN=pyrC PE=1 SV=1 54 453 2.0E-26
sp|Q59699|HYDA_PSEPU D-hydantoinase/dihydropyrimidinase OS=Pseudomonas putida GN=dht PE=1 SV=2 61 453 3.0E-26
sp|B8I770|PYRC_CLOCE Dihydroorotase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=pyrC PE=3 SV=1 26 456 4.0E-26
sp|Q6AS41|PYRC_DESPS Dihydroorotase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pyrC PE=3 SV=1 25 455 9.0E-26
sp|O27199|PYRC_METTH Dihydroorotase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pyrC PE=3 SV=2 14 469 4.0E-25
sp|Q44184|HYDA_RHIRD D-hydantoinase OS=Rhizobium radiobacter GN=hyuA PE=3 SV=1 61 454 7.0E-25
sp|A0LK22|PYRC_SYNFM Dihydroorotase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=pyrC PE=3 SV=1 13 455 1.0E-24
sp|P9WHL3|PYRC_MYCTU Dihydroorotase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pyrC PE=1 SV=1 49 451 3.0E-24
sp|P9WHL2|PYRC_MYCTO Dihydroorotase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pyrC PE=3 SV=1 49 451 3.0E-24
sp|Q7U057|PYRC_MYCBO Dihydroorotase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pyrC PE=3 SV=1 49 451 3.0E-24
sp|Q8TXX9|PYRC_METKA Dihydroorotase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pyrC PE=3 SV=1 66 454 5.0E-24
sp|Q8KDK5|PYRC_CHLTE Dihydroorotase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=pyrC PE=3 SV=1 61 452 5.0E-24
sp|Q8RG88|PYRC_FUSNN Dihydroorotase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=pyrC PE=3 SV=1 54 456 9.0E-24
sp|Q58885|PYRC_METJA Dihydroorotase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pyrC PE=3 SV=1 47 451 9.0E-24
sp|Q59712|PYRX_PSEPU Dihydroorotase-like protein OS=Pseudomonas putida GN=pyrC' PE=3 SV=1 61 456 1.0E-23
sp|Q97QN4|PYRC_STRPN Dihydroorotase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pyrC PE=3 SV=1 4 453 2.0E-23
sp|Q55DL0|DPYS_DICDI Dihydropyrimidinase OS=Dictyostelium discoideum GN=pyd2 PE=1 SV=1 19 469 5.0E-23
sp|Q8DPQ5|PYRC_STRR6 Dihydroorotase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pyrC PE=3 SV=1 4 453 5.0E-23
sp|A4J556|PYRC_DESRM Dihydroorotase OS=Desulfotomaculum reducens (strain MI-1) GN=pyrC PE=3 SV=1 58 456 1.0E-22
sp|P0DD65|PYRC_STRPQ Dihydroorotase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pyrC PE=3 SV=1 58 453 3.0E-22
sp|Q7CNB0|PYRC_STRP8 Dihydroorotase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pyrC PE=3 SV=1 58 453 3.0E-22
sp|Q5XCK2|PYRC_STRP6 Dihydroorotase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pyrC PE=3 SV=1 58 453 3.0E-22
sp|P0DD64|PYRC_STRP3 Dihydroorotase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pyrC PE=3 SV=1 58 453 3.0E-22
sp|Q8NQ39|PYRC_CORGL Dihydroorotase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=pyrC PE=3 SV=1 61 452 3.0E-22
sp|Q5JJ91|PYRC_THEKO Dihydroorotase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pyrC PE=3 SV=1 34 454 3.0E-22
sp|Q5M4C1|PYRC_STRT2 Dihydroorotase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pyrC PE=3 SV=1 54 453 4.0E-22
sp|Q5LZQ6|PYRC_STRT1 Dihydroorotase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pyrC PE=3 SV=1 54 453 4.0E-22
sp|Q9A071|PYRC_STRP1 Dihydroorotase OS=Streptococcus pyogenes serotype M1 GN=pyrC PE=3 SV=1 58 453 4.0E-22
sp|B8JAE8|PYRC_ANAD2 Dihydroorotase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=pyrC PE=3 SV=1 1 456 4.0E-22
sp|Q61YQ1|DHP2_CAEBR Dihydropyrimidinase 2 OS=Caenorhabditis briggsae GN=dhp-2 PE=3 SV=1 29 469 5.0E-22
sp|B2UW91|PYRC_CLOBA Dihydroorotase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=pyrC PE=3 SV=1 45 455 5.0E-22
sp|Q9FMP3|DPYS_ARATH Dihydropyrimidinase OS=Arabidopsis thaliana GN=PYD2 PE=1 SV=1 27 456 1.0E-21
sp|B4UDQ2|PYRC_ANASK Dihydroorotase OS=Anaeromyxobacter sp. (strain K) GN=pyrC PE=3 SV=1 1 454 1.0E-21
sp|P27708|PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 1 453 2.0E-21
sp|Q91437|PYR1_SQUAC CAD protein OS=Squalus acanthias GN=CAD PE=2 SV=1 1 453 3.0E-21
sp|B2TNG1|PYRC_CLOBB Dihydroorotase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=pyrC PE=3 SV=1 45 455 8.0E-21
sp|P08955|PYR1_MESAU CAD protein OS=Mesocricetus auratus GN=CAD PE=1 SV=4 1 453 8.0E-21
sp|Q18677|DHP2_CAEEL Dihydropyrimidinase 2 OS=Caenorhabditis elegans GN=dhp-2 PE=1 SV=1 29 453 3.0E-20
sp|B2RQC6|PYR1_MOUSE CAD protein OS=Mus musculus GN=Cad PE=1 SV=1 1 453 3.0E-20
sp|Q9P903|DPYS_LACK1 Dihydropyrimidinase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=PYD2 PE=1 SV=1 61 453 1.0E-19
sp|Q9EQF5|DPYS_MOUSE Dihydropyrimidinase OS=Mus musculus GN=Dpys PE=1 SV=2 61 469 1.0E-19
sp|Q2IIB0|PYRC_ANADE Dihydroorotase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pyrC PE=3 SV=1 1 454 3.0E-19
sp|Q51551|PYRX_PSEAE Dihydroorotase-like protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pyrC' PE=3 SV=2 5 454 5.0E-19
sp|Q97C35|PYRC_THEVO Dihydroorotase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pyrC PE=3 SV=1 68 469 1.0E-18
sp|Q63150|DPYS_RAT Dihydropyrimidinase OS=Rattus norvegicus GN=Dpys PE=1 SV=2 61 469 9.0E-18
sp|Q9BPU6|DPYL5_HUMAN Dihydropyrimidinase-related protein 5 OS=Homo sapiens GN=DPYSL5 PE=1 SV=1 58 454 2.0E-17
sp|Q52PJ5|DPYL3_DANRE Dihydropyrimidinase-related protein 3 OS=Danio rerio GN=dpysl3 PE=2 SV=1 61 469 2.0E-17
sp|Q9HIM0|PYRC_THEAC Dihydroorotase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pyrC PE=3 SV=1 65 455 2.0E-17
sp|Q60Q85|DHP1_CAEBR Dihydropyrimidinase 1 OS=Caenorhabditis briggsae GN=dhp-1 PE=3 SV=1 61 453 4.0E-17
sp|Q6GL72|DPYL3_XENTR Dihydropyrimidinase-related protein 3 OS=Xenopus tropicalis GN=dpysl3 PE=2 SV=1 61 469 7.0E-17
sp|Q640K6|DPY3B_XENLA Dihydropyrimidinase-related protein 3-B OS=Xenopus laevis GN=dpysl3-b PE=2 SV=1 61 469 8.0E-17
sp|Q9JHU0|DPYL5_RAT Dihydropyrimidinase-related protein 5 OS=Rattus norvegicus GN=Dpysl5 PE=1 SV=1 58 454 3.0E-16
sp|Q14195|DPYL3_HUMAN Dihydropyrimidinase-related protein 3 OS=Homo sapiens GN=DPYSL3 PE=1 SV=1 61 469 4.0E-16
sp|Q9EQF6|DPYL5_MOUSE Dihydropyrimidinase-related protein 5 OS=Mus musculus GN=Dpysl5 PE=1 SV=1 58 454 4.0E-16
sp|O13022|DPY3A_XENLA Dihydropyrimidinase-related protein 3-A OS=Xenopus laevis GN=dpysl3-a PE=2 SV=2 61 469 4.0E-16
sp|Q62950|DPYL1_RAT Dihydropyrimidinase-related protein 1 OS=Rattus norvegicus GN=Crmp1 PE=1 SV=1 61 469 6.0E-16
sp|P97427|DPYL1_MOUSE Dihydropyrimidinase-related protein 1 OS=Mus musculus GN=Crmp1 PE=1 SV=1 61 469 1.0E-15
sp|Q62952|DPYL3_RAT Dihydropyrimidinase-related protein 3 OS=Rattus norvegicus GN=Dpysl3 PE=1 SV=2 61 469 1.0E-15
sp|Q62188|DPYL3_MOUSE Dihydropyrimidinase-related protein 3 OS=Mus musculus GN=Dpysl3 PE=1 SV=1 61 469 1.0E-15
sp|P05990|PYR1_DROME CAD protein OS=Drosophila melanogaster GN=r PE=1 SV=3 67 453 2.0E-15
sp|Q14194|DPYL1_HUMAN Dihydropyrimidinase-related protein 1 OS=Homo sapiens GN=CRMP1 PE=1 SV=1 61 469 2.0E-15
sp|P20054|PYR1_DICDI Protein PYR1-3 OS=Dictyostelium discoideum GN=pyr1-3 PE=1 SV=3 25 453 4.0E-15
sp|Q14117|DPYS_HUMAN Dihydropyrimidinase OS=Homo sapiens GN=DPYS PE=1 SV=1 61 469 6.0E-15
sp|Q9YFI5|PYRC_AERPE Dihydroorotase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pyrC PE=3 SV=2 65 335 6.0E-15
sp|Q3AC01|PYRC_CARHZ Dihydroorotase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pyrC PE=3 SV=1 249 459 2.0E-14
sp|Q21773|DHP1_CAEEL Dihydropyrimidinase 1 OS=Caenorhabditis elegans GN=dhp-1 PE=1 SV=2 34 453 1.0E-13
sp|Q1AVY7|PYRC_RUBXD Dihydroorotase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pyrC PE=3 SV=1 252 455 1.0E-13
sp|O28034|PYRC_ARCFU Dihydroorotase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pyrC PE=3 SV=1 67 456 5.0E-13
sp|Q62951|DPYL4_RAT Dihydropyrimidinase-related protein 4 (Fragment) OS=Rattus norvegicus GN=Dpysl4 PE=1 SV=1 61 469 8.0E-13
sp|O35098|DPYL4_MOUSE Dihydropyrimidinase-related protein 4 OS=Mus musculus GN=Dpysl4 PE=1 SV=1 5 469 2.0E-12
sp|Q90635|DPYL2_CHICK Dihydropyrimidinase-related protein 2 OS=Gallus gallus GN=DPYSL2 PE=2 SV=1 61 469 4.0E-12
sp|Q7UNR2|PYRC_RHOBA Putative dihydroorotase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=pyrC PE=3 SV=1 26 454 1.0E-11
sp|O14531|DPYL4_HUMAN Dihydropyrimidinase-related protein 4 OS=Homo sapiens GN=DPYSL4 PE=1 SV=2 61 469 2.0E-11
sp|P47942|DPYL2_RAT Dihydropyrimidinase-related protein 2 OS=Rattus norvegicus GN=Dpysl2 PE=1 SV=1 61 469 2.0E-11
sp|O08553|DPYL2_MOUSE Dihydropyrimidinase-related protein 2 OS=Mus musculus GN=Dpysl2 PE=1 SV=2 61 469 2.0E-11
sp|O02675|DPYL2_BOVIN Dihydropyrimidinase-related protein 2 OS=Bos taurus GN=DPYSL2 PE=1 SV=1 61 469 2.0E-11
sp|Q5R9Y6|DPYL2_PONAB Dihydropyrimidinase-related protein 2 OS=Pongo abelii GN=DPYSL2 PE=2 SV=1 61 469 7.0E-11
sp|Q16555|DPYL2_HUMAN Dihydropyrimidinase-related protein 2 OS=Homo sapiens GN=DPYSL2 PE=1 SV=1 61 469 7.0E-11
sp|Q8ZZC7|PYRC_PYRAE Dihydroorotase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pyrC PE=3 SV=1 67 453 4.0E-10
sp|P72934|PYRX_SYNY3 Probable dihydroorotase-like protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pyrC' PE=3 SV=1 58 341 8.0E-10
sp|Q3AC01|PYRC_CARHZ Dihydroorotase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pyrC PE=3 SV=1 29 115 1.0E-07
sp|Q01630|UNC33_CAEEL Protein unc-33 OS=Caenorhabditis elegans GN=unc-33 PE=2 SV=1 58 453 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|046250
MSSFLAFSGRQVLLPDADVPQPATIIIDISSGKIVNILLARLSKNDLASHITPDSNIATYIDAGDKIVLPGLVDA
HVHLNEPGRTDWEGFQSGTRAAASGGVTTVIDMPLNSIPPTTTIDNLKVKQDAARGQCHVDVGFWGGVVPGNQDS
LASLVNNGVKGFKCFLIESGVDEFPCVGKRDVEMAMQALQGRPTVLMFHAELADQEAGVSENQHHEHSGDPSKYI
TFLESRPQQLEVNAIKLITETQEKHPGLRCHIVHLSAAHALAEIRRARAAGLDLTVETCFHYLCLASDNIPDGRP
EFKCCPPVRDELNRDQLWEALQDGTIDFVVSDHSPCVRELKLIEEGDVMRAWGGISTLGLGLSLLWTEGQKRGAS
LGNVVEWTSRRTAVHAGVGDCKGQLKVGYDGDVVIWDSEAIFEVTSESLHFKNKVTPYVGQKLRGIVEQTYVRGR
LVYDREAGGAVGEARGRFV*
Coding >Agabi119p4|046250
ATGTCTTCTTTCCTTGCGTTCTCAGGCAGACAGGTTCTCCTTCCTGATGCAGATGTCCCTCAGCCAGCAACAATC
ATCATCGACATATCGTCTGGGAAGATCGTCAACATCTTGCTAGCTCGACTCTCCAAAAATGACCTTGCTTCACAC
ATAACCCCAGACAGCAATATTGCTACTTACATTGACGCAGGAGATAAAATAGTATTACCCGGACTAGTTGACGCA
CATGTGCATCTTAATGAACCCGGACGAACTGACTGGGAAGGCTTTCAATCGGGAACCCGTGCGGCGGCATCAGGC
GGTGTAACCACCGTCATCGACATGCCTCTTAATTCAATCCCACCGACGACAACGATAGACAATCTAAAAGTCAAA
CAGGATGCAGCGCGTGGTCAGTGCCATGTCGATGTCGGCTTTTGGGGAGGTGTTGTACCCGGAAACCAGGATAGT
CTCGCATCCCTAGTTAATAACGGCGTGAAAGGATTCAAGTGCTTTCTCATCGAAAGTGGCGTTGATGAATTTCCT
TGCGTGGGCAAACGAGATGTTGAAATGGCTATGCAAGCGCTTCAAGGTCGACCGACGGTCCTAATGTTTCATGCA
GAACTAGCAGATCAAGAAGCAGGTGTTTCAGAAAATCAACACCACGAACATTCCGGCGATCCATCGAAATATATA
ACTTTCCTCGAATCCAGGCCACAGCAACTCGAGGTGAATGCGATCAAACTTATTACGGAAACCCAAGAAAAACAT
CCCGGGCTGCGATGCCACATTGTCCATTTGTCTGCGGCTCACGCACTCGCAGAGATCCGGAGAGCGAGAGCAGCG
GGACTTGATTTAACAGTGGAGACTTGCTTCCATTATCTCTGCCTCGCCTCAGACAATATTCCTGACGGGCGACCT
GAATTCAAGTGCTGTCCTCCTGTGCGGGATGAGTTGAACAGAGACCAGTTATGGGAAGCGTTGCAGGATGGAACG
ATCGACTTCGTAGTTTCTGATCATAGCCCGTGCGTCCGCGAACTGAAGTTGATTGAGGAAGGTGATGTCATGAGA
GCATGGGGCGGGATCAGCACGCTCGGACTTGGCCTGAGCCTGCTATGGACGGAAGGTCAAAAGCGGGGGGCATCC
CTCGGAAACGTTGTGGAGTGGACCAGTCGACGCACGGCCGTGCACGCAGGAGTGGGGGACTGCAAAGGCCAATTG
AAGGTTGGCTACGACGGAGATGTGGTCATCTGGGATAGCGAGGCAATTTTCGAGGTAACAAGCGAAAGTCTACAT
TTCAAGAATAAAGTGACACCGTATGTAGGCCAGAAGCTGCGTGGGATAGTCGAACAGACGTATGTACGGGGCAGA
CTGGTGTACGACCGGGAAGCAGGAGGGGCGGTCGGGGAGGCCAGAGGAAGATTTGTGTAA
Transcript >Agabi119p4|046250
ATGTCTTCTTTCCTTGCGTTCTCAGGCAGACAGGTTCTCCTTCCTGATGCAGATGTCCCTCAGCCAGCAACAATC
ATCATCGACATATCGTCTGGGAAGATCGTCAACATCTTGCTAGCTCGACTCTCCAAAAATGACCTTGCTTCACAC
ATAACCCCAGACAGCAATATTGCTACTTACATTGACGCAGGAGATAAAATAGTATTACCCGGACTAGTTGACGCA
CATGTGCATCTTAATGAACCCGGACGAACTGACTGGGAAGGCTTTCAATCGGGAACCCGTGCGGCGGCATCAGGC
GGTGTAACCACCGTCATCGACATGCCTCTTAATTCAATCCCACCGACGACAACGATAGACAATCTAAAAGTCAAA
CAGGATGCAGCGCGTGGTCAGTGCCATGTCGATGTCGGCTTTTGGGGAGGTGTTGTACCCGGAAACCAGGATAGT
CTCGCATCCCTAGTTAATAACGGCGTGAAAGGATTCAAGTGCTTTCTCATCGAAAGTGGCGTTGATGAATTTCCT
TGCGTGGGCAAACGAGATGTTGAAATGGCTATGCAAGCGCTTCAAGGTCGACCGACGGTCCTAATGTTTCATGCA
GAACTAGCAGATCAAGAAGCAGGTGTTTCAGAAAATCAACACCACGAACATTCCGGCGATCCATCGAAATATATA
ACTTTCCTCGAATCCAGGCCACAGCAACTCGAGGTGAATGCGATCAAACTTATTACGGAAACCCAAGAAAAACAT
CCCGGGCTGCGATGCCACATTGTCCATTTGTCTGCGGCTCACGCACTCGCAGAGATCCGGAGAGCGAGAGCAGCG
GGACTTGATTTAACAGTGGAGACTTGCTTCCATTATCTCTGCCTCGCCTCAGACAATATTCCTGACGGGCGACCT
GAATTCAAGTGCTGTCCTCCTGTGCGGGATGAGTTGAACAGAGACCAGTTATGGGAAGCGTTGCAGGATGGAACG
ATCGACTTCGTAGTTTCTGATCATAGCCCGTGCGTCCGCGAACTGAAGTTGATTGAGGAAGGTGATGTCATGAGA
GCATGGGGCGGGATCAGCACGCTCGGACTTGGCCTGAGCCTGCTATGGACGGAAGGTCAAAAGCGGGGGGCATCC
CTCGGAAACGTTGTGGAGTGGACCAGTCGACGCACGGCCGTGCACGCAGGAGTGGGGGACTGCAAAGGCCAATTG
AAGGTTGGCTACGACGGAGATGTGGTCATCTGGGATAGCGAGGCAATTTTCGAGGTAACAAGCGAAAGTCTACAT
TTCAAGAATAAAGTGACACCGTATGTAGGCCAGAAGCTGCGTGGGATAGTCGAACAGACGTATGTACGGGGCAGA
CTGGTGTACGACCGGGAAGCAGGAGGGGCGGTCGGGGAGGCCAGAGGAAGATTTGTGTAA
Gene >Agabi119p4|046250
ATGTCTTCTTTCCTTGCGTTCTCAGGCAGACAGGTTCTCCTTCCTGATGCAGATGTCCCTCAGCCAGCAACAATC
ATCATCGACATATCGTCTGGGAAGATCGTCAACATCTTGCTAGCTCGACTCTCCAAAAATGACCTTGCTTCACAC
ATAACCCCAGACAGCAATATTGCTACTTACATTGACGCAGGAGATAAAATAGTATTACCCGGACTAGTTGAGTGA
GCCTATTATCTACCAAGCCAAGAATTCTTCCCTTATTTTCTCATTGCTCAGCGCACATGTGCATCTTAATGAACC
CGGACGAACTGACTGGGAAGGCTTTCAATCGGGAACCCGTGCGGCGGCATCAGGCGGTGTAACCACCGTCATCGA
CATGCCTCTTAATTCAATCCCACCGACGACAACGATAGACAATCTAAAAGTCAAACAGGATGCAGCGCGTGGTCA
GTGCCATGTCGATGTCGGCTTTTGGGGAGGTGTTGTACCCGGAAACCAGGTAACACAACACCATCGGGCGTCATG
TGTATTCTGATGCGCGCTATAGGATAGTCTCGCATCCCTAGTTAATAACGGCGTGAAAGGATTCAAGTGCTTTCT
CATCGAAAGTGGCGTTGATGTGCGGCAGTCATTTTATATATAGCTTCCGCTCATACGATTGATGAACAGGAATTT
CCTTGCGTGGGCAAACGAGATGTTGAAATGGCTATGCAAGCGCTTCAAGTGACTATTTTAGATATAAAAACCTGT
GCGACGTCATGCTCAATGAAGAAACCAGGGTCGACCGACGGTCCTAATGTTTCATGCAGAACTAGCAGATCAAGA
AGCAGGTGTTTCAGAAAATCAACACCACGAACATTCCGGCGATCCATCGAAATATATAACTTTCCTCGAATCCAG
GCCACAGCAACTCGAGGTGAATGCGATCAAACTTATTACGGAAACCCAAGAAAAACATCCCGGGCTGCGATGCCA
CATTGTCCATTTGTCTGCGGCTCACGCACTCGCAGAGATCCGGAGAGCGAGAGCAGCGGGACTTGATTTAACAGT
GGAGACTTGCTTCCATTATCTCTGCCTCGCCTCAGACAATATTCCTGACGGGCGACCTGAATTCAAGTGCTGTCC
TCCTGTGCGGGATGAGTTGAACAGAGACCAGTTATGGGAAGCGTTGCAGGATGGAACGATCGACTTCGTAGTTTC
TGATCATAGCCCGTGCGTCCGCGAACTGAAGTTGATTGAGGAAGGTGATGTCATGAGAGCATGGGGCGGGATCAG
CACGCTCGGACTTGGCCTGAGCCTGCTATGGACGGAAGGTCAAAAGCGGGGGGCATCCCTCGGAAACGTTGTGGA
GTGGACCAGTCGACGCACGGCCGTGCACGCAGGAGTGGGGGACTGCAAAGGCCAATTGAAGGTTGGCTACGACGG
AGATGTGGTCATCTGGGATAGCGAGGCAATTTTCGAGGTGGGTCAACGAGGTCTGTTTTTGGCGTTGATACTGAT
TGCAGGACAAGGTAACAAGCGAAAGTCTACATTTCAAGAATAAAGTGACACCGTATGTAGGCCAGAAGCTGCGTG
GGATAGTCGAACAGACGTATGTACGGGGCAGACTGGTGTACGACCGGGAAGCAGGAGGGGCGGTCGGGGAGGCCA
GAGGAAGATTTGTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail