Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|046030
Gene name
Locationscaffold_02:1715945..1718513
Strand-
Gene length (bp)2568
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03935 SKN1_KRE6_Sbg1 Beta-glucan synthesis-associated protein SKN1/KRE6/Sbg1 4.1E-190 59 578

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32486|KRE6_YEAST Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE6 PE=1 SV=2 64 578 7.0E-115
sp|O13941|YEPB_SCHPO Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H3.11c PE=3 SV=1 64 578 1.0E-112
sp|P87023|KRE6_CANAX Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans GN=KRE6 PE=2 SV=1 61 576 6.0E-112
sp|P87024|SKN1_CANAX Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans GN=SKN1 PE=2 SV=1 58 576 3.0E-109
sp|P33336|SKN1_YEAST Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN1 PE=1 SV=1 147 578 1.0E-103
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32486|KRE6_YEAST Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KRE6 PE=1 SV=2 64 578 7.0E-115
sp|O13941|YEPB_SCHPO Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC23H3.11c PE=3 SV=1 64 578 1.0E-112
sp|P87023|KRE6_CANAX Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans GN=KRE6 PE=2 SV=1 61 576 6.0E-112
sp|P87024|SKN1_CANAX Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans GN=SKN1 PE=2 SV=1 58 576 3.0E-109
sp|P33336|SKN1_YEAST Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN1 PE=1 SV=1 147 578 1.0E-103
sp|O13789|YEOB_SCHPO Uncharacterized beta-glucan synthesis-associated protein C17G6.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G6.11c PE=3 SV=1 56 578 5.0E-96
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

Domain # Start End Length
1 94 116 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|046030
MPTPIFSDSLGSPRRKGEWTALPSSDSSIYPVGARSSFANLSNQYSLSHNPQDWGLNLSPNYVEDDDALHMPTIQ
SNSIWGLSTFSKRGIGNCGCLLVVIVGILLLFVAYPIIAAARLQQLDKSGAFNFGGINASGQIPMIQGNYGLIDE
DTPREAYTRPSWNDPTKNMQLVFSDEFNTDGRTFYAGDDPYWEAVDLHYWQTNNMEWYDPEAIVTEGGSLVITLS
QKETHNLNYQGGLLSTWNKFCFTGGYIEANVQLPGFNNILGFWPAIWAMGNLGRAGYGASLEGTWPYSYDTCDVG
TAPNQTLNGLPVAARTGGDPEHDGALSYLPGQKLSRCTCDGESHPGPKHPDGTFVGRSAPEIDVFEAQINQDTLI
ADVSQSAQWAPFNNRYLWKNSSANMIIADPAISQQNSYVGGITQQATSVTTRTDPNSYEFSGGRYATYGFEYKPG
FDEGYITWISSGEMAWTLRGLGLGPDPSVQIGARPVSQEPMYLIMNLGMSKNFGPVDLENLPFPAHMRVDYVRVY
QPEDAINIGCDPKEFPTADYINKYIEAYTKPNLTTWVDDYKQPWPRNSLLGQC*
Coding >Agabi119p4|046030
ATGCCAACGCCTATATTTTCAGACTCGCTGGGCTCGCCCAGAAGGAAAGGCGAATGGACCGCCTTGCCAAGTTCG
GACTCATCCATATATCCAGTTGGTGCCCGCTCAAGCTTTGCAAACTTGTCCAATCAATACTCTCTCTCTCACAAT
CCTCAGGACTGGGGACTCAACTTGTCGCCGAATTACGTTGAAGACGACGATGCTTTACACATGCCAACGATCCAA
TCGAATTCAATCTGGGGCCTTTCAACTTTTTCGAAACGTGGTATTGGAAATTGTGGGTGTCTCCTTGTTGTTATT
GTCGGAATACTCCTATTATTTGTTGCGTATCCCATCATTGCTGCCGCCCGCCTCCAGCAATTGGACAAGAGTGGA
GCATTTAATTTCGGTGGAATCAATGCTAGTGGACAGATACCCATGATTCAAGGAAATTACGGTCTCATTGACGAA
GATACCCCGAGAGAGGCATATACTAGACCTTCGTGGAACGACCCTACGAAGAATATGCAATTGGTGTTCTCCGAT
GAGTTTAATACCGATGGACGGACATTTTATGCTGGAGATGACCCGTATTGGGAAGCTGTCGATTTACATTATTGG
CAAACAAACAATATGGAATGGTATGATCCCGAAGCTATCGTGACGGAAGGCGGCTCCCTGGTCATCACTCTCAGC
CAAAAAGAGACGCACAATCTCAACTACCAGGGCGGCCTTCTATCAACATGGAACAAATTTTGTTTTACTGGGGGA
TATATTGAAGCCAACGTACAACTTCCGGGTTTCAACAATATTCTCGGATTTTGGCCAGCGATATGGGCAATGGGA
AATCTTGGGAGAGCAGGATATGGTGCTTCTCTGGAAGGAACCTGGCCGTATAGTTATGATACCTGTGACGTGGGT
ACTGCTCCTAATCAAACCTTGAACGGACTACCCGTCGCAGCAAGGACTGGTGGAGACCCCGAGCACGATGGTGCA
CTGTCATATCTACCCGGGCAAAAACTATCAAGGTGTACTTGTGACGGGGAATCACATCCTGGTCCGAAACATCCC
GATGGGACTTTCGTTGGACGATCCGCACCAGAAATCGATGTCTTTGAAGCGCAGATAAATCAGGATACATTAATT
GCTGATGTTTCACAATCTGCACAATGGGCGCCATTCAATAACAGATATTTATGGAAAAACTCGTCAGCGAATATG
ATCATTGCGGATCCTGCCATCAGCCAACAAAACAGTTATGTTGGCGGTATCACGCAACAAGCTACATCTGTTACG
ACGCGTACTGATCCCAATTCTTACGAATTCAGTGGCGGGCGCTACGCCACCTACGGCTTTGAGTATAAGCCGGGT
TTCGATGAAGGATATATTACATGGATCTCGAGCGGAGAAATGGCGTGGACTCTAAGAGGTCTTGGTCTTGGTCCT
GATCCATCGGTGCAAATAGGTGCTCGACCTGTTTCTCAAGAACCCATGTATTTGATTATGAACCTGGGGATGTCG
AAGAACTTTGGTCCAGTCGACTTGGAAAATCTTCCTTTTCCAGCGCATATGCGCGTGGATTATGTTCGAGTATAT
CAACCTGAAGACGCAATCAATATAGGTTGCGATCCCAAGGAATTCCCGACCGCGGACTACATCAACAAATATATA
GAGGCTTACACGAAGCCAAACTTGACCACGTGGGTGGACGATTACAAACAGCCGTGGCCGAGGAACTCGCTCCTT
GGTCAATGCTGA
Transcript >Agabi119p4|046030
ATGCCAACGCCTATATTTTCAGACTCGCTGGGCTCGCCCAGAAGGAAAGGCGAATGGACCGCCTTGCCAAGTTCG
GACTCATCCATATATCCAGTTGGTGCCCGCTCAAGCTTTGCAAACTTGTCCAATCAATACTCTCTCTCTCACAAT
CCTCAGGACTGGGGACTCAACTTGTCGCCGAATTACGTTGAAGACGACGATGCTTTACACATGCCAACGATCCAA
TCGAATTCAATCTGGGGCCTTTCAACTTTTTCGAAACGTGGTATTGGAAATTGTGGGTGTCTCCTTGTTGTTATT
GTCGGAATACTCCTATTATTTGTTGCGTATCCCATCATTGCTGCCGCCCGCCTCCAGCAATTGGACAAGAGTGGA
GCATTTAATTTCGGTGGAATCAATGCTAGTGGACAGATACCCATGATTCAAGGAAATTACGGTCTCATTGACGAA
GATACCCCGAGAGAGGCATATACTAGACCTTCGTGGAACGACCCTACGAAGAATATGCAATTGGTGTTCTCCGAT
GAGTTTAATACCGATGGACGGACATTTTATGCTGGAGATGACCCGTATTGGGAAGCTGTCGATTTACATTATTGG
CAAACAAACAATATGGAATGGTATGATCCCGAAGCTATCGTGACGGAAGGCGGCTCCCTGGTCATCACTCTCAGC
CAAAAAGAGACGCACAATCTCAACTACCAGGGCGGCCTTCTATCAACATGGAACAAATTTTGTTTTACTGGGGGA
TATATTGAAGCCAACGTACAACTTCCGGGTTTCAACAATATTCTCGGATTTTGGCCAGCGATATGGGCAATGGGA
AATCTTGGGAGAGCAGGATATGGTGCTTCTCTGGAAGGAACCTGGCCGTATAGTTATGATACCTGTGACGTGGGT
ACTGCTCCTAATCAAACCTTGAACGGACTACCCGTCGCAGCAAGGACTGGTGGAGACCCCGAGCACGATGGTGCA
CTGTCATATCTACCCGGGCAAAAACTATCAAGGTGTACTTGTGACGGGGAATCACATCCTGGTCCGAAACATCCC
GATGGGACTTTCGTTGGACGATCCGCACCAGAAATCGATGTCTTTGAAGCGCAGATAAATCAGGATACATTAATT
GCTGATGTTTCACAATCTGCACAATGGGCGCCATTCAATAACAGATATTTATGGAAAAACTCGTCAGCGAATATG
ATCATTGCGGATCCTGCCATCAGCCAACAAAACAGTTATGTTGGCGGTATCACGCAACAAGCTACATCTGTTACG
ACGCGTACTGATCCCAATTCTTACGAATTCAGTGGCGGGCGCTACGCCACCTACGGCTTTGAGTATAAGCCGGGT
TTCGATGAAGGATATATTACATGGATCTCGAGCGGAGAAATGGCGTGGACTCTAAGAGGTCTTGGTCTTGGTCCT
GATCCATCGGTGCAAATAGGTGCTCGACCTGTTTCTCAAGAACCCATGTATTTGATTATGAACCTGGGGATGTCG
AAGAACTTTGGTCCAGTCGACTTGGAAAATCTTCCTTTTCCAGCGCATATGCGCGTGGATTATGTTCGAGTATAT
CAACCTGAAGACGCAATCAATATAGGTTGCGATCCCAAGGAATTCCCGACCGCGGACTACATCAACAAATATATA
GAGGCTTACACGAAGCCAAACTTGACCACGTGGGTGGACGATTACAAACAGCCGTGGCCGAGGAACTCGCTCCTT
GGTCAATGCTGA
Gene >Agabi119p4|046030
ATGCCAACGCCTATATTTTCAGACTCGCTGGGCTCGCCCAGAAGGAAAGGCGAATGGACCGCCTTGGTGAGTCTG
CAATTACGATTTTCAGTAGCATACAGCGTGACATCTCTTACTCACATAAAAACTACACCAGCCAAGTTCGGACTC
ATCCATATATCCAGTTGGTGCCCGCTCAAGCTTTGCAAACTTGTCCAATCAAGTGTGTACTTCAAATCCCTCATT
CACTATGCGTTCTCCGTCCTTAGTATGATCATTAGTACTCTCTCTCTCACAATCCTCAGGACTGGGGACTCAACT
TGTCGCCGAATTACGTTGAAGACGACGATGCTTTACACATGCCAACGATCCAATCGAATTCAATCTGGGGCCTTT
CAACTTTTTCGAAACGTGGTATTGGAAATTGTGGGTGTCTCCTTGTTGTTATTGTCGGAATACTCCTATTATTGT
AAGTTCTGCCATATGACTCTATGCGGATCTCATAAACTTTCTAGTGTTGCGTATCCCATCATTGCTGCCGCCCGC
CTCCAGCAATTGGACAAGAGTGGAGCATTTAATTTCGGTGGAATCAATGCTAGTGGACAGGTATGTCATTGAATA
CTCTGATTCTCGAAAAACCGATTTCAAGTGTAGATACCCATGATTCAAGGAAATTACGGTCTCATTGACGAAGAT
ACCCCGAGAGAGGCATATACTAGACCTTCGTGGAACGACCCTACGAAGAATATGCAATTGGTGTTCTCCGATGAG
TTTAATACCGATGGACGGACATTTTATGCTGGAGATGACCCGTATTGGGAAGCTGTCGATTTACATTATTGGGTG
AGTGTGTCATTGGTCCGAAGACGTGTATAGTATTTCGTCGAGCAATTTTACAGCAAACAAACAATATGGAATGGT
ATGATCCCGAAGCTATCGTGACGGAAGGCGGCTCCCTGGTCATCACTCTCAGCCAAAAAGAGACGCACAATCTCA
ACTACCAGGGCGGTAAGTAGAACCATCATTTCAAATCAGTGGCACTAACGGTGTGTGAGAACAGGCCTTCTATCA
ACATGGTACGTCTTCCCGTGGTAGCATCGTAGCCAAAATACCGACTATCTGTAGGAACAAATTTTGTTTTACTGG
GGGATATATTGAAGCCAACGTACAACTTCCGGGTTTCAACAATATTCTCGGATTTTGGCCAGCGATATGGGCAAT
GGGAAATCTTGGGAGAGCAGGATATGGTGCTTCTCTGGAAGGAACCGTATGTTTCGCGGTCTATTTTTCCAAGAA
ATTTTAGTTCGCTGATCATGGTATGGCGGTGCGTTACAGTGGCCGTATAGTTATGATACCTGTGACGTGGGTACT
GCTCCTAATCAAACCTTGAACGGACTACCCGTCGCAGCAAGGACTGGTGGAGACCCCGAGCACGATGGTGCACTG
TCATATCTACCCGGGCAAAAACTATCAAGGTGTACTTGTGACGGGGAATCACATCCTGGTCCGAAACATCCCGAT
GGGACTTTCGTTGGACGATCCGCACCAGAAATCGATGTCTTTGAAGCGCAGGTGAGTACCAATCACCTTGTGATA
AGTCAAAGCTGCAATTAACGTCTGATTTGTACCTTACTTGCTAATCACTCGCGCTCTGGTATGACGTGAGATAGA
TAAATCAGGATACATTAATTGCTGATGTTTCACAATCTGCACAATGGGCGGTAGGTCTTTCCATTTCACGATCCG
TACCAATGGCGTTGACTTATCTGGTCTGTAGCCATTCAATAACAGATATTTATGGAAAAACTCGTCAGCGAATAT
GATCATTGCGGATCCTGCCATCAGCCAACAAAACAGTTATGTTGGCGGTATCACGCAACAAGCTACATCTGTTAC
GACGCGTACTGATCCCAATTCTTACGAATTCAGTGGCGGGCGCTACGCCACCTACGGCTTTGAGGTAAGAGTCGC
GTCACTATCGTGGATTTACAGTGGGGATAATAACCTCTGATGACATGTTAGTATAAGCCGGGTTTCGATGAAGGA
GTAAGTGGCGGTTTACTTTCAATGAAATTGAGATTGACTTCGGAGGTATCGTTGTAGTATATTACATGGATCTCG
AGCGGAGAAATGGCGTGGACTCTAAGAGGTCTTGGTCTTGGTCCTGATCCATCGGTGCAAATAGGTGCTCGACCT
GTTTCTCAAGAACCCATGGTATATATATATATCTTCATTCCCCTCAATCGCTAACTGAATGATATCAGTATTTGA
TTATGAACCTGGGGATGTCGAAGAACTTTGGTCCAGTCGACTTGGAAAATCTTCCTTTTCCAGCGCATATGCGCG
TGGATTATGTTCGAGTATATCAACCTGAAGACGCAATCAATATAGGTTGCGATCCCAAGGAATTCCCGACCGCGG
ACTACATCAACAAGTGAGCATCGACATCCTGCTGGATGTAAATTGTTATTAAACCTTTGCGATTCTGTCCTCAGA
TATATAGAGGCTTACACGAAGCCAAACTTGACCACGTGGGTGGACGATTACAAACAGCCGTGGCCGAGGAACTCG
CTCCTTGGTCAATGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail