Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|045830
Gene name
Locationscaffold_02:1671401..1673475
Strand-
Gene length (bp)2074
Transcript length (bp)1347
Coding sequence length (bp)1347
Protein length (aa) 449

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00150 Cellulase Cellulase (glycosyl hydrolase family 5) 3.4E-37 117 413
PF00734 CBM_1 Fungal cellulose binding domain 6.4E-13 33 60
PF02836 Glyco_hydro_2_C Glycosyl hydrolases family 2, TIM barrel domain 3.3E-05 229 412

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 17 428 3.0E-97
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 17 428 3.0E-97
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 11 437 2.0E-94
sp|B8NIV9|MANF_ASPFN Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manF PE=3 SV=1 12 428 7.0E-92
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 12 428 8.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0Y9E7|MANF_ASPFC Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=manF PE=3 SV=2 17 428 3.0E-97
sp|Q4WBS1|MANF_ASPFU Mannan endo-1,4-beta-mannosidase F OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=manF PE=1 SV=2 17 428 3.0E-97
sp|Q5AR04|MANF_EMENI Probable mannan endo-1,4-beta-mannosidase F OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manF PE=3 SV=2 11 437 2.0E-94
sp|B8NIV9|MANF_ASPFN Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manF PE=3 SV=1 12 428 7.0E-92
sp|A1C8U0|MANF_ASPCL Mannan endo-1,4-beta-mannosidase F OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manF PE=3 SV=1 12 428 8.0E-92
sp|Q2U2I3|MANF_ASPOR Probable mannan endo-1,4-beta-mannosidase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=manF PE=3 SV=2 12 428 8.0E-92
sp|A1DBV1|MANF_NEOFI Probable mannan endo-1,4-beta-mannosidase F OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manF PE=3 SV=1 19 428 5.0E-90
sp|A1D8Y6|MANA_NEOFI Probable mannan endo-1,4-beta-mannosidase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=manA PE=3 SV=1 96 447 6.0E-85
sp|Q00012|MANA_ASPAC Mannan endo-1,4-beta-mannosidase A OS=Aspergillus aculeatus GN=manA PE=1 SV=1 82 448 8.0E-83
sp|B8NVK8|MANA_ASPFN Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=manA PE=3 SV=2 96 447 5.0E-82
sp|Q2TXJ2|MANA_ASPOR Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=manA PE=3 SV=1 96 447 1.0E-81
sp|A2QKT4|MANA_ASPNC Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=manA PE=1 SV=1 101 444 3.0E-80
sp|Q5AVP1|MAND_EMENI Mannan endo-1,4-beta-mannosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manD PE=3 SV=1 99 428 2.0E-79
sp|A1CGC6|MANA_ASPCL Probable mannan endo-1,4-beta-mannosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=manA PE=3 SV=1 95 447 1.0E-77
sp|Q0CCD0|MANA1_ASPTN Probable mannan endo-1,4-beta-mannosidase A-1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=manA-1 PE=3 SV=1 74 448 3.0E-77
sp|Q0C8J3|MANC_ASPTN Probable mannan endo-1,4-beta-mannosidase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=manC PE=3 SV=1 92 445 2.0E-74
sp|Q5B7X2|MANA_EMENI Mannan endo-1,4-beta-mannosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manA PE=1 SV=1 93 448 7.0E-73
sp|Q0CUG5|MANA2_ASPTN Probable mannan endo-1,4-beta-mannosidase A-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=manA-2 PE=3 SV=2 92 444 3.0E-71
sp|Q5AZ53|MANC_EMENI Mannan endo-1,4-beta-mannosidase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manC PE=2 SV=1 95 444 3.0E-70
sp|Q5B833|MANB_EMENI Mannan endo-1,4-beta-mannosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manB PE=2 SV=2 98 447 2.0E-67
sp|Q0JKM9|MAN1_ORYSJ Mannan endo-1,4-beta-mannosidase 1 OS=Oryza sativa subsp. japonica GN=MAN1 PE=2 SV=2 96 427 2.0E-50
sp|Q8L5J1|MAN4_SOLLC Mannan endo-1,4-beta-mannosidase 4 OS=Solanum lycopersicum GN=MAN4 PE=1 SV=2 96 427 5.0E-50
sp|Q9FZ29|MAN1_ARATH Mannan endo-1,4-beta-mannosidase 1 OS=Arabidopsis thaliana GN=MAN1 PE=2 SV=1 92 446 7.0E-49
sp|Q9FJZ3|MAN7_ARATH Mannan endo-1,4-beta-mannosidase 7 OS=Arabidopsis thaliana GN=MAN7 PE=2 SV=1 93 388 1.0E-47
sp|Q9SG95|MAN4_ARATH Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana GN=MAN4 PE=3 SV=1 93 388 2.0E-47
sp|Q9LZV3|MAN6_ARATH Mannan endo-1,4-beta-mannosidase 6 OS=Arabidopsis thaliana GN=MAN6 PE=2 SV=1 97 428 5.0E-46
sp|Q9SG94|MAN3_ARATH Mannan endo-1,4-beta-mannosidase 3 OS=Arabidopsis thaliana GN=MAN3 PE=2 SV=1 93 388 2.0E-45
sp|Q9M0H6|MAN5_ARATH Mannan endo-1,4-beta-mannosidase 5 OS=Arabidopsis thaliana GN=MAN5 PE=2 SV=1 93 444 3.0E-45
sp|O48540|MAN1_SOLLC Mannan endo-1,4-beta-mannosidase 1 OS=Solanum lycopersicum GN=MAN1 PE=1 SV=2 93 427 7.0E-45
sp|Q9LW44|MANP_ARATH Putative mannan endo-1,4-beta-mannosidase P OS=Arabidopsis thaliana GN=MANP PE=5 SV=3 93 388 1.0E-44
sp|Q0JJD4|MAN2_ORYSJ Mannan endo-1,4-beta-mannosidase 2 OS=Oryza sativa subsp. japonica GN=MAN2 PE=2 SV=2 96 429 1.0E-44
sp|Q6Z310|MAN9_ORYSJ Putative mannan endo-1,4-beta-mannosidase 9 OS=Oryza sativa subsp. japonica GN=MAN9 PE=2 SV=2 96 427 2.0E-43
sp|Q6YM50|MAN5_SOLLC Mannan endo-1,4-beta-mannosidase 5 OS=Solanum lycopersicum GN=MAN5 PE=2 SV=1 95 427 1.0E-42
sp|Q9FZ03|MAN2_SOLLC Mannan endo-1,4-beta-mannosidase 2 OS=Solanum lycopersicum GN=MAN2 PE=2 SV=2 95 427 1.0E-42
sp|Q7Y223|MAN2_ARATH Mannan endo-1,4-beta-mannosidase 2 OS=Arabidopsis thaliana GN=MAN2 PE=2 SV=1 96 429 2.0E-42
sp|Q9FUQ6|MAN3_SOLLC Mannan endo-1,4-beta-mannosidase 3 OS=Solanum lycopersicum GN=MAN3 PE=3 SV=1 93 427 2.0E-40
sp|Q5W6G0|MAN5_ORYSJ Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica GN=MAN5 PE=2 SV=2 95 386 1.0E-36
sp|Q2RBB1|MAN7_ORYSJ Mannan endo-1,4-beta-mannosidase 7 OS=Oryza sativa subsp. japonica GN=MAN7 PE=2 SV=3 96 427 6.0E-35
sp|Q10B67|MAN4_ORYSJ Mannan endo-1,4-beta-mannosidase 4 OS=Oryza sativa subsp. japonica GN=MAN4 PE=2 SV=2 95 382 2.0E-33
sp|Q0IQJ7|MAN8_ORYSJ Mannan endo-1,4-beta-mannosidase 8 OS=Oryza sativa subsp. japonica GN=MAN8 PE=2 SV=2 97 427 3.0E-33
sp|Q0DCM5|MAN6_ORYSJ Mannan endo-1,4-beta-mannosidase 6 OS=Oryza sativa subsp. japonica GN=MAN6 PE=2 SV=2 96 382 8.0E-32
sp|Q0DM48|MAN3_ORYSJ Mannan endo-1,4-beta-mannosidase 3 OS=Oryza sativa subsp. japonica GN=MAN3 PE=2 SV=2 100 382 9.0E-28
sp|B7SIW2|XYNC_PHACH Endo-1,4-beta-xylanase C OS=Phanerochaete chrysosporium GN=xynC PE=1 SV=1 23 263 5.0E-16
sp|P46239|GUNF_FUSOX Putative endoglucanase type F OS=Fusarium oxysporum PE=2 SV=1 13 261 1.0E-14
sp|Q9HEZ1|XYNA_PHACH Endo-1,4-beta-xylanase A OS=Phanerochaete chrysosporium GN=xynA PE=1 SV=1 28 263 5.0E-14
sp|G4MPQ7|XYN6_MAGO7 Endo-1,4-beta-xylanase 6 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=XYL6 PE=3 SV=1 13 262 2.0E-13
sp|Q8NJ73|XYN6_MAGGR Endo-1,4-beta-xylanase 6 OS=Magnaporthe grisea GN=XYL6 PE=1 SV=1 13 262 2.0E-13
sp|B2ABX7|CEL6A_PODAN 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CEL6A PE=1 SV=1 32 71 3.0E-12
sp|P49075|GUX3_AGABI Exoglucanase 3 OS=Agaricus bisporus GN=cel3 PE=1 SV=1 25 65 1.0E-11
sp|P07987|GUX2_HYPJE Exoglucanase 2 OS=Hypocrea jecorina GN=cbh2 PE=1 SV=1 32 105 1.0E-10
sp|Q9C1S9|GUX6_HUMIN Exoglucanase-6A OS=Humicola insolens GN=cel6A PE=1 SV=1 31 67 3.0E-10
sp|I1S3C6|XYND_GIBZE Endo-1,4-beta-xylanase D OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=XYLD PE=1 SV=1 15 262 2.0E-09
sp|P07982|GUN2_HYPJE Endoglucanase EG-II OS=Hypocrea jecorina GN=egl2 PE=1 SV=1 17 74 2.0E-09
sp|Q4WBW4|AXE1_ASPFU Probable acetylxylan esterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=axeA PE=3 SV=1 33 64 2.0E-09
sp|G4MM92|CEL6A_MAGO7 1,4-beta-D-glucan cellobiohydrolase CEL6A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=cel6A PE=1 SV=1 33 66 2.0E-09
sp|G0RV93|CIP2_HYPJQ 4-O-methyl-glucuronoyl methylesterase OS=Hypocrea jecorina (strain QM6a) GN=cip2 PE=1 SV=1 12 65 4.0E-09
sp|Q4WFK4|CBHC_ASPFU Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cbhC PE=3 SV=1 11 66 1.0E-08
sp|B0XWL3|CBHC_ASPFC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=cbhC PE=3 SV=1 11 66 1.0E-08
sp|G2Q9T3|CEL61_MYCTT Polysaccharide monooxygenase Cel61a OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) GN=Cel61a PE=1 SV=1 33 64 2.0E-08
sp|A1DBP9|AXE1_NEOFI Probable acetylxylan esterase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=axeA PE=3 SV=1 33 64 3.0E-08
sp|Q7SDR1|GUN3_NEUCR Endoglucanase gh5-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gh5-1 PE=1 SV=1 18 80 3.0E-08
sp|A1DJQ7|CBHC_NEOFI Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cbhC PE=3 SV=1 11 66 3.0E-08
sp|Q5B2E8|CBHC_EMENI 1,4-beta-D-glucan cellobiohydrolase C OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cbhC PE=1 SV=2 17 67 4.0E-08
sp|P46236|GUNB_FUSOX Putative endoglucanase type B OS=Fusarium oxysporum PE=2 SV=1 32 71 1.0E-07
sp|A8PB24|AXE1_COPC7 Acetylxylan esterase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=CC1G_12850 PE=1 SV=1 12 66 2.0E-07
sp|Q99034|AXE1_HYPJE Acetylxylan esterase OS=Hypocrea jecorina GN=axe1 PE=1 SV=1 33 64 2.0E-07
sp|Q8WZJ4|XYNA_TALFU 1,4-beta-D-glucan cellobiohydrolase xynA OS=Talaromyces funiculosus GN=xynA PE=1 SV=1 33 64 2.0E-07
sp|A1CCN4|CBHC_ASPCL Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cbhC PE=3 SV=1 32 66 2.0E-07
sp|Q0CFP1|CBHC_ASPTN Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cbhC PE=3 SV=1 32 65 2.0E-07
sp|Q8NJP6|AXE1_TALPU Acetylxylan esterase A OS=Talaromyces purpurogenus GN=axeA PE=1 SV=1 33 64 3.0E-07
sp|A2QYR9|CBHC_ASPNC Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cbhC PE=3 SV=1 23 67 8.0E-07
sp|P43317|GUN5_HYPJE Endoglucanase-5 OS=Hypocrea jecorina GN=egl5 PE=3 SV=1 32 65 9.0E-07
sp|Q02290|XYNB_NEOPA Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum GN=xynB PE=2 SV=1 33 64 1.0E-06
sp|Q92400|GUX2_AGABI Exoglucanase OS=Agaricus bisporus GN=cel2 PE=2 SV=1 32 64 2.0E-06
sp|Q06886|GUX1_PENJA Exoglucanase 1 OS=Penicillium janthinellum GN=cbh1 PE=2 SV=1 33 64 3.0E-06
sp|Q12624|GUN3_HUMIN Endoglucanase 3 OS=Humicola insolens GN=CMC3 PE=1 SV=1 17 65 4.0E-06
sp|E7EF85|XYNB_PENOX Endo-1,4-beta-xylanase B OS=Penicillium oxalicum GN=xynB PE=1 SV=1 33 64 5.0E-06
sp|B2ADA5|GH6D_PODAN Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=GH6D PE=3 SV=1 33 64 5.0E-06
sp|O59843|CBHB_ASPAC 1,4-beta-D-glucan cellobiohydrolase B OS=Aspergillus aculeatus GN=cbhB PE=2 SV=1 32 64 6.0E-06
sp|B7SIW1|XYNB_PHACH Endo-1,4-beta-xylanase B OS=Phanerochaete chrysosporium GN=xynB PE=1 SV=1 32 64 9.0E-06
sp|Q9P7F1|YKK5_SCHPO Carbohydrate-binding domain-containing protein C2E1P3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2E1P3.05c PE=3 SV=1 13 65 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0071704 organic substance metabolic process Yes
GO:0005576 extracellular region Yes
GO:0030248 cellulose binding Yes
GO:0003824 catalytic activity No
GO:0030246 carbohydrate binding No
GO:0044238 primary metabolic process No
GO:0030247 polysaccharide binding No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|045830
MACQVICVRYKRQTRFIILAISISLATADVPVWGQCGGRGWTGETACASGSSCVVQNEWYSQCLPGSTTPTNPPP
TTTTSQTTAPPTTSHPVSTGFVKASGTRFTLNGQKYTVVGGNSYWVGLTGLSTSAMNQAFSDIANAGGTTVRTWG
FNEVTSPNGNYYQSWSGARPTINTGASGLLNFDNVIAAAKANGIRLIVALTNNWADYGGMDVYVNQMVGNGQPHD
LFYTNTAIKDAFKSYVRTFVSRYANEPTIMAWELANEPRCKGSTGTTSGTCTTTTVTNWAKEMSAFIKTIDSNHL
VAIGDEGFYNQPGAPTYPYQGSEGVDFEANLAISSVDFATFHSYPEPWGQGANAKAWGTQWITDHAASMKRVNKP
VILEEFGVTTNQPDTYAEWFNEVESSGLTGDLIWQAGSHLSTGDTHNDGYAVYPDGPVYPLMKSHASAMKNRA*
Coding >Agabi119p4|045830
ATGGCGTGTCAAGTCATTTGTGTCCGTTATAAAAGGCAGACTAGATTCATTATTTTGGCTATTTCTATCTCTCTA
GCGACCGCAGATGTTCCAGTCTGGGGTCAGTGCGGTGGCAGGGGTTGGACGGGAGAGACAGCTTGTGCAAGTGGG
TCATCTTGTGTCGTGCAGAACGAATGGTACTCGCAGTGCCTCCCTGGATCAACAACTCCAACAAATCCTCCCCCT
ACCACTACCACCTCCCAAACTACCGCTCCTCCTACCACTTCACACCCAGTGTCGACCGGATTTGTCAAAGCTTCT
GGTACCAGATTCACCCTAAATGGCCAAAAATACACTGTTGTTGGAGGCAATTCCTACTGGGTTGGTTTAACTGGG
CTCAGCACCAGTGCAATGAATCAGGCTTTCTCCGACATCGCTAACGCTGGAGGAACAACCGTCCGAACATGGGGA
TTTAATGAAGTAACCTCGCCAAACGGCAATTATTATCAATCCTGGTCTGGTGCCAGACCTACTATAAACACCGGA
GCGTCTGGTCTACTTAATTTCGACAATGTGATTGCTGCGGCCAAGGCAAATGGAATTCGTCTGATAGTTGCTCTG
ACGAATAATTGGGCGGACTATGGTGGCATGGATGTCTATGTCAACCAGATGGTGGGAAATGGCCAACCACACGAT
CTCTTCTACACAAACACCGCAATCAAGGACGCGTTCAAATCTTACGTCCGGACCTTCGTGAGCCGCTATGCCAAC
GAACCTACCATAATGGCTTGGGAGCTCGCAAATGAGCCGAGGTGCAAAGGTAGCACCGGCACGACTTCTGGAACC
TGTACAACTACGACCGTCACGAATTGGGCCAAGGAGATGTCGGCATTTATTAAAACCATTGATAGCAACCATCTC
GTTGCTATTGGCGATGAAGGTTTCTATAATCAACCCGGTGCTCCAACTTATCCATACCAAGGAAGCGAAGGTGTT
GATTTCGAAGCTAATCTCGCTATCTCCTCTGTCGACTTTGCGACCTTCCATTCCTATCCGGAACCGTGGGGACAG
GGCGCCAATGCAAAAGCCTGGGGCACTCAATGGATTACGGATCATGCTGCCAGTATGAAGAGGGTCAACAAACCC
GTTATCCTTGAAGAATTCGGTGTAACTACCAATCAACCTGATACTTACGCTGAGTGGTTCAACGAGGTAGAATCA
TCAGGGTTGACTGGTGATCTCATTTGGCAAGCCGGTTCTCACTTGTCTACGGGAGATACACACAATGACGGTTAC
GCCGTCTACCCCGATGGTCCAGTATACCCGTTAATGAAGTCGCATGCAAGTGCAATGAAAAACCGGGCTTGA
Transcript >Agabi119p4|045830
ATGGCGTGTCAAGTCATTTGTGTCCGTTATAAAAGGCAGACTAGATTCATTATTTTGGCTATTTCTATCTCTCTA
GCGACCGCAGATGTTCCAGTCTGGGGTCAGTGCGGTGGCAGGGGTTGGACGGGAGAGACAGCTTGTGCAAGTGGG
TCATCTTGTGTCGTGCAGAACGAATGGTACTCGCAGTGCCTCCCTGGATCAACAACTCCAACAAATCCTCCCCCT
ACCACTACCACCTCCCAAACTACCGCTCCTCCTACCACTTCACACCCAGTGTCGACCGGATTTGTCAAAGCTTCT
GGTACCAGATTCACCCTAAATGGCCAAAAATACACTGTTGTTGGAGGCAATTCCTACTGGGTTGGTTTAACTGGG
CTCAGCACCAGTGCAATGAATCAGGCTTTCTCCGACATCGCTAACGCTGGAGGAACAACCGTCCGAACATGGGGA
TTTAATGAAGTAACCTCGCCAAACGGCAATTATTATCAATCCTGGTCTGGTGCCAGACCTACTATAAACACCGGA
GCGTCTGGTCTACTTAATTTCGACAATGTGATTGCTGCGGCCAAGGCAAATGGAATTCGTCTGATAGTTGCTCTG
ACGAATAATTGGGCGGACTATGGTGGCATGGATGTCTATGTCAACCAGATGGTGGGAAATGGCCAACCACACGAT
CTCTTCTACACAAACACCGCAATCAAGGACGCGTTCAAATCTTACGTCCGGACCTTCGTGAGCCGCTATGCCAAC
GAACCTACCATAATGGCTTGGGAGCTCGCAAATGAGCCGAGGTGCAAAGGTAGCACCGGCACGACTTCTGGAACC
TGTACAACTACGACCGTCACGAATTGGGCCAAGGAGATGTCGGCATTTATTAAAACCATTGATAGCAACCATCTC
GTTGCTATTGGCGATGAAGGTTTCTATAATCAACCCGGTGCTCCAACTTATCCATACCAAGGAAGCGAAGGTGTT
GATTTCGAAGCTAATCTCGCTATCTCCTCTGTCGACTTTGCGACCTTCCATTCCTATCCGGAACCGTGGGGACAG
GGCGCCAATGCAAAAGCCTGGGGCACTCAATGGATTACGGATCATGCTGCCAGTATGAAGAGGGTCAACAAACCC
GTTATCCTTGAAGAATTCGGTGTAACTACCAATCAACCTGATACTTACGCTGAGTGGTTCAACGAGGTAGAATCA
TCAGGGTTGACTGGTGATCTCATTTGGCAAGCCGGTTCTCACTTGTCTACGGGAGATACACACAATGACGGTTAC
GCCGTCTACCCCGATGGTCCAGTATACCCGTTAATGAAGTCGCATGCAAGTGCAATGAAAAACCGGGCTTGA
Gene >Agabi119p4|045830
ATGGCGTGTCAAGTCATTTGTGTCCGTTATAAAAGGCAGACTAGGTGACATGACTATTGCTCTGCAAATACCCTC
AGAAAATGAAGCCTGCGATTAGATTCATTATTTTGGCTATTTCTATCTCTCTAGCGACCGCAGATGTTCCAGTCT
GGGGTCAGTGCGGTGGCAGGGGTTGGACGGGAGAGACAGGTCGGTAATTCAACTAACTCGAGTCATCCTCGTAAT
CCTGAAAGAAAGATAGCTTGTGCAAGTGGGTCATCTTGTGTCGTGCAGAACGAATGGTACTCGCAGTGCCTCCCT
GGATCAACAACTCCAACAAATCCTCCCCCTACCACTACCACCTCCCAAACTACCGCTCCTCCTACCACTTCACAC
CCAGTGTCGACCGGATTTGTCAAAGCTTCTGGTACCAGATTCACCCTAAATGGCCAAAAATACACTGTTGTTGGG
TCCGTGTCGTCTCTATCGGTACGTGTAGTGACTGATTGATTTTTTGCGTTTCTAGAGGCAATTCCTACTGGGTTG
GTTTAACTGGGCTCAGCACCAGTGCAATGAATCAGGCTTTCTCCGACATCGCTAACGCTGGAGGAACAACCGTCC
GAACATGGTGAATATCGTCATGGTGTTTGCGACTGAGATGTTATTAAAGCCCGAACTTATGATATACTAACAGGG
GATTTAATGAAGTAACCTCGCCAAACGGCAATTATTATCAATCCTGGTCTGGTGCCAGACCTACTATAAACACCG
GAGCGTCTGGTCTACTTAATTTCGGTAGGTGATATTTGATTGCGAAAAGGTACTTGGGGTAGATGGCTTAACACG
TTTTCTCAGACAATGTGATTGCTGCGGCCAAGGCAAATGGAATTCGTCTGATAGTTGCTCTGTGGGTTTCTTGCA
TTATGATGCGATATTGGAGCATGTATTGACTGATCCTTTGTTTCGGTTAGGACGAATAATTGGTAAGATAATATT
GTCCTCGTACAACATCCACCGACCAAGGCAACCTATTTAGGGCGGACTATGGTGGCATGGATGTCTATGTCAACC
AGATGGTGGGAAATGGCCAACCACACGATCTCTTCTACACAAACACCGCAATCAAGGTGGGTAGTTCGCAGAAGC
CTTGATACTTATCAATTGAACATTCCCTTAGGACGCGTTCAAATCTTACGTCCGGACCTTCGTGAGCCGCTATGC
CAACGAACCTACCATAATGGCTTGGGAGCTCGCAAATGAGCCGAGGTGCAAAGGTAGCACCGGGTGAGTTTTTTA
AGACCATAATTCGGCGTATTAATCTTAATTTCTGGAACTGACAGCACGACTTCTGGAACCTGTACAACTACGACC
GTCACGAATTGGGCCAAGGAGATGTCGGCATTTATTAAAACCATTGATAGCAACCATCTCGTTGCTATTGGCGAT
GAAGGTTTCTATAATCAACCCGGTGCTCCAACTTATCCATACCAGTAAAGTATTTCCTCCAATGCTTTTTCAGAG
AGTCTAAAATAAGTGACATAGAGGAAGCGAAGGTGTTGATTTCGAAGCTAATCTCGCTATCTCCTCTGTCGACTT
TGCGACCTTCCATGTAAGGCTTTATTCCTATACTAGTATGGTCCCTTCTCTGACGTCAAGATTCTTCCAAGTCCT
ATCCGGAACCGTGGGGACAGGGCGCCAATGCAAAAGCCTGGGGCACTCAATGGATTACGGATCATGCTGCCAGTA
TGAAGAGGGTCAACAAACCCGTTATCCTTGAAGAATTCGGTGTAACTACCAATCAACCTGATACTTACGCTGAGT
GGTTCAACGAGGTAGAATCATCAGGGTTGACTGGTGATCTCATTTGGTGCGTAGATTTAGTTTAGCACGAACTTT
ACTGACAGACTCTCCGTATGCAGGCAAGCCGGTTCTCACTTGTCTACGTTGGTTTTCTCTCTTTTCGTGCAAAGT
TGTTTGTATACTGATTTCCGATTATAGGGGAGATACACACAATGACGGTTACGCCGTCTACCCCGATGGTCCAGT
ATACCCGTTAATGAAGTCGCATGCAAGTGCAATGAAAAACCGGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail