Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|045800
Gene name
Locationscaffold_02:1665027..1667661
Strand-
Gene length (bp)2634
Transcript length (bp)2388
Coding sequence length (bp)2388
Protein length (aa) 796

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00320 GATA GATA zinc finger 4.4E-18 664 697
PF08550 DUF1752 Fungal protein of unknown function (DUF1752) 1.2E-11 11 37

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 591 793 3.0E-31
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 591 757 4.0E-28
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 591 792 5.0E-28
sp|Q01168|NUT1_MAGO7 Nitrogen regulatory protein NUT1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NUT1 PE=3 SV=1 640 768 2.0E-27
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 642 749 2.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 591 793 3.0E-31
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 591 757 4.0E-28
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 591 792 5.0E-28
sp|Q01168|NUT1_MAGO7 Nitrogen regulatory protein NUT1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NUT1 PE=3 SV=1 640 768 2.0E-27
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 642 749 2.0E-27
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 639 718 2.0E-26
sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-2 PE=1 SV=2 644 767 4.0E-26
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 639 718 6.0E-26
sp|Q01582|AREA_PENCH Nitrogen regulatory protein areA OS=Penicillium chrysogenum GN=AREA PE=3 SV=1 627 718 7.0E-25
sp|Q10280|GAF1_SCHPO Transcription factor gaf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gaf1 PE=1 SV=2 658 725 2.0E-23
sp|Q5A432|GAT1_CANAL Transcriptional regulatory protein GAT1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GAT1 PE=2 SV=1 664 713 4.0E-22
sp|P43574|GAT1_YEAST Transcriptional regulatory protein GAT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAT1 PE=1 SV=1 664 719 5.0E-21
sp|P18494|GLN3_YEAST Nitrogen regulatory protein GLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLN3 PE=1 SV=2 653 711 2.0E-19
sp|Q10134|FEP1_SCHPO Iron-sensing transcription factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fep1 PE=1 SV=1 614 721 7.0E-19
sp|P42944|GZF3_YEAST Protein GZF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GZF3 PE=1 SV=1 591 719 9.0E-19
sp|Q9HEV5|ASD4_NEUCR GATA type zinc finger protein asd-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=asd-4 PE=1 SV=1 664 714 4.0E-18
sp|Q5A201|GZF3_CANAL Transcriptional regulator GZF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GZF3 PE=2 SV=1 663 714 1.0E-17
sp|P52172|SRP_DROME Box A-binding factor OS=Drosophila melanogaster GN=srp PE=1 SV=2 664 713 3.0E-17
sp|P40349|URB1_USTMA Siderophore biosynthesis regulatory protein URBS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=URBS1 PE=3 SV=2 664 717 5.0E-17
sp|Q92259|SREP_PENCH GATA factor SREP OS=Penicillium chrysogenum GN=SREP PE=3 SV=1 664 714 4.0E-16
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 664 721 7.0E-16
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 664 721 8.0E-16
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 664 721 9.0E-16
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 664 721 1.0E-15
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 664 721 1.0E-15
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 662 713 2.0E-15
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 664 721 2.0E-15
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 662 719 2.0E-15
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 664 721 3.0E-15
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 664 721 3.0E-15
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 662 713 4.0E-15
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 664 721 4.0E-15
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 664 719 5.0E-15
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 662 713 5.0E-15
sp|P17429|AREA_EMENI Nitrogen regulatory protein areA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=areA PE=1 SV=2 1 65 6.0E-15
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 663 722 6.0E-15
sp|P26343|DAL80_YEAST Nitrogen regulatory protein DAL80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL80 PE=2 SV=1 650 709 6.0E-15
sp|O13415|AREA_ASPOR Nitrogen regulatory protein areA OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=areA PE=3 SV=1 1 49 7.0E-15
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 663 717 7.0E-15
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 662 713 7.0E-15
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 662 750 7.0E-15
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 662 713 7.0E-15
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 663 717 8.0E-15
sp|Q95JA5|GATA6_PIG Transcription factor GATA-6 (Fragment) OS=Sus scrofa GN=GATA6 PE=2 SV=2 664 721 9.0E-15
sp|O13412|AREA_ASPNG Nitrogen regulatory protein areA OS=Aspergillus niger GN=areA PE=3 SV=1 1 49 1.0E-14
sp|P91623|GATAC_DROME GATA-binding factor C OS=Drosophila melanogaster GN=grn PE=2 SV=1 662 713 1.0E-14
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 663 794 1.0E-14
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 662 713 1.0E-14
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 662 713 1.0E-14
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 662 713 1.0E-14
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 662 713 1.0E-14
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 645 713 1.0E-14
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 662 713 2.0E-14
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 664 713 2.0E-14
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 664 713 3.0E-14
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 664 713 6.0E-14
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 655 713 7.0E-14
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 662 713 1.0E-13
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 662 712 2.0E-13
sp|P78688|AREA_GIBFU Nitrogen regulatory protein areA OS=Gibberella fujikuroi GN=AREA PE=3 SV=1 1 49 6.0E-13
sp|O13508|AREA_PENRO Nitrogen regulatory protein areA OS=Penicillium roqueforti GN=AREA PE=3 SV=2 1 83 6.0E-13
sp|Q10655|ELT2_CAEEL Transcription factor elt-2 OS=Caenorhabditis elegans GN=elt-2 PE=2 SV=1 663 766 8.0E-13
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 674 766 6.0E-11
sp|Q92269|NRFA_PENUR Nitrogen regulatory protein nrfA OS=Penicillium urticae GN=nrfA PE=3 SV=1 1 40 1.0E-10
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 674 739 1.0E-10
sp|Q01168|NUT1_MAGO7 Nitrogen regulatory protein NUT1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NUT1 PE=3 SV=1 1 50 2.0E-10
sp|P19212|NIT2_NEUCR Nitrogen catabolic enzyme regulatory protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-2 PE=1 SV=2 1 46 5.0E-10
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 674 713 5.0E-10
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 674 717 9.0E-10
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 674 723 1.0E-09
sp|P43696|GAT5B_XENLA GATA-binding factor 5-B OS=Xenopus laevis GN=gata5-b PE=2 SV=1 664 736 2.0E-09
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 663 708 2.0E-09
sp|P43695|GAT5A_XENLA GATA-binding factor 5-A OS=Xenopus laevis GN=gata5-a PE=2 SV=1 664 736 3.0E-09
sp|P23767|GAT1A_XENLA GATA-binding factor 1-A OS=Xenopus laevis GN=gata1-a PE=2 SV=1 634 711 3.0E-09
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 674 717 3.0E-09
sp|P23768|GAT1B_XENLA GATA-binding factor 1-B OS=Xenopus laevis GN=gata1-b PE=2 SV=1 634 711 4.0E-09
sp|Q91677|GATA4_XENLA Transcription factor GATA-4 OS=Xenopus laevis GN=gata4 PE=2 SV=1 664 716 5.0E-09
sp|P23770|GATA2_XENLA GATA-binding factor 2 OS=Xenopus laevis GN=gata2 PE=2 SV=1 664 736 5.0E-09
sp|Q5AP95|SFU1_CANAL Suppressor of ferric uptake 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SFU1 PE=1 SV=1 664 704 6.0E-09
sp|Q0Q0E4|GATA4_CANLF Transcription factor GATA-4 OS=Canis lupus familiaris GN=GATA4 PE=2 SV=1 664 715 7.0E-09
sp|P28515|ELT1_CAEEL Transcription factor elt-1 OS=Caenorhabditis elegans GN=elt-1 PE=1 SV=1 643 701 8.0E-09
sp|P43694|GATA4_HUMAN Transcription factor GATA-4 OS=Homo sapiens GN=GATA4 PE=1 SV=2 664 715 9.0E-09
sp|P52168|PNR_DROME GATA-binding factor A OS=Drosophila melanogaster GN=pnr PE=1 SV=1 664 701 9.0E-09
sp|P97489|GATA5_MOUSE Transcription factor GATA-5 OS=Mus musculus GN=Gata5 PE=1 SV=2 664 701 9.0E-09
sp|Q9BWX5|GATA5_HUMAN Transcription factor GATA-5 OS=Homo sapiens GN=GATA5 PE=1 SV=1 664 714 9.0E-09
sp|Q08369|GATA4_MOUSE Transcription factor GATA-4 OS=Mus musculus GN=Gata4 PE=1 SV=4 664 715 1.0E-08
sp|P46152|GATA4_RAT Transcription factor GATA-4 OS=Rattus norvegicus GN=Gata4 PE=1 SV=1 664 715 1.0E-08
sp|P23824|GATA2_CHICK GATA-binding factor 2 OS=Gallus gallus GN=GATA2 PE=2 SV=1 664 736 1.0E-08
sp|P43691|GATA4_CHICK Transcription factor GATA-4 (Fragment) OS=Gallus gallus GN=GATA4 PE=2 SV=1 664 701 1.0E-08
sp|O09100|GATA2_MOUSE Endothelial transcription factor GATA-2 OS=Mus musculus GN=Gata2 PE=1 SV=2 664 736 1.0E-08
sp|P23769|GATA2_HUMAN Endothelial transcription factor GATA-2 OS=Homo sapiens GN=GATA2 PE=1 SV=3 664 736 1.0E-08
sp|P23772|GATA3_MOUSE Trans-acting T-cell-specific transcription factor GATA-3 OS=Mus musculus GN=Gata3 PE=1 SV=1 664 736 1.0E-08
sp|P23773|GATA3_XENLA GATA-binding factor 3 OS=Xenopus laevis GN=gata3 PE=2 SV=1 664 736 1.0E-08
sp|Q91428|GATA3_DANRE Transcription factor GATA-3 OS=Danio rerio GN=gata3 PE=2 SV=1 664 736 1.0E-08
sp|P23771|GATA3_HUMAN Trans-acting T-cell-specific transcription factor GATA-3 OS=Homo sapiens GN=GATA3 PE=1 SV=1 664 736 1.0E-08
sp|Q08DV0|GATA3_BOVIN Trans-acting T-cell-specific transcription factor GATA-3 OS=Bos taurus GN=GATA3 PE=2 SV=1 664 736 1.0E-08
sp|P70005|GAT6B_XENLA GATA-binding factor 6-B OS=Xenopus laevis GN=gata6-b PE=2 SV=1 651 701 1.0E-08
sp|Q91678|GAT6A_XENLA GATA-binding factor 6-A OS=Xenopus laevis GN=gata6-a PE=2 SV=1 651 736 1.0E-08
sp|Q3SZJ5|GATA5_BOVIN Transcription factor GATA-5 OS=Bos taurus GN=GATA5 PE=2 SV=1 664 714 1.0E-08
sp|P23825|GATA3_CHICK GATA-binding factor 3 OS=Gallus gallus GN=GATA3 PE=2 SV=1 664 736 2.0E-08
sp|P43429|GATA1_RAT Erythroid transcription factor OS=Rattus norvegicus GN=Gata1 PE=2 SV=1 664 711 2.0E-08
sp|P17679|GATA1_MOUSE Erythroid transcription factor OS=Mus musculus GN=Gata1 PE=1 SV=1 664 711 2.0E-08
sp|P17678|GATA1_CHICK Erythroid transcription factor OS=Gallus gallus GN=GATA1 PE=1 SV=1 664 736 3.0E-08
sp|P43692|GATA5_CHICK Transcription factor GATA-5 OS=Gallus gallus GN=GATA5 PE=1 SV=1 664 701 3.0E-08
sp|P15976|GATA1_HUMAN Erythroid transcription factor OS=Homo sapiens GN=GATA1 PE=1 SV=1 664 711 4.0E-08
sp|P43693|GATA6_CHICK Transcription factor GATA-6 OS=Gallus gallus GN=GATA6 PE=2 SV=1 664 701 6.0E-08
sp|Q92908|GATA6_HUMAN Transcription factor GATA-6 OS=Homo sapiens GN=GATA6 PE=1 SV=2 664 713 6.0E-08
sp|Q61169|GATA6_MOUSE Transcription factor GATA-6 OS=Mus musculus GN=Gata6 PE=1 SV=3 664 701 6.0E-08
sp|P46153|GATA6_RAT Transcription factor GATA-6 OS=Rattus norvegicus GN=Gata6 PE=1 SV=2 664 701 8.0E-08
sp|Q9UHF7|TRPS1_HUMAN Zinc finger transcription factor Trps1 OS=Homo sapiens GN=TRPS1 PE=1 SV=2 662 717 9.0E-08
sp|Q90ZS6|TRPS1_XENLA Zinc finger transcription factor Trps1 OS=Xenopus laevis GN=trps1 PE=1 SV=1 662 717 9.0E-08
sp|Q925H1|TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus GN=Trps1 PE=1 SV=1 662 717 1.0E-07
sp|O94720|YCF8_SCHPO GATA zinc finger domain-containing protein C1393.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.08 PE=3 SV=1 629 702 4.0E-07
sp|P52167|GATAB_BOMMO Transcription factor BCFI OS=Bombyx mori GN=GATA-B PE=2 SV=1 664 750 6.0E-07
sp|Q75JZ0|GTAH_DICDI GATA zinc finger domain-containing protein 8 OS=Dictyostelium discoideum GN=gtaH PE=3 SV=1 643 692 2.0E-06
sp|Q924Y4|GATA2_RAT Endothelial transcription factor GATA-2 OS=Rattus norvegicus GN=Gata2 PE=1 SV=1 540 736 3.0E-06
sp|Q95JA5|GATA6_PIG Transcription factor GATA-6 (Fragment) OS=Sus scrofa GN=GATA6 PE=2 SV=2 664 701 3.0E-06
sp|Q9ZPX0|GAT20_ARATH GATA transcription factor 20 OS=Arabidopsis thaliana GN=GATA20 PE=2 SV=2 644 693 8.0E-06
sp|Q9SZI6|GAT22_ARATH Putative GATA transcription factor 22 OS=Arabidopsis thaliana GN=GATA22 PE=3 SV=1 627 690 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0043565 sequence-specific DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0031323 regulation of cellular metabolic process No
GO:0003676 nucleic acid binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0019222 regulation of metabolic process No
GO:0005488 binding No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:2001141 regulation of RNA biosynthetic process No
GO:0051252 regulation of RNA metabolic process No
GO:0050794 regulation of cellular process No
GO:1901363 heterocyclic compound binding No
GO:0050789 regulation of biological process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0003677 DNA binding No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0008150 biological_process No
GO:0010468 regulation of gene expression No
GO:0080090 regulation of primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
GATA type zinc finger

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|045800
MAKEDPLATQVWKMYARQKAQLPHAQRMENLTWRMMALALKKKKDEEARLNADLTNELPGTPDVSPDQPSSNGTP
EARNETGERGRRIDKGKARVRVLGFDGTSQDGLEEDDAVPMDWRAISRSRSRISMDWRPTSRSRSRVADAAMSFE
QYGFLPPPAHENQFTFPTLSSAPLEHSRPDHAYGRWLSKPAYNVASPGTSLLSSGKPSPPFASNNPLSSVLEDPA
DRNSGSFNFPTDSRYHHMMQLHPPTSFDDSFAPASLPATGLHGFSKMPSRVSSPELRGFPRHVRKTSFDHTVSRE
GILQNLGGRHQVNGKPIPPLQSLLGTKRPAENVHFDSLLRSDPSNVNDNTAQSTSANARTIGRSENNNPFPTSSF
NFSFPAYDGIFDLPSSETSASADFSHSLRTSGAGGGSGATNAGSGNADGSRVEFPGQGFPTRGFVRGNQSHNHHE
GLSAAAAAASAAMAEGYAQLSAANMVDDSGLDYRQLAGLGLVYPLDISPFTHVDPTQIVDFTVNVNPGGLSPGSD
GWTNGIGPSPTASPGSYNTSNAPTPPPADSPGGTGVGTSGNTSQSQPSRRGTDQTRKYMSLQQGAQEVQRAKSTS
NNINIANSSGGANPDGRSSTATPETNGVGTTSSSASQLEEGGSGSGAQRSGKSGEDGDPLPTLCTNCQTTNTPLW
RRDPEGQPLCNACGLFYKLHGVVRPLSLKTDVIKKRNRASGNTNSSSRKGTVLPKIASSTSRPRSQSGSTISTAA
RGMPSAANQRVSVTQAAAGGGGAVGSSSMSMKRQRRTSGLTDSTP*
Coding >Agabi119p4|045800
ATGGCCAAAGAGGACCCTCTTGCCACTCAAGTCTGGAAGATGTATGCTCGTCAAAAGGCTCAGCTTCCACACGCC
CAGCGCATGGAAAATCTTACTTGGCGGATGATGGCGCTTGCTCTCAAGAAGAAAAAGGATGAAGAAGCGAGGTTG
AACGCGGATCTGACCAACGAGCTGCCAGGCACACCGGATGTCTCGCCTGATCAACCATCAAGCAATGGCACCCCC
GAGGCCAGAAATGAAACAGGTGAACGTGGGCGTAGAATTGATAAGGGAAAAGCAAGGGTCCGAGTACTTGGCTTT
GACGGAACCAGTCAGGATGGTCTCGAAGAGGATGATGCCGTACCCATGGACTGGAGGGCTATAAGTCGGTCAAGA
TCTCGTATATCGATGGATTGGAGGCCTACCAGTCGTTCTCGTTCGCGCGTCGCCGATGCTGCCATGTCCTTTGAG
CAATATGGTTTTTTACCGCCGCCAGCTCACGAAAACCAGTTTACGTTTCCTACGCTCTCGTCTGCTCCACTCGAG
CATTCTCGGCCAGATCATGCCTACGGGAGGTGGTTGTCCAAACCTGCGTACAATGTGGCCTCCCCCGGTACTTCC
CTTTTGTCCTCTGGGAAGCCGAGTCCCCCATTTGCCAGCAACAACCCGTTGTCATCTGTCCTCGAGGACCCAGCT
GACCGCAACTCTGGCTCCTTCAACTTTCCCACCGACAGTCGATACCACCACATGATGCAATTGCATCCCCCGACA
TCTTTCGATGACTCGTTTGCTCCCGCGTCACTACCTGCCACTGGACTGCACGGTTTTTCCAAAATGCCCAGCAGA
GTATCGTCTCCTGAACTGCGAGGGTTCCCTCGACATGTACGCAAAACGAGCTTTGATCACACAGTTTCTAGGGAA
GGAATTCTACAAAACCTAGGAGGTCGCCATCAAGTGAACGGAAAGCCAATTCCTCCCCTGCAAAGTCTGTTGGGC
ACGAAGCGTCCCGCCGAGAATGTTCATTTCGATAGTCTATTGCGCTCTGACCCCTCAAACGTGAACGACAATACG
GCGCAATCAACCTCGGCAAACGCAAGGACAATAGGGCGTTCAGAAAACAACAATCCGTTCCCCACTTCCTCGTTC
AATTTTTCCTTTCCAGCATACGATGGTATATTCGACCTTCCCTCTTCCGAAACCAGTGCAAGTGCAGATTTCTCT
CACAGTCTTCGGACTTCTGGCGCCGGAGGCGGGAGTGGAGCTACCAATGCCGGTTCCGGTAATGCAGATGGCAGT
CGCGTTGAATTTCCTGGTCAGGGGTTTCCAACCCGAGGATTTGTTCGTGGCAACCAGTCCCATAATCATCACGAA
GGTTTGTCAGCAGCCGCTGCCGCTGCCTCTGCCGCTATGGCGGAGGGCTATGCCCAGCTGAGTGCGGCAAATATG
GTGGACGACTCTGGATTGGACTATCGCCAGCTAGCGGGCCTTGGTTTAGTCTATCCTCTCGACATCTCACCGTTT
ACGCACGTCGATCCGACGCAGATTGTAGATTTCACAGTGAATGTGAATCCAGGTGGATTAAGTCCCGGAAGTGAC
GGATGGACCAATGGTATTGGACCGAGTCCCACCGCTAGCCCTGGATCATATAATACTTCTAATGCTCCTACGCCA
CCTCCAGCGGACAGCCCCGGCGGGACAGGTGTTGGCACGAGTGGCAACACCTCTCAGTCTCAACCATCGAGGCGG
GGGACAGATCAGACGAGGAAGTACATGTCTTTGCAACAGGGAGCCCAGGAGGTTCAACGGGCAAAGTCGACTTCG
AACAATATTAATATCGCTAACTCTTCGGGTGGAGCCAACCCAGATGGGAGATCTTCAACGGCTACACCTGAAACG
AACGGAGTGGGTACTACTAGTTCAAGTGCGAGTCAGTTGGAGGAAGGTGGGAGTGGGAGTGGCGCTCAACGCAGC
GGAAAAAGCGGTGAAGATGGTGACCCTCTGCCTACGTTATGCACGAATTGCCAAACGACAAACACACCTTTATGG
AGGAGGGACCCCGAAGGCCAGCCCCTATGTAACGCATGCGGATTGTTTTACAAACTTCACGGTGTTGTTAGACCG
CTTTCCCTGAAGACGGACGTCATCAAGAAGCGGAATCGTGCATCTGGTAACACCAACAGCAGTTCGCGCAAAGGC
ACCGTGCTACCCAAGATTGCATCCTCGACATCGCGTCCTCGCTCTCAATCGGGTTCGACAATATCAACGGCAGCG
CGAGGAATGCCATCGGCTGCCAATCAGAGGGTAAGTGTGACACAAGCTGCTGCTGGAGGCGGTGGCGCTGTTGGA
AGTAGCTCAATGTCAATGAAACGGCAAAGACGGACATCGGGTCTGACAGATTCTACGCCGTAA
Transcript >Agabi119p4|045800
ATGGCCAAAGAGGACCCTCTTGCCACTCAAGTCTGGAAGATGTATGCTCGTCAAAAGGCTCAGCTTCCACACGCC
CAGCGCATGGAAAATCTTACTTGGCGGATGATGGCGCTTGCTCTCAAGAAGAAAAAGGATGAAGAAGCGAGGTTG
AACGCGGATCTGACCAACGAGCTGCCAGGCACACCGGATGTCTCGCCTGATCAACCATCAAGCAATGGCACCCCC
GAGGCCAGAAATGAAACAGGTGAACGTGGGCGTAGAATTGATAAGGGAAAAGCAAGGGTCCGAGTACTTGGCTTT
GACGGAACCAGTCAGGATGGTCTCGAAGAGGATGATGCCGTACCCATGGACTGGAGGGCTATAAGTCGGTCAAGA
TCTCGTATATCGATGGATTGGAGGCCTACCAGTCGTTCTCGTTCGCGCGTCGCCGATGCTGCCATGTCCTTTGAG
CAATATGGTTTTTTACCGCCGCCAGCTCACGAAAACCAGTTTACGTTTCCTACGCTCTCGTCTGCTCCACTCGAG
CATTCTCGGCCAGATCATGCCTACGGGAGGTGGTTGTCCAAACCTGCGTACAATGTGGCCTCCCCCGGTACTTCC
CTTTTGTCCTCTGGGAAGCCGAGTCCCCCATTTGCCAGCAACAACCCGTTGTCATCTGTCCTCGAGGACCCAGCT
GACCGCAACTCTGGCTCCTTCAACTTTCCCACCGACAGTCGATACCACCACATGATGCAATTGCATCCCCCGACA
TCTTTCGATGACTCGTTTGCTCCCGCGTCACTACCTGCCACTGGACTGCACGGTTTTTCCAAAATGCCCAGCAGA
GTATCGTCTCCTGAACTGCGAGGGTTCCCTCGACATGTACGCAAAACGAGCTTTGATCACACAGTTTCTAGGGAA
GGAATTCTACAAAACCTAGGAGGTCGCCATCAAGTGAACGGAAAGCCAATTCCTCCCCTGCAAAGTCTGTTGGGC
ACGAAGCGTCCCGCCGAGAATGTTCATTTCGATAGTCTATTGCGCTCTGACCCCTCAAACGTGAACGACAATACG
GCGCAATCAACCTCGGCAAACGCAAGGACAATAGGGCGTTCAGAAAACAACAATCCGTTCCCCACTTCCTCGTTC
AATTTTTCCTTTCCAGCATACGATGGTATATTCGACCTTCCCTCTTCCGAAACCAGTGCAAGTGCAGATTTCTCT
CACAGTCTTCGGACTTCTGGCGCCGGAGGCGGGAGTGGAGCTACCAATGCCGGTTCCGGTAATGCAGATGGCAGT
CGCGTTGAATTTCCTGGTCAGGGGTTTCCAACCCGAGGATTTGTTCGTGGCAACCAGTCCCATAATCATCACGAA
GGTTTGTCAGCAGCCGCTGCCGCTGCCTCTGCCGCTATGGCGGAGGGCTATGCCCAGCTGAGTGCGGCAAATATG
GTGGACGACTCTGGATTGGACTATCGCCAGCTAGCGGGCCTTGGTTTAGTCTATCCTCTCGACATCTCACCGTTT
ACGCACGTCGATCCGACGCAGATTGTAGATTTCACAGTGAATGTGAATCCAGGTGGATTAAGTCCCGGAAGTGAC
GGATGGACCAATGGTATTGGACCGAGTCCCACCGCTAGCCCTGGATCATATAATACTTCTAATGCTCCTACGCCA
CCTCCAGCGGACAGCCCCGGCGGGACAGGTGTTGGCACGAGTGGCAACACCTCTCAGTCTCAACCATCGAGGCGG
GGGACAGATCAGACGAGGAAGTACATGTCTTTGCAACAGGGAGCCCAGGAGGTTCAACGGGCAAAGTCGACTTCG
AACAATATTAATATCGCTAACTCTTCGGGTGGAGCCAACCCAGATGGGAGATCTTCAACGGCTACACCTGAAACG
AACGGAGTGGGTACTACTAGTTCAAGTGCGAGTCAGTTGGAGGAAGGTGGGAGTGGGAGTGGCGCTCAACGCAGC
GGAAAAAGCGGTGAAGATGGTGACCCTCTGCCTACGTTATGCACGAATTGCCAAACGACAAACACACCTTTATGG
AGGAGGGACCCCGAAGGCCAGCCCCTATGTAACGCATGCGGATTGTTTTACAAACTTCACGGTGTTGTTAGACCG
CTTTCCCTGAAGACGGACGTCATCAAGAAGCGGAATCGTGCATCTGGTAACACCAACAGCAGTTCGCGCAAAGGC
ACCGTGCTACCCAAGATTGCATCCTCGACATCGCGTCCTCGCTCTCAATCGGGTTCGACAATATCAACGGCAGCG
CGAGGAATGCCATCGGCTGCCAATCAGAGGGTAAGTGTGACACAAGCTGCTGCTGGAGGCGGTGGCGCTGTTGGA
AGTAGCTCAATGTCAATGAAACGGCAAAGACGGACATCGGGTCTGACAGATTCTACGCCGTAA
Gene >Agabi119p4|045800
ATGGCCAAAGAGGACCCTCTTGCCACTCAAGTCTGGAAGATGTATGCTCGTCAAAAGGCTCAGCTTCCACACGCC
CAGCGCATGGAAAATCTTACTTGGCGGATGATGGCGCTTGCTCTCAAGAAGAAAAAGGATGAAGAAGCGAGGTTG
AACGCGGATCTGACCAACGAGCTGCCAGGCACACCGGATGTCTCGCCTGATCAACCATCAAGCAATGGCACCCCC
GAGGCCAGAAATGAAACAGGTGAACGTGGGCGTAGAATTGATAAGGGAAAAGCAAGGGTCCGAGTACTTGGCTTT
GACGGAACCAGTCAGGATGGTCTCGAAGAGGATGAGTGAGTCGTCGTTTGCTTTCCATCGCCAAGCTTAGCCGAT
TGCTTACGTCGCTTCCACCTATCCTTCCGCCTCTTTTCCCTTCTAGTGCCGTACCCATGGACTGGAGGGCTATAA
GTCGGTCAAGATCTCGTATATCGATGGATTGGAGGCCTACCAGTCGTTCTCGTTCGCGCGTCGCCGATGCTGCCA
TGTCCTTTGAGCAATATGGTTTTTTACCGCCGCCAGCTCACGAAAACCAGTTTACGTTTCCTACGCTCTCGTCTG
CTCCACTCGAGCATTCTCGGCCAGATCATGCCTACGGGAGGTGGTTGTCCAAACCTGCGTACAATGTGGCCTCCC
CCGGTACTTCCCTTTTGTCCTCTGGGAAGCCGAGTCCCCCATTTGCCAGCAACAACCCGTTGTCATCTGTCCTCG
AGGACCCAGCTGACCGCAACTCTGGCTCCTTCAACTTTCCCACCGACAGTCGATACCACCACATGATGCAATTGC
ATCCCCCGACATCTTTCGATGACTCGTTTGCTCCCGCGTCACTACCTGCCACTGGACTGCACGGTTTTTCCAAAA
TGCCCAGCAGAGTATCGTCTCCTGAACTGCGAGGGTTCCCTCGACATGTACGCAAAACGAGCTTTGATCACACAG
TTTCTAGGGAAGGAATTCTACAAAACCTAGGAGGTCGCCATCAAGTGAACGGAAAGCCAATTCCTCCCCTGCAAA
GTCTGTTGGGCACGAAGCGTCCCGCCGAGAATGTTCATTTCGATAGTCTATTGCGCTCTGACCCCTCAAACGTGA
ACGACAATACGGCGCAATCAACCTCGGCAAACGCAAGGACAATAGGGCGTTCAGAAAACAACAATCCGTTCCCCA
CTTCCTCGTTCAATTTTTCCTTTCCAGCATACGATGGTATATTCGACCTTCCCTCTTCCGAAACCAGTGCAAGTG
CAGATTTCTCTCACAGTCTTCGGACTTCTGGCGCCGGAGGCGGGAGTGGAGCTACCAATGCCGGTTCCGGTAATG
CAGATGGCAGTCGCGTTGAATTTCCTGGTCAGGGGTTTCCAACCCGAGGATTTGTTCGTGGCAACCAGTCCCATA
ATCATCACGAAGGTTTGTCAGCAGCCGCTGCCGCTGCCTCTGCCGCTATGGCGGAGGGCTATGCCCAGCTGAGTG
CGGCAAATATGGTGGACGACTCTGGATTGGACTATCGCCAGCTAGCGGGCCTTGGTTTAGTCTATCCTCTCGACA
TCTCACCGTTTACGCACGTCGATCCGACGCAGATTGTAGATTTCACAGTGAATGTGAATCCAGGTGGATTAAGTC
CCGGAAGTGACGGATGGACCAATGGTATTGGACCGAGTCCCACCGCTAGCCCTGGATCATATAATACTTCTAATG
CTCCTACGCCACCTCCAGCGGACAGCCCCGGCGGGACAGGTGTTGGCACGAGTGGCAACACCTCTCAGTCTCAAC
CATCGAGGCGGGGGACAGATCAGACGAGGAAGTACATGTCTTTGCAACAGGGAGCCCAGGAGGTTCAACGGGCAA
AGTCGACTTCGAACAATATTAATATCGCTAACTCTTCGGGTGGAGCCAACCCAGATGGGAGATCTTCAACGGCTA
CACCTGAAACGAACGGAGTGGGTACTACTAGTTCAAGTGCGAGTCAGTTGGAGGAAGGTGGGAGTGGGAGTGGCG
CTCAACGCAGCGGAAAAAGCGGTGAAGATGGTGACCCTCTGCCTACGTTATGCACGAATTGCCAAACGACAAACA
CACCTTTATGGAGGAGGGACCCCGAAGGCCAGCCCCTATGTAAGCATCCCATTATAATTCTCCATGATCTCTAGT
GAAATATTGTGCTTCTAGGTAACGCATGCGGATTGTTTTACGTGGGTTGCTATGAATCTCTGTGCTATCGACATT
TACTCACTGTTGCTGCAGAAACTTCACGGTGTTGTTAGACCGCTTTCCCTGAAGACGGACGTCATCAAGAAGCGG
TATGCAAAATTTAAATTCTCATTGCTAGTCCGCCGTTTTGACATTGTAACCAGGAATCGTGCATCTGGTAACACC
AACAGCAGTTCGCGCAAAGGCACCGTGCTACCCAAGATTGCATCCTCGACATCGCGTCCTCGCTCTCAATCGGGT
TCGACAATATCAACGGCAGCGCGAGGAATGCCATCGGCTGCCAATCAGAGGGTAAGTGTGACACAAGCTGCTGCT
GGAGGCGGTGGCGCTGTTGGAAGTAGCTCAATGTCAATGAAACGGCAAAGACGGACATCGGGTCTGACAGATTCT
ACGCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail