Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabi119p4|045750
Gene name
Locationscaffold_02:1646664..1648890
Strand+
Gene length (bp)2226
Transcript length (bp)1782
Coding sequence length (bp)1782
Protein length (aa) 594

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05918 API5 Apoptosis inhibitory protein 5 (API5) 4.8E-20 34 216

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZY79|API5B_XENLA Apoptosis inhibitor 5-B OS=Xenopus laevis GN=api5-b PE=2 SV=1 49 176 2.0E-12
sp|Q6DDM4|API5A_XENLA Apoptosis inhibitor 5-A OS=Xenopus laevis GN=api5-a PE=2 SV=1 49 200 3.0E-12
sp|Q5ZMW3|API5_CHICK Apoptosis inhibitor 5 OS=Gallus gallus GN=API5 PE=2 SV=1 49 170 4.0E-11
sp|O35841|API5_MOUSE Apoptosis inhibitor 5 OS=Mus musculus GN=Api5 PE=1 SV=2 46 170 5.0E-11
sp|Q5R644|API5_PONAB Apoptosis inhibitor 5 OS=Pongo abelii GN=API5 PE=2 SV=1 46 170 6.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7ZY79|API5B_XENLA Apoptosis inhibitor 5-B OS=Xenopus laevis GN=api5-b PE=2 SV=1 49 176 2.0E-12
sp|Q6DDM4|API5A_XENLA Apoptosis inhibitor 5-A OS=Xenopus laevis GN=api5-a PE=2 SV=1 49 200 3.0E-12
sp|Q5ZMW3|API5_CHICK Apoptosis inhibitor 5 OS=Gallus gallus GN=API5 PE=2 SV=1 49 170 4.0E-11
sp|O35841|API5_MOUSE Apoptosis inhibitor 5 OS=Mus musculus GN=Api5 PE=1 SV=2 46 170 5.0E-11
sp|Q5R644|API5_PONAB Apoptosis inhibitor 5 OS=Pongo abelii GN=API5 PE=2 SV=1 46 170 6.0E-11
sp|Q9BZZ5|API5_HUMAN Apoptosis inhibitor 5 OS=Homo sapiens GN=API5 PE=1 SV=3 46 170 6.0E-11
sp|Q9V431|API5_DROME Apoptosis inhibitor 5 homolog OS=Drosophila melanogaster GN=Aac11 PE=2 SV=1 49 176 2.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Agabi119p4|045750
MNREVAQQERELRDMLRRAEDSSDLQGPLRQETLKRLISLVHSPHTPLKILAAGNMRFFLKDFPDLEEAAIDAIY
DLCEDSSAQVRIEGYHAITQVSRTQGKWIKRNVDVLVQLLQSEDIQEVGVVKLALVEHLNMDFKITISVLCDQII
PRDDVSDEEEVSIRERLRFLVLAFMTGEAKSAICERQFLPGDAAESVLYDGLFAAVPHLGVDDLQLAVKGLICSL
PAFKSKQPTGKGSELLQLLLNGKLTGSLKADLQSESKSLSPTTKALLDICEHITCVLFAAPAIDLLQFYYYSLIG
KIALQRFPVDEQRWIVGHLARILSVAEKQATLQHSNLHWRVVDATPYLFEVYQKSKISEPEFQAVYDVFIQACFK
RSKDSSWVVPTNILKVLQEYRPPQNIAQNQEYENIFRSFSQSNQVPPPNNGALQNNATTSTSQPNTSSTPTLRAP
ALRPSGSLPEGSGPVNRQAGSEIRDTKHGTSMRPAKRTKVEEVANPQRAPSLLSRLSDTISRQPSHSNLSLGVQP
TFLPEEKRQPEPTQGLSIKGAATKQALQNGGDPISRPTSSSLLERLQGPYLKESGTRQADAGRKRKIV*
Coding >Agabi119p4|045750
ATGAATCGCGAGGTAGCACAGCAAGAACGTGAACTACGAGACATGCTGCGACGAGCCGAGGACTCCTCAGATCTA
CAGGGCCCACTGAGACAAGAAACCCTCAAACGCTTAATTAGTTTAGTGCATTCGCCGCATACACCTCTCAAAATA
CTGGCCGCAGGCAACATGCGGTTCTTCTTGAAAGATTTTCCCGACTTAGAGGAAGCAGCAATAGATGCTATTTAT
GATCTCTGCGAAGATTCTTCCGCACAGGTTCGTATTGAAGGTTATCACGCTATCACGCAAGTTTCAAGGACACAG
GGCAAGTGGATAAAGAGAAATGTAGATGTCCTGGTTCAATTATTGCAGAGCGAGGATATCCAAGAAGTTGGCGTC
GTCAAGCTGGCCCTAGTAGAACATTTGAACATGGACTTCAAAATTACTATAAGTGTGCTCTGTGACCAGATCATC
CCGCGAGATGACGTCTCAGATGAAGAGGAAGTATCTATCAGAGAGCGTCTTAGGTTCCTTGTCTTGGCATTTATG
ACTGGAGAAGCCAAAAGTGCGATATGCGAGAGACAATTTCTTCCCGGAGACGCTGCAGAGTCGGTGCTTTACGAT
GGACTTTTTGCGGCAGTCCCACACCTCGGAGTAGATGACCTACAGCTTGCCGTAAAAGGTCTTATATGTTCACTT
CCTGCATTCAAGTCCAAACAACCCACTGGAAAAGGCTCGGAACTGCTGCAGCTACTATTGAATGGCAAATTAACA
GGCTCGTTGAAAGCCGATTTACAATCGGAATCGAAGAGTCTCAGCCCCACGACTAAAGCATTGCTAGATATCTGC
GAACATATAACTTGCGTCTTGTTTGCTGCCCCTGCTATCGATTTGCTACAATTCTACTATTATTCCCTGATAGGA
AAAATCGCGCTGCAGAGGTTTCCAGTAGATGAGCAACGGTGGATCGTCGGTCATCTGGCTCGGATACTTAGCGTG
GCCGAAAAACAGGCGACCCTGCAGCATTCCAATTTGCATTGGAGGGTTGTGGACGCAACTCCATATCTTTTTGAG
GTATATCAAAAATCAAAAATTTCTGAGCCTGAATTTCAGGCCGTATATGATGTCTTCATTCAGGCATGCTTCAAA
CGCTCAAAAGATTCCTCTTGGGTCGTTCCTACCAATATCTTAAAAGTATTACAAGAGTACAGACCACCTCAAAAC
ATCGCACAAAACCAAGAGTATGAGAACATATTTAGGTCGTTTTCGCAGTCAAATCAGGTACCCCCACCGAATAAC
GGCGCATTACAAAACAATGCAACGACTTCAACATCACAACCCAATACTTCTTCCACGCCGACTTTACGAGCGCCC
GCTTTACGTCCTTCCGGATCTCTTCCTGAAGGTTCAGGTCCTGTAAATAGGCAAGCTGGCTCCGAGATTCGAGAC
ACCAAACATGGAACATCTATGCGACCGGCGAAAAGGACCAAAGTTGAAGAAGTTGCGAATCCGCAGAGAGCGCCT
AGCCTGCTGAGTCGTCTGAGTGACACCATCAGTCGCCAACCGTCTCACTCAAATCTATCGCTGGGAGTGCAGCCT
ACTTTTTTGCCTGAAGAAAAGCGACAACCCGAACCTACACAAGGACTGTCCATCAAAGGGGCTGCCACCAAGCAA
GCATTACAGAATGGTGGTGACCCGATCTCAAGGCCGACCTCGTCTTCTCTCCTAGAACGACTACAGGGACCTTAT
TTAAAAGAGTCTGGTACACGGCAAGCCGATGCAGGGAGAAAAAGAAAGATTGTATAA
Transcript >Agabi119p4|045750
ATGAATCGCGAGGTAGCACAGCAAGAACGTGAACTACGAGACATGCTGCGACGAGCCGAGGACTCCTCAGATCTA
CAGGGCCCACTGAGACAAGAAACCCTCAAACGCTTAATTAGTTTAGTGCATTCGCCGCATACACCTCTCAAAATA
CTGGCCGCAGGCAACATGCGGTTCTTCTTGAAAGATTTTCCCGACTTAGAGGAAGCAGCAATAGATGCTATTTAT
GATCTCTGCGAAGATTCTTCCGCACAGGTTCGTATTGAAGGTTATCACGCTATCACGCAAGTTTCAAGGACACAG
GGCAAGTGGATAAAGAGAAATGTAGATGTCCTGGTTCAATTATTGCAGAGCGAGGATATCCAAGAAGTTGGCGTC
GTCAAGCTGGCCCTAGTAGAACATTTGAACATGGACTTCAAAATTACTATAAGTGTGCTCTGTGACCAGATCATC
CCGCGAGATGACGTCTCAGATGAAGAGGAAGTATCTATCAGAGAGCGTCTTAGGTTCCTTGTCTTGGCATTTATG
ACTGGAGAAGCCAAAAGTGCGATATGCGAGAGACAATTTCTTCCCGGAGACGCTGCAGAGTCGGTGCTTTACGAT
GGACTTTTTGCGGCAGTCCCACACCTCGGAGTAGATGACCTACAGCTTGCCGTAAAAGGTCTTATATGTTCACTT
CCTGCATTCAAGTCCAAACAACCCACTGGAAAAGGCTCGGAACTGCTGCAGCTACTATTGAATGGCAAATTAACA
GGCTCGTTGAAAGCCGATTTACAATCGGAATCGAAGAGTCTCAGCCCCACGACTAAAGCATTGCTAGATATCTGC
GAACATATAACTTGCGTCTTGTTTGCTGCCCCTGCTATCGATTTGCTACAATTCTACTATTATTCCCTGATAGGA
AAAATCGCGCTGCAGAGGTTTCCAGTAGATGAGCAACGGTGGATCGTCGGTCATCTGGCTCGGATACTTAGCGTG
GCCGAAAAACAGGCGACCCTGCAGCATTCCAATTTGCATTGGAGGGTTGTGGACGCAACTCCATATCTTTTTGAG
GTATATCAAAAATCAAAAATTTCTGAGCCTGAATTTCAGGCCGTATATGATGTCTTCATTCAGGCATGCTTCAAA
CGCTCAAAAGATTCCTCTTGGGTCGTTCCTACCAATATCTTAAAAGTATTACAAGAGTACAGACCACCTCAAAAC
ATCGCACAAAACCAAGAGTATGAGAACATATTTAGGTCGTTTTCGCAGTCAAATCAGGTACCCCCACCGAATAAC
GGCGCATTACAAAACAATGCAACGACTTCAACATCACAACCCAATACTTCTTCCACGCCGACTTTACGAGCGCCC
GCTTTACGTCCTTCCGGATCTCTTCCTGAAGGTTCAGGTCCTGTAAATAGGCAAGCTGGCTCCGAGATTCGAGAC
ACCAAACATGGAACATCTATGCGACCGGCGAAAAGGACCAAAGTTGAAGAAGTTGCGAATCCGCAGAGAGCGCCT
AGCCTGCTGAGTCGTCTGAGTGACACCATCAGTCGCCAACCGTCTCACTCAAATCTATCGCTGGGAGTGCAGCCT
ACTTTTTTGCCTGAAGAAAAGCGACAACCCGAACCTACACAAGGACTGTCCATCAAAGGGGCTGCCACCAAGCAA
GCATTACAGAATGGTGGTGACCCGATCTCAAGGCCGACCTCGTCTTCTCTCCTAGAACGACTACAGGGACCTTAT
TTAAAAGAGTCTGGTACACGGCAAGCCGATGCAGGGAGAAAAAGAAAGATTGTATAA
Gene >Agabi119p4|045750
ATGAATCGCGAGGTAGCACAGCAAGAACGTGAACTACGAGGTATGATACCATGACCGTGAAGTGTTGCTGCTAAA
AAATATGTGCTAGACATGCTGCGACGAGCCGAGGACTCCTCAGATCTACAGGGCCCACTGGTAAGATGGTTTTCG
CGGATCCATCCAACAAGCTTTGCTCATGTTTTTTAGAGACAAGAAACCCTCAAACGCTTAATTAGTTTAGTGCAT
TCGCCGCATACACCTCTCAAAATACTGGCCGCAGGCAACATGCGGTTCTTCTTGAAAGATTTTCCCGACTTAGAG
GAAGCAGCAATAGATGCTATTTATGATCTCTGCGAAGATTCTTCCGCACAGGTACGTCCACTTTGTGCCACCTAC
TCATTCTTTCGTCTGGAAACTCATCATCTAGTAGGTTCGTATTGAAGGTTATCACGCTATCACGCAAGTTTCAAG
GACACAGGGCAAGTGGATAAAGAGAAATGTAGATGTCCTGGTTCAATTATTGCAGAGCGGTGAGATTCGTTCAAC
CTTTCTCCTTTGGTTTGATCATAACAGAAGGTCATAGAGGATATCCAAGAAGTTGGCGTCGTCAAGCTGGCCCTA
GTAGAACATTTGAACATGGACTTCAAAATTACTATAAGTGTGCTCTGTGACCAGATCATCCCGCGAGATGACGTC
TCAGATGAAGAGGAAGTATCTATCAGAGAGCGTCTTAGGTTCCTTGTCTTGGCATTTATGACTGGAGAAGCCAAA
AGTGCGATATGCGAGAGACAATTTCTTCCCGGAGACGCTGCAGAGTCGGTGCTTTACGATGGACTTTTTGCGGTG
CGAGCCCCAGTCTCCACTCTTTCACTCACAACTCATAGGTCTGCTTACCGATTTCATCGTCGCCAGGCAGTCCCA
CACCTCGGAGTAGATGACCTACAGCTTGCCGTAAAAGGTCTTATATGTTCACTTCCTGCATTCAAGTCCAAACAA
CCCACTGGAAAAGGCTCGGAACTGCTGCAGCTACTATTGAATGGCAAATTAACAGGCTCGTTGAAAGCCGATTTA
CAATCGGAATCGAAGAGTCTCAGCCCCACGACTAAAGCATTGCTAGATATCTGCGAACATATAACTTGCGTCTTG
TTTGCTGCCCCTGCTATCGATTTGCTACAATTCTACTATTATTCCCTGATAGGAAAAATCGCGCTGCAGAGGTTT
CCAGTAGATGAGCAACGGTGGATCGTCGGTCATCTGGCTCGGATACTTAGCGTGGCCGAAAAACAGGCGACCCTG
CAGCATTCCAATTTGCATTGGAGGGTTGTGGACGCAACTCCATATCTTTTTGAGGTCTGTTCCCTGTCACTACCT
TTTGTCCAATTGATTCACAATAATAATAGGTATATCAAAAATCAAAAATTTCTGAGCCTGAATTTCAGGCCGTAT
ATGATGTCTTCATTCAGGCATGCTTCAAAGTGCGATCTTACCTTTCAGAGCTACCAGCGTCTTACACCATCCGTC
ATAGCGCTCAAAAGATTCCTCTTGGGTCGTTCCTACCAATATCTTAAAAGTATTACAAGAGTACAGACCACCTCA
AAACATCGCACAAAACCAAGAGTATGAGAACATATTTAGGGTTCGCAGTGGTCGTATTATTTTATTGGCTACTCC
CATCCAACGTCGTTTTTGCCTGTTTTCTAGTCGTTTTCGCAGTCAAATCAGGTACCCCCACCGAATAACGGCGCA
TTACAAAACAATGCAACGACTTCAACATCACAACCCAATACTTCTTCCACGCCGACTTTACGAGCGCCCGCTTTA
CGTCCTTCCGGATCTCTTCCTGAAGGTTCAGGTCCTGTAAATAGGCAAGCTGGCTCCGAGATTCGAGACACCAAA
CATGGAACATCTATGCGACCGGCGAAAAGGACCAAAGTTGAAGAAGTTGCGAATCCGCAGAGAGCGCCTAGCCTG
CTGAGTCGTCTGAGTGACACCATCAGTCGCCAACCGTCTCACTCAAATCTATCGCTGGGAGTGCAGCCTACTTTT
TTGCCTGAAGAAAAGCGACAACCCGAACCTACACAAGGACTGTCCATCAAAGGGGCTGCCACCAAGCAAGCATTA
CAGAATGGTGGTGACCCGATCTCAAGGCCGACCTCGTCTTCTCTCCTAGAACGACTACAGGGACCTTATTTAAAA
GAGTCTGGTACACGGCAAGCCGATGCAGGGAGAAAAAGAAAGATTGTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail