Protein ID | Agabi119p4|045680 |
Gene name | |
Location | scaffold_02:1623945..1624818 |
Strand | - |
Gene length (bp) | 873 |
Transcript length (bp) | 771 |
Coding sequence length (bp) | 771 |
Protein length (aa) | 257 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF00333 | Ribosomal_S5 | Ribosomal protein S5, N-terminal domain | 3.0E-27 | 77 | 141 |
PF03719 | Ribosomal_S5_C | Ribosomal protein S5, C-terminal domain | 2.4E-22 | 161 | 232 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q90YS3|RS2_ICTPU | 40S ribosomal protein S2 OS=Ictalurus punctatus GN=rps2 PE=2 SV=1 | 25 | 254 | 1.0E-121 |
sp|P27952|RS2_RAT | 40S ribosomal protein S2 OS=Rattus norvegicus GN=Rps2 PE=1 SV=1 | 30 | 254 | 5.0E-119 |
sp|P25444|RS2_MOUSE | 40S ribosomal protein S2 OS=Mus musculus GN=Rps2 PE=1 SV=3 | 30 | 254 | 5.0E-119 |
sp|O18789|RS2_BOVIN | 40S ribosomal protein S2 OS=Bos taurus GN=RPS2 PE=2 SV=2 | 30 | 254 | 1.0E-118 |
sp|P15880|RS2_HUMAN | 40S ribosomal protein S2 OS=Homo sapiens GN=RPS2 PE=1 SV=2 | 30 | 254 | 1.0E-118 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|Q90YS3|RS2_ICTPU | 40S ribosomal protein S2 OS=Ictalurus punctatus GN=rps2 PE=2 SV=1 | 25 | 254 | 1.0E-121 |
sp|P27952|RS2_RAT | 40S ribosomal protein S2 OS=Rattus norvegicus GN=Rps2 PE=1 SV=1 | 30 | 254 | 5.0E-119 |
sp|P25444|RS2_MOUSE | 40S ribosomal protein S2 OS=Mus musculus GN=Rps2 PE=1 SV=3 | 30 | 254 | 5.0E-119 |
sp|O18789|RS2_BOVIN | 40S ribosomal protein S2 OS=Bos taurus GN=RPS2 PE=2 SV=2 | 30 | 254 | 1.0E-118 |
sp|P15880|RS2_HUMAN | 40S ribosomal protein S2 OS=Homo sapiens GN=RPS2 PE=1 SV=2 | 30 | 254 | 1.0E-118 |
sp|P31009|RS2_DROME | 40S ribosomal protein S2 OS=Drosophila melanogaster GN=RpS2 PE=1 SV=2 | 30 | 249 | 1.0E-118 |
sp|O74892|RS2_SCHPO | 40S ribosomal protein S2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps2 PE=1 SV=1 | 28 | 256 | 1.0E-118 |
sp|P27685|RS2_DICDI | 40S ribosomal protein S2 OS=Dictyostelium discoideum GN=rps2 PE=1 SV=1 | 11 | 249 | 8.0E-112 |
sp|P49154|RS2_URECA | 40S ribosomal protein S2 OS=Urechis caupo GN=RPS2 PE=2 SV=1 | 30 | 249 | 4.0E-110 |
sp|P46791|RS2_CRIGR | 40S ribosomal protein S2 (Fragment) OS=Cricetulus griseus GN=RPS2 PE=2 SV=1 | 37 | 233 | 8.0E-109 |
sp|P51403|RS2_CAEEL | 40S ribosomal protein S2 OS=Caenorhabditis elegans GN=rps-2 PE=3 SV=1 | 31 | 249 | 4.0E-108 |
sp|Q93VB8|RS22_ARATH | 40S ribosomal protein S2-2 OS=Arabidopsis thaliana GN=RPS2B PE=2 SV=1 | 32 | 254 | 4.0E-107 |
sp|Q8L8Y0|RS21_ARATH | 40S ribosomal protein S2-1 OS=Arabidopsis thaliana GN=RPS2A PE=2 SV=2 | 31 | 254 | 5.0E-107 |
sp|P49688|RS23_ARATH | 40S ribosomal protein S2-3 OS=Arabidopsis thaliana GN=RPS2C PE=1 SV=2 | 31 | 254 | 2.0E-106 |
sp|Q9SCM3|RS24_ARATH | 40S ribosomal protein S2-4 OS=Arabidopsis thaliana GN=RPS2D PE=2 SV=1 | 32 | 250 | 3.0E-106 |
sp|P25443|RS2_YEAST | 40S ribosomal protein S2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS2 PE=1 SV=3 | 32 | 245 | 8.0E-104 |
sp|O43992|RS2_LEIAM | 40S ribosomal protein S2 OS=Leishmania amazonensis PE=3 SV=1 | 32 | 253 | 2.0E-95 |
sp|Q975K0|RS5_SULTO | 30S ribosomal protein S5 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps5 PE=3 SV=1 | 34 | 231 | 4.0E-61 |
sp|A1RWR6|RS5_THEPD | 30S ribosomal protein S5 OS=Thermofilum pendens (strain Hrk 5) GN=rps5 PE=3 SV=1 | 35 | 231 | 4.0E-60 |
sp|A8AC00|RS5_IGNH4 | 30S ribosomal protein S5 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rps5 PE=3 SV=1 | 34 | 231 | 1.0E-59 |
sp|Q9YF95|RS5_AERPE | 30S ribosomal protein S5 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps5 PE=3 SV=1 | 36 | 236 | 4.0E-59 |
sp|C3NH89|RS5_SULIN | 30S ribosomal protein S5 OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rps5 PE=3 SV=1 | 34 | 231 | 2.0E-58 |
sp|Q9UX87|RS5_SULSO | 30S ribosomal protein S5 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps5 PE=3 SV=2 | 34 | 231 | 3.0E-58 |
sp|O05641|RS5_SULAC | 30S ribosomal protein S5 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps5 PE=3 SV=1 | 34 | 231 | 5.0E-58 |
sp|A2BMD9|RS5_HYPBU | 30S ribosomal protein S5 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps5 PE=3 SV=1 | 31 | 231 | 3.0E-57 |
sp|A1RU37|RS5_PYRIL | 30S ribosomal protein S5 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps5 PE=3 SV=1 | 36 | 225 | 8.0E-57 |
sp|A3MU88|RS5_PYRCJ | 30S ribosomal protein S5 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps5 PE=3 SV=1 | 36 | 225 | 3.0E-56 |
sp|A4YCY6|RS5_METS5 | 30S ribosomal protein S5 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rps5 PE=3 SV=1 | 34 | 231 | 6.0E-56 |
sp|A4WHQ8|RS5_PYRAR | 30S ribosomal protein S5 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps5 PE=3 SV=2 | 36 | 225 | 3.0E-55 |
sp|Q8ZXN9|RS5_PYRAE | 30S ribosomal protein S5 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps5 PE=3 SV=1 | 36 | 225 | 4.0E-55 |
sp|O28374|RS5_ARCFU | 30S ribosomal protein S5 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rps5 PE=3 SV=1 | 34 | 222 | 2.0E-54 |
sp|A0B9V0|RS5_METTP | 30S ribosomal protein S5 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps5 PE=3 SV=1 | 32 | 222 | 3.0E-54 |
sp|Q12ZT1|RS5_METBU | 30S ribosomal protein S5 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rps5 PE=3 SV=1 | 31 | 233 | 4.0E-54 |
sp|Q46GB5|RS5_METBF | 30S ribosomal protein S5 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rps5 PE=3 SV=1 | 33 | 233 | 1.0E-53 |
sp|Q8TRS7|RS5_METAC | 30S ribosomal protein S5 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rps5 PE=3 SV=1 | 33 | 228 | 5.0E-53 |
sp|Q8PV30|RS5_METMA | 30S ribosomal protein S5 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rps5 PE=3 SV=1 | 33 | 228 | 5.0E-53 |
sp|Q2FSG3|RS5_METHJ | 30S ribosomal protein S5 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rps5 PE=3 SV=1 | 32 | 222 | 2.0E-52 |
sp|Q9HPB4|RS5_HALSA | 30S ribosomal protein S5 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps5 PE=3 SV=1 | 36 | 233 | 6.0E-51 |
sp|O26131|RS5_METTH | 30S ribosomal protein S5 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rps5 PE=3 SV=1 | 34 | 221 | 8.0E-51 |
sp|Q0W1W8|RS5_METAR | 30S ribosomal protein S5 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps5 PE=3 SV=1 | 30 | 227 | 3.0E-50 |
sp|Q9HIS7|RS5_THEAC | 30S ribosomal protein S5 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rps5 PE=3 SV=1 | 33 | 247 | 1.0E-49 |
sp|P26815|RS5_HALMA | 30S ribosomal protein S5 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rps5 PE=3 SV=1 | 36 | 229 | 4.0E-49 |
sp|A3DNC7|RS5_STAMF | 30S ribosomal protein S5 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rps5 PE=3 SV=1 | 24 | 231 | 9.0E-49 |
sp|Q5JJG8|RS5_THEKO | 30S ribosomal protein S5 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps5 PE=3 SV=1 | 34 | 222 | 2.0E-48 |
sp|O59439|RS5_PYRHO | 30S ribosomal protein S5 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps5 PE=3 SV=1 | 35 | 230 | 3.0E-48 |
sp|Q8U017|RS5_PYRFU | 30S ribosomal protein S5 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps5 PE=1 SV=1 | 35 | 230 | 3.0E-48 |
sp|Q97BV6|RS5_THEVO | 30S ribosomal protein S5 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rps5 PE=3 SV=1 | 35 | 247 | 3.0E-48 |
sp|Q9V1V5|RS5_PYRAB | 30S ribosomal protein S5 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps5 PE=3 SV=1 | 35 | 230 | 4.0E-48 |
sp|A2SPM2|RS5_METLZ | 30S ribosomal protein S5 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps5 PE=3 SV=1 | 32 | 222 | 1.0E-47 |
sp|A3CT17|RS5_METMJ | 30S ribosomal protein S5 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps5 PE=3 SV=1 | 34 | 222 | 3.0E-47 |
sp|A7I5Q9|RS5_METB6 | 30S ribosomal protein S5 OS=Methanoregula boonei (strain 6A8) GN=rps5 PE=3 SV=1 | 32 | 227 | 3.0E-47 |
sp|A5UL68|RS5_METS3 | 30S ribosomal protein S5 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rps5 PE=3 SV=1 | 35 | 219 | 4.0E-47 |
sp|A4FWA1|RS5_METM5 | 30S ribosomal protein S5 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rps5 PE=3 SV=1 | 29 | 221 | 7.0E-47 |
sp|P54045|RS5_METJA | 30S ribosomal protein S5 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps5 PE=3 SV=1 | 35 | 219 | 2.0E-46 |
sp|Q6LXD3|RS5_METMP | 30S ribosomal protein S5 OS=Methanococcus maripaludis (strain S2 / LL) GN=rps5 PE=3 SV=1 | 29 | 221 | 3.0E-46 |
sp|Q3IMW8|RS5_NATPD | 30S ribosomal protein S5 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rps5 PE=3 SV=1 | 36 | 234 | 3.0E-46 |
sp|A9A9P4|RS5_METM6 | 30S ribosomal protein S5 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rps5 PE=3 SV=1 | 29 | 221 | 3.0E-46 |
sp|Q18GG9|RS5_HALWD | 30S ribosomal protein S5 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rps5 PE=3 SV=1 | 36 | 228 | 4.0E-46 |
sp|A6VH05|RS5_METM7 | 30S ribosomal protein S5 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rps5 PE=3 SV=1 | 29 | 221 | 7.0E-46 |
sp|Q8TZA6|RS5_METKA | 30S ribosomal protein S5 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps5 PE=3 SV=1 | 34 | 219 | 2.0E-44 |
sp|A6UQ64|RS5_METVS | 30S ribosomal protein S5 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rps5 PE=3 SV=1 | 29 | 221 | 3.0E-43 |
sp|P14036|RS5_METVA | 30S ribosomal protein S5 OS=Methanococcus vannielii GN=rps5 PE=3 SV=1 | 29 | 221 | 3.0E-43 |
sp|Q6L1A7|RS5_PICTO | 30S ribosomal protein S5 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rps5 PE=3 SV=1 | 33 | 236 | 9.0E-43 |
sp|Q74MD4|RS5_NANEQ | 30S ribosomal protein S5 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rps5 PE=3 SV=1 | 34 | 221 | 1.0E-42 |
sp|A0RUE7|RS5_CENSY | 30S ribosomal protein S5 OS=Cenarchaeum symbiosum (strain A) GN=rps5 PE=3 SV=1 | 36 | 224 | 2.0E-42 |
sp|A6UWV8|RS5_META3 | 30S ribosomal protein S5 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rps5 PE=3 SV=1 | 36 | 221 | 3.0E-42 |
sp|Q2NFX7|RS5_METST | 30S ribosomal protein S5 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rps5 PE=3 SV=1 | 34 | 221 | 7.0E-41 |
sp|Q9PQP3|RS5_UREPA | 30S ribosomal protein S5 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=rpsE PE=3 SV=1 | 77 | 228 | 6.0E-20 |
sp|B1AIN7|RS5_UREP2 | 30S ribosomal protein S5 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=rpsE PE=3 SV=1 | 77 | 228 | 6.0E-20 |
sp|B5ZB57|RS5_UREU1 | 30S ribosomal protein S5 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=rpsE PE=3 SV=1 | 77 | 228 | 8.0E-20 |
sp|A0M581|RS5_GRAFK | 30S ribosomal protein S5 OS=Gramella forsetii (strain KT0803) GN=rpsE PE=3 SV=1 | 65 | 239 | 1.0E-19 |
sp|Q6HPP1|RS5_BACHK | 30S ribosomal protein S5 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpsE PE=3 SV=1 | 76 | 221 | 6.0E-19 |
sp|Q63H73|RS5_BACCZ | 30S ribosomal protein S5 OS=Bacillus cereus (strain ZK / E33L) GN=rpsE PE=3 SV=1 | 76 | 221 | 6.0E-19 |
sp|Q73F79|RS5_BACC1 | 30S ribosomal protein S5 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpsE PE=3 SV=1 | 76 | 221 | 6.0E-19 |
sp|Q81VR3|RS5_BACAN | 30S ribosomal protein S5 OS=Bacillus anthracis GN=rpsE PE=3 SV=1 | 76 | 221 | 6.0E-19 |
sp|Q81J25|RS5_BACCR | 30S ribosomal protein S5 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpsE PE=3 SV=1 | 76 | 221 | 8.0E-19 |
sp|A0R8J7|RS5_BACAH | 30S ribosomal protein S5 OS=Bacillus thuringiensis (strain Al Hakam) GN=rpsE PE=3 SV=1 | 76 | 221 | 8.0E-19 |
sp|O52349|RS5_MYCGA | 30S ribosomal protein S5 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpsE PE=3 SV=2 | 76 | 223 | 8.0E-19 |
sp|A6GZ82|RS5_FLAPJ | 30S ribosomal protein S5 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpsE PE=3 SV=1 | 66 | 239 | 1.0E-18 |
sp|P02357|RS5_GEOSE | 30S ribosomal protein S5 OS=Geobacillus stearothermophilus GN=rpsE PE=1 SV=1 | 76 | 216 | 2.0E-18 |
sp|Q5L3S2|RS5_GEOKA | 30S ribosomal protein S5 OS=Geobacillus kaustophilus (strain HTA426) GN=rpsE PE=3 SV=1 | 76 | 216 | 2.0E-18 |
sp|Q38US8|RS5_LACSS | 30S ribosomal protein S5 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpsE PE=3 SV=1 | 77 | 239 | 2.0E-18 |
sp|Q5WLP5|RS5_BACSK | 30S ribosomal protein S5 OS=Bacillus clausii (strain KSM-K16) GN=rpsE PE=3 SV=1 | 76 | 221 | 3.0E-18 |
sp|A7GK37|RS5_BACCN | 30S ribosomal protein S5 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpsE PE=3 SV=1 | 76 | 221 | 3.0E-18 |
sp|A4IJK5|RS5_GEOTN | 30S ribosomal protein S5 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpsE PE=3 SV=1 | 76 | 216 | 3.0E-18 |
sp|P59123|RS5_OCEIH | 30S ribosomal protein S5 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpsE PE=3 SV=1 | 77 | 221 | 4.0E-18 |
sp|Q055C7|RS5_LEPBL | 30S ribosomal protein S5 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpsE1 PE=3 SV=1 | 79 | 239 | 5.0E-18 |
sp|Q04PV5|RS5_LEPBJ | 30S ribosomal protein S5 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpsE PE=3 SV=1 | 79 | 239 | 5.0E-18 |
sp|Q03PX4|RS5_LACBA | 30S ribosomal protein S5 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpsE PE=3 SV=1 | 76 | 221 | 5.0E-18 |
sp|Q9XD19|RS5_LEPIN | 30S ribosomal protein S5 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpsE PE=3 SV=3 | 79 | 239 | 6.0E-18 |
sp|Q72NH8|RS5_LEPIC | 30S ribosomal protein S5 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpsE PE=3 SV=3 | 79 | 239 | 6.0E-18 |
sp|A5USH2|RS5_ROSS1 | 30S ribosomal protein S5 OS=Roseiflexus sp. (strain RS-1) GN=rpsE PE=3 SV=1 | 76 | 239 | 8.0E-18 |
sp|P21467|RS5_BACSU | 30S ribosomal protein S5 OS=Bacillus subtilis (strain 168) GN=rpsE PE=1 SV=3 | 76 | 221 | 1.0E-17 |
sp|Q65P90|RS5_BACLD | 30S ribosomal protein S5 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpsE PE=3 SV=1 | 76 | 221 | 1.0E-17 |
sp|B9MKG4|RS5_CALBD | 30S ribosomal protein S5 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpsE PE=3 SV=1 | 77 | 221 | 1.0E-17 |
sp|A4XLR3|RS5_CALS8 | 30S ribosomal protein S5 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpsE PE=3 SV=1 | 76 | 219 | 1.0E-17 |
sp|A7Z0Q5|RS5_BACMF | 30S ribosomal protein S5 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpsE PE=3 SV=1 | 76 | 221 | 2.0E-17 |
sp|C5D3T4|RS5_GEOSW | 30S ribosomal protein S5 OS=Geobacillus sp. (strain WCH70) GN=rpsE PE=3 SV=1 | 76 | 216 | 2.0E-17 |
sp|Q0SQG1|RS5_CLOPS | 30S ribosomal protein S5 OS=Clostridium perfringens (strain SM101 / Type A) GN=rpsE PE=3 SV=1 | 77 | 221 | 2.0E-17 |
sp|Q8XHU0|RS5_CLOPE | 30S ribosomal protein S5 OS=Clostridium perfringens (strain 13 / Type A) GN=rpsE PE=3 SV=1 | 77 | 221 | 2.0E-17 |
sp|Q0TMR3|RS5_CLOP1 | 30S ribosomal protein S5 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpsE PE=3 SV=1 | 77 | 221 | 2.0E-17 |
sp|Q1D758|RS5_MYXXD | 30S ribosomal protein S5 OS=Myxococcus xanthus (strain DK 1622) GN=rpsE PE=3 SV=1 | 77 | 219 | 3.0E-17 |
sp|B1HMW3|RS5_LYSSC | 30S ribosomal protein S5 OS=Lysinibacillus sphaericus (strain C3-41) GN=rpsE PE=3 SV=1 | 74 | 221 | 3.0E-17 |
sp|A3DJI9|RS5_CLOTH | 30S ribosomal protein S5 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpsE PE=3 SV=1 | 67 | 221 | 3.0E-17 |
sp|B7GJ84|RS5_ANOFW | 30S ribosomal protein S5 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpsE PE=3 SV=1 | 76 | 216 | 3.0E-17 |
sp|A8F9A2|RS5_BACP2 | 30S ribosomal protein S5 OS=Bacillus pumilus (strain SAFR-032) GN=rpsE PE=3 SV=1 | 76 | 221 | 4.0E-17 |
sp|Q8EUD0|RS5_MYCPE | 30S ribosomal protein S5 OS=Mycoplasma penetrans (strain HF-2) GN=rpsE PE=3 SV=1 | 68 | 231 | 4.0E-17 |
sp|Q2IJ66|RS5_ANADE | 30S ribosomal protein S5 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpsE PE=3 SV=1 | 76 | 221 | 5.0E-17 |
sp|Q035A0|RS5_LACC3 | 30S ribosomal protein S5 OS=Lactobacillus casei (strain ATCC 334) GN=rpsE PE=3 SV=1 | 77 | 221 | 7.0E-17 |
sp|Q50301|RS5_MYCPN | 30S ribosomal protein S5 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=rpsE PE=3 SV=1 | 73 | 239 | 9.0E-17 |
sp|O67563|RS5_AQUAE | 30S ribosomal protein S5 OS=Aquifex aeolicus (strain VF5) GN=rpsE PE=3 SV=1 | 68 | 219 | 9.0E-17 |
sp|Q04G69|RS5_OENOB | 30S ribosomal protein S5 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpsE PE=3 SV=1 | 74 | 216 | 1.0E-16 |
sp|P47414|RS5_MYCGE | 30S ribosomal protein S5 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpsE PE=3 SV=1 | 65 | 239 | 1.0E-16 |
sp|B3QYE1|RS5_CHLT3 | 30S ribosomal protein S5 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rpsE PE=3 SV=1 | 76 | 222 | 1.0E-16 |
sp|A5IYW9|RS5_MYCAP | 30S ribosomal protein S5 OS=Mycoplasma agalactiae (strain PG2) GN=rpsE PE=3 SV=1 | 79 | 234 | 2.0E-16 |
sp|Q97EJ5|RS5_CLOAB | 30S ribosomal protein S5 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpsE PE=3 SV=1 | 77 | 221 | 2.0E-16 |
sp|P93014|RR5_ARATH | 30S ribosomal protein S5, chloroplastic OS=Arabidopsis thaliana GN=rps5 PE=2 SV=1 | 77 | 239 | 2.0E-16 |
sp|Q03ED3|RS5_PEDPA | 30S ribosomal protein S5 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpsE PE=3 SV=1 | 76 | 216 | 2.0E-16 |
sp|Q6F1X7|RS5_MESFL | 30S ribosomal protein S5 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsE PE=3 SV=1 | 65 | 223 | 2.0E-16 |
sp|Q2S3P7|RS5_SALRD | 30S ribosomal protein S5 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rpsE PE=3 SV=1 | 79 | 239 | 3.0E-16 |
sp|Q1ISA5|RS5_KORVE | 30S ribosomal protein S5 OS=Koribacter versatilis (strain Ellin345) GN=rpsE PE=3 SV=1 | 76 | 219 | 3.0E-16 |
sp|Q4G352|RR5_EMIHU | 30S ribosomal protein S5, chloroplastic OS=Emiliania huxleyi GN=rps5 PE=3 SV=1 | 78 | 226 | 3.0E-16 |
sp|A6TWG5|RS5_ALKMQ | 30S ribosomal protein S5 OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpsE PE=3 SV=1 | 70 | 216 | 3.0E-16 |
sp|Q98PZ9|RS5_MYCPU | 30S ribosomal protein S5 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpsE PE=3 SV=1 | 33 | 221 | 4.0E-16 |
sp|Q9Z9J7|RS5_BACHD | 30S ribosomal protein S5 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpsE PE=3 SV=1 | 76 | 221 | 4.0E-16 |
sp|Q839E7|RS5_ENTFA | 30S ribosomal protein S5 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpsE PE=3 SV=1 | 76 | 221 | 4.0E-16 |
sp|B9DM30|RS5_STACT | 30S ribosomal protein S5 OS=Staphylococcus carnosus (strain TM300) GN=rpsE PE=3 SV=1 | 76 | 219 | 5.0E-16 |
sp|A1ALV8|RS5_PELPD | 30S ribosomal protein S5 OS=Pelobacter propionicus (strain DSM 2379) GN=rpsE PE=3 SV=1 | 76 | 221 | 5.0E-16 |
sp|Q749A4|RS5_GEOSL | 30S ribosomal protein S5 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpsE PE=3 SV=1 | 76 | 221 | 6.0E-16 |
sp|B3EGX3|RS5_CHLL2 | 30S ribosomal protein S5 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-16 |
sp|B4SBW4|RS5_PELPB | 30S ribosomal protein S5 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-16 |
sp|Q9ST69|RR5_SPIOL | 30S ribosomal protein S5, chloroplastic OS=Spinacia oleracea GN=rps5 PE=1 SV=1 | 77 | 239 | 8.0E-16 |
sp|A7HM35|RS5_FERNB | 30S ribosomal protein S5 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsE PE=3 SV=1 | 78 | 234 | 8.0E-16 |
sp|Q88XW9|RS5_LACPL | 30S ribosomal protein S5 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpsE PE=3 SV=1 | 77 | 216 | 9.0E-16 |
sp|Q2LQC0|RS5_SYNAS | 30S ribosomal protein S5 OS=Syntrophus aciditrophicus (strain SB) GN=rpsE PE=3 SV=1 | 79 | 221 | 1.0E-15 |
sp|B2V7J6|RS5_SULSY | 30S ribosomal protein S5 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpsE PE=3 SV=1 | 76 | 221 | 1.0E-15 |
sp|A5VLI8|RS5_LACRD | 30S ribosomal protein S5 OS=Lactobacillus reuteri (strain DSM 20016) GN=rpsE PE=3 SV=1 | 77 | 216 | 1.0E-15 |
sp|A4J128|RS5_DESRM | 30S ribosomal protein S5 OS=Desulfotomaculum reducens (strain MI-1) GN=rpsE PE=3 SV=1 | 70 | 219 | 1.0E-15 |
sp|Q3A9T3|RS5_CARHZ | 30S ribosomal protein S5 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpsE PE=3 SV=1 | 70 | 219 | 1.0E-15 |
sp|A6Q1J5|RS5_NITSB | 30S ribosomal protein S5 OS=Nitratiruptor sp. (strain SB155-2) GN=rpsE PE=3 SV=1 | 76 | 221 | 1.0E-15 |
sp|Q18CH3|RS5_PEPD6 | 30S ribosomal protein S5 OS=Peptoclostridium difficile (strain 630) GN=rpsE PE=3 SV=1 | 77 | 220 | 1.0E-15 |
sp|B8G1Y3|RS5_DESHD | 30S ribosomal protein S5 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpsE PE=3 SV=1 | 70 | 219 | 1.0E-15 |
sp|B3E847|RS5_GEOLS | 30S ribosomal protein S5 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpsE PE=3 SV=1 | 76 | 216 | 1.0E-15 |
sp|B4S5B1|RS5_PROA2 | 30S ribosomal protein S5 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpsE PE=3 SV=1 | 76 | 216 | 1.0E-15 |
sp|A0ALV1|RS5_LISW6 | 30S ribosomal protein S5 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpsE PE=3 SV=1 | 77 | 219 | 1.0E-15 |
sp|Q8Y446|RS5_LISMO | 30S ribosomal protein S5 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpsE PE=3 SV=1 | 77 | 219 | 1.0E-15 |
sp|Q71WG3|RS5_LISMF | 30S ribosomal protein S5 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpsE PE=3 SV=1 | 77 | 219 | 1.0E-15 |
sp|A5D5H1|RS5_PELTS | 30S ribosomal protein S5 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpsE PE=3 SV=1 | 79 | 219 | 1.0E-15 |
sp|A7HBN5|RS5_ANADF | 30S ribosomal protein S5 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpsE PE=3 SV=1 | 76 | 221 | 2.0E-15 |
sp|Q4AAF7|RS5_MYCHJ | 30S ribosomal protein S5 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rpsE PE=3 SV=1 | 75 | 221 | 2.0E-15 |
sp|Q601J7|RS5_MYCH2 | 30S ribosomal protein S5 OS=Mycoplasma hyopneumoniae (strain 232) GN=rpsE PE=3 SV=1 | 75 | 221 | 2.0E-15 |
sp|Q4A8I8|RS5_MYCH7 | 30S ribosomal protein S5 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rpsE PE=3 SV=1 | 75 | 221 | 2.0E-15 |
sp|Q927M4|RS5_LISIN | 30S ribosomal protein S5 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpsE PE=3 SV=1 | 77 | 219 | 2.0E-15 |
sp|Q3APJ0|RS5_CHLCH | 30S ribosomal protein S5 OS=Chlorobium chlorochromatii (strain CaD3) GN=rpsE PE=3 SV=1 | 76 | 216 | 2.0E-15 |
sp|B1XJJ1|RS5_SYNP2 | 30S ribosomal protein S5 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rpsE PE=3 SV=1 | 78 | 239 | 2.0E-15 |
sp|A1BJ17|RS5_CHLPD | 30S ribosomal protein S5 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpsE PE=3 SV=1 | 76 | 216 | 2.0E-15 |
sp|Q3B6E5|RS5_CHLL7 | 30S ribosomal protein S5 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpsE PE=3 SV=1 | 76 | 216 | 2.0E-15 |
sp|A7GJ57|RS5_CLOBL | 30S ribosomal protein S5 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpsE PE=3 SV=1 | 70 | 221 | 2.0E-15 |
sp|A5I7I9|RS5_CLOBH | 30S ribosomal protein S5 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpsE PE=3 SV=1 | 70 | 221 | 2.0E-15 |
sp|A7FQ40|RS5_CLOB1 | 30S ribosomal protein S5 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpsE PE=3 SV=1 | 70 | 221 | 2.0E-15 |
sp|A0PXW3|RS5_CLONN | 30S ribosomal protein S5 OS=Clostridium novyi (strain NT) GN=rpsE PE=3 SV=1 | 76 | 221 | 2.0E-15 |
sp|B0TC73|RS5_HELMI | 30S ribosomal protein S5 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpsE PE=3 SV=1 | 76 | 219 | 3.0E-15 |
sp|A4SCS6|RS5_CHLPM | 30S ribosomal protein S5 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpsE PE=3 SV=1 | 76 | 216 | 3.0E-15 |
sp|Q250L5|RS5_DESHY | 30S ribosomal protein S5 OS=Desulfitobacterium hafniense (strain Y51) GN=rpsE PE=3 SV=1 | 70 | 219 | 3.0E-15 |
sp|B4U761|RS5_HYDS0 | 30S ribosomal protein S5 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rpsE PE=3 SV=1 | 76 | 221 | 3.0E-15 |
sp|Q8KAI8|RS5_CHLTE | 30S ribosomal protein S5 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpsE PE=3 SV=1 | 76 | 216 | 3.0E-15 |
sp|A4VSH0|RS5_STRSY | 30S ribosomal protein S5 OS=Streptococcus suis (strain 05ZYH33) GN=rpsE PE=3 SV=1 | 76 | 216 | 3.0E-15 |
sp|A4VYQ9|RS5_STRS2 | 30S ribosomal protein S5 OS=Streptococcus suis (strain 98HAH33) GN=rpsE PE=3 SV=1 | 76 | 216 | 3.0E-15 |
sp|B3QR82|RS5_CHLP8 | 30S ribosomal protein S5 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rpsE PE=3 SV=1 | 76 | 216 | 4.0E-15 |
sp|Q49ZF1|RS5_STAS1 | 30S ribosomal protein S5 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpsE PE=3 SV=1 | 76 | 219 | 5.0E-15 |
sp|A8AZK8|RS5_STRGC | 30S ribosomal protein S5 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpsE PE=3 SV=1 | 76 | 216 | 5.0E-15 |
sp|A7H0Z5|RS5_CAMC5 | 30S ribosomal protein S5 OS=Campylobacter curvus (strain 525.92) GN=rpsE PE=3 SV=1 | 76 | 220 | 5.0E-15 |
sp|C0QQP0|RS5_PERMH | 30S ribosomal protein S5 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rpsE PE=3 SV=1 | 64 | 219 | 5.0E-15 |
sp|B0UHV2|RS5_METS4 | 30S ribosomal protein S5 OS=Methylobacterium sp. (strain 4-46) GN=rpsE PE=3 SV=1 | 79 | 221 | 6.0E-15 |
sp|Q2RQX7|RS5_RHORT | 30S ribosomal protein S5 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpsE PE=3 SV=1 | 79 | 224 | 6.0E-15 |
sp|B8ELE6|RS5_METSB | 30S ribosomal protein S5 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpsE PE=3 SV=1 | 79 | 221 | 6.0E-15 |
sp|B3EP44|RS5_CHLPB | 30S ribosomal protein S5 OS=Chlorobium phaeobacteroides (strain BS1) GN=rpsE PE=3 SV=1 | 76 | 219 | 6.0E-15 |
sp|B9K8A3|RS5_THENN | 30S ribosomal protein S5 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpsE PE=3 SV=1 | 88 | 228 | 7.0E-15 |
sp|P0DE95|RS5_STRPQ | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-15 |
sp|Q48VT2|RS5_STRPM | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-15 |
sp|A2RC31|RS5_STRPG | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-15 |
sp|Q1J8Z6|RS5_STRPF | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-15 |
sp|Q1JJ45|RS5_STRPD | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-15 |
sp|Q1JP00|RS5_STRPC | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-15 |
sp|Q1JE42|RS5_STRPB | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-15 |
sp|P66585|RS5_STRP8 | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-15 |
sp|Q5XEB8|RS5_STRP6 | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-15 |
sp|P0DE94|RS5_STRP3 | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-15 |
sp|P66583|RS5_STRP1 | 30S ribosomal protein S5 OS=Streptococcus pyogenes serotype M1 GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-15 |
sp|Q1QN13|RS5_NITHX | 30S ribosomal protein S5 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsE PE=3 SV=1 | 79 | 239 | 8.0E-15 |
sp|B9LJE9|RS5_CHLSY | 30S ribosomal protein S5 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpsE PE=3 SV=1 | 76 | 225 | 8.0E-15 |
sp|A9WH83|RS5_CHLAA | 30S ribosomal protein S5 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpsE PE=3 SV=1 | 76 | 225 | 8.0E-15 |
sp|A7ZFZ5|RS5_CAMC1 | 30S ribosomal protein S5 OS=Campylobacter concisus (strain 13826) GN=rpsE PE=3 SV=1 | 76 | 220 | 8.0E-15 |
sp|P66582|RS5_STRR6 | 30S ribosomal protein S5 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpsE PE=3 SV=1 | 76 | 216 | 8.0E-15 |
sp|P66581|RS5_STRPN | 30S ribosomal protein S5 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpsE PE=3 SV=1 | 76 | 216 | 8.0E-15 |
sp|Q04ML9|RS5_STRP2 | 30S ribosomal protein S5 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpsE PE=3 SV=1 | 76 | 216 | 8.0E-15 |
sp|A6LEH4|RS5_PARD8 | 30S ribosomal protein S5 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpsE PE=3 SV=1 | 76 | 219 | 8.0E-15 |
sp|B2S2F3|RS5_TREPS | 30S ribosomal protein S5 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpsE PE=3 SV=1 | 71 | 221 | 9.0E-15 |
sp|O83236|RS5_TREPA | 30S ribosomal protein S5 OS=Treponema pallidum (strain Nichols) GN=rpsE PE=3 SV=1 | 71 | 221 | 9.0E-15 |
sp|P66580|RS5_STAAW | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain MW2) GN=rpsE PE=3 SV=1 | 81 | 216 | 9.0E-15 |
sp|A8Z340|RS5_STAAT | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpsE PE=3 SV=1 | 81 | 216 | 9.0E-15 |
sp|Q6G788|RS5_STAAS | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain MSSA476) GN=rpsE PE=3 SV=1 | 81 | 216 | 9.0E-15 |
sp|Q6GEK0|RS5_STAAR | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain MRSA252) GN=rpsE PE=3 SV=1 | 81 | 216 | 9.0E-15 |
sp|P66579|RS5_STAAN | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain N315) GN=rpsE PE=1 SV=1 | 81 | 216 | 9.0E-15 |
sp|P66578|RS5_STAAM | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpsE PE=3 SV=1 | 81 | 216 | 9.0E-15 |
sp|Q5HDX5|RS5_STAAC | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain COL) GN=rpsE PE=3 SV=1 | 81 | 216 | 9.0E-15 |
sp|Q2YYL4|RS5_STAAB | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpsE PE=3 SV=1 | 81 | 216 | 9.0E-15 |
sp|A5IV17|RS5_STAA9 | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain JH9) GN=rpsE PE=3 SV=1 | 81 | 216 | 9.0E-15 |
sp|Q2FW23|RS5_STAA8 | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpsE PE=3 SV=1 | 81 | 216 | 9.0E-15 |
sp|Q2FEQ6|RS5_STAA3 | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain USA300) GN=rpsE PE=3 SV=1 | 81 | 216 | 9.0E-15 |
sp|A6U3V8|RS5_STAA2 | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain JH1) GN=rpsE PE=3 SV=1 | 81 | 216 | 9.0E-15 |
sp|A7X5D8|RS5_STAA1 | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpsE PE=3 SV=1 | 81 | 216 | 9.0E-15 |
sp|O51448|RS5_BORBU | 30S ribosomal protein S5 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpsE PE=3 SV=1 | 79 | 218 | 9.0E-15 |
sp|Q4L897|RS5_STAHJ | 30S ribosomal protein S5 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpsE PE=3 SV=1 | 81 | 219 | 1.0E-14 |
sp|Q07KN5|RS5_RHOP5 | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpsE PE=3 SV=1 | 79 | 239 | 1.0E-14 |
sp|A6QJ75|RS5_STAAE | 30S ribosomal protein S5 OS=Staphylococcus aureus (strain Newman) GN=rpsE PE=3 SV=1 | 81 | 216 | 1.0E-14 |
sp|A6KYH8|RS5_BACV8 | 30S ribosomal protein S5 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpsE PE=3 SV=1 | 76 | 219 | 1.0E-14 |
sp|A6QCR5|RS5_SULNB | 30S ribosomal protein S5 OS=Sulfurovum sp. (strain NBC37-1) GN=rpsE PE=3 SV=1 | 81 | 224 | 1.0E-14 |
sp|Q03ZM9|RS5_LEUMM | 30S ribosomal protein S5 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpsE PE=3 SV=1 | 69 | 220 | 1.0E-14 |
sp|A4YSK9|RS5_BRASO | 30S ribosomal protein S5 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsE PE=3 SV=2 | 79 | 239 | 1.0E-14 |
sp|A5ELL0|RS5_BRASB | 30S ribosomal protein S5 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsE PE=3 SV=1 | 79 | 239 | 1.0E-14 |
sp|Q6YR05|RS5_ONYPE | 30S ribosomal protein S5 OS=Onion yellows phytoplasma (strain OY-M) GN=rpsE PE=3 SV=1 | 75 | 216 | 1.0E-14 |
sp|Q8CRH7|RS5_STAES | 30S ribosomal protein S5 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpsE PE=3 SV=1 | 81 | 219 | 1.0E-14 |
sp|Q5HM16|RS5_STAEQ | 30S ribosomal protein S5 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpsE PE=3 SV=1 | 81 | 219 | 1.0E-14 |
sp|A3CK81|RS5_STRSV | 30S ribosomal protein S5 OS=Streptococcus sanguinis (strain SK36) GN=rpsE PE=3 SV=1 | 76 | 216 | 1.0E-14 |
sp|B0K5R0|RS5_THEPX | 30S ribosomal protein S5 OS=Thermoanaerobacter sp. (strain X514) GN=rpsE PE=3 SV=1 | 70 | 239 | 1.0E-14 |
sp|B0KCL7|RS5_THEP3 | 30S ribosomal protein S5 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsE PE=3 SV=1 | 70 | 239 | 1.0E-14 |
sp|Q3SSU9|RS5_NITWN | 30S ribosomal protein S5 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsE PE=3 SV=1 | 79 | 239 | 1.0E-14 |
sp|B2UV65|RS5_HELPS | 30S ribosomal protein S5 OS=Helicobacter pylori (strain Shi470) GN=rpsE PE=3 SV=1 | 52 | 224 | 2.0E-14 |
sp|Q1CRV8|RS5_HELPH | 30S ribosomal protein S5 OS=Helicobacter pylori (strain HPAG1) GN=rpsE PE=3 SV=1 | 52 | 224 | 2.0E-14 |
sp|B6JNE1|RS5_HELP2 | 30S ribosomal protein S5 OS=Helicobacter pylori (strain P12) GN=rpsE PE=3 SV=1 | 52 | 224 | 2.0E-14 |
sp|Q1MPP8|RS5_LAWIP | 30S ribosomal protein S5 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpsE PE=3 SV=1 | 79 | 220 | 2.0E-14 |
sp|B1LWQ9|RS5_METRJ | 30S ribosomal protein S5 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsE PE=3 SV=1 | 79 | 249 | 2.0E-14 |
sp|Q39XY9|RS5_GEOMG | 30S ribosomal protein S5 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpsE PE=3 SV=1 | 76 | 229 | 2.0E-14 |
sp|Q0AUJ7|RS5_SYNWW | 30S ribosomal protein S5 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpsE PE=3 SV=1 | 75 | 219 | 2.0E-14 |
sp|Q3ZZQ7|RS5_DEHMC | 30S ribosomal protein S5 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpsE PE=3 SV=1 | 76 | 220 | 2.0E-14 |
sp|Q1AU46|RS5_RUBXD | 30S ribosomal protein S5 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rpsE PE=3 SV=1 | 76 | 215 | 2.0E-14 |
sp|Q211G5|RS5_RHOPB | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsE PE=3 SV=1 | 79 | 239 | 2.0E-14 |
sp|Q2IXP3|RS5_RHOP2 | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsE PE=3 SV=1 | 79 | 239 | 2.0E-14 |
sp|Q5LW41|RS5_RUEPO | 30S ribosomal protein S5 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpsE PE=3 SV=1 | 75 | 224 | 3.0E-14 |
sp|B8ISA2|RS5_METNO | 30S ribosomal protein S5 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsE PE=3 SV=1 | 79 | 221 | 3.0E-14 |
sp|O24705|RS5_SYNP6 | 30S ribosomal protein S5 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rpsE PE=3 SV=1 | 78 | 239 | 3.0E-14 |
sp|Q31L23|RS5_SYNE7 | 30S ribosomal protein S5 OS=Synechococcus elongatus (strain PCC 7942) GN=rpsE PE=3 SV=1 | 78 | 239 | 3.0E-14 |
sp|B5ELZ6|RS5_ACIF5 | 30S ribosomal protein S5 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-14 |
sp|B7J484|RS5_ACIF2 | 30S ribosomal protein S5 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-14 |
sp|Q64NM5|RS5_BACFR | 30S ribosomal protein S5 OS=Bacteroides fragilis (strain YCH46) GN=rpsE PE=3 SV=1 | 76 | 219 | 3.0E-14 |
sp|Q5L8C6|RS5_BACFN | 30S ribosomal protein S5 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpsE PE=3 SV=1 | 76 | 219 | 3.0E-14 |
sp|Q7M8E9|RS5_WOLSU | 30S ribosomal protein S5 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpsE PE=3 SV=1 | 76 | 224 | 3.0E-14 |
sp|A8LM74|RS5_DINSH | 30S ribosomal protein S5 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpsE PE=3 SV=1 | 75 | 221 | 3.0E-14 |
sp|A1VE99|RS5_DESVV | 30S ribosomal protein S5 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpsE PE=3 SV=1 | 77 | 219 | 3.0E-14 |
sp|Q72CG3|RS5_DESVH | 30S ribosomal protein S5 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpsE PE=3 SV=1 | 77 | 219 | 3.0E-14 |
sp|Q3Z964|RS5_DEHM1 | 30S ribosomal protein S5 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpsE PE=3 SV=1 | 76 | 220 | 3.0E-14 |
sp|B1Y8C0|RS5_LEPCP | 30S ribosomal protein S5 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpsE PE=3 SV=1 | 73 | 221 | 4.0E-14 |
sp|Q8R7X1|RS5_CALS4 | 30S ribosomal protein S5 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsE PE=3 SV=1 | 70 | 239 | 4.0E-14 |
sp|Q8A493|RS5_BACTN | 30S ribosomal protein S5 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpsE PE=3 SV=1 | 76 | 221 | 4.0E-14 |
sp|B6JEY2|RS5_OLICO | 30S ribosomal protein S5 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpsE PE=3 SV=1 | 79 | 239 | 4.0E-14 |
sp|A8MLF7|RS5_ALKOO | 30S ribosomal protein S5 OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpsE PE=3 SV=1 | 70 | 221 | 4.0E-14 |
sp|B1LBM3|RS5_THESQ | 30S ribosomal protein S5 OS=Thermotoga sp. (strain RQ2) GN=rpsE PE=3 SV=1 | 88 | 228 | 4.0E-14 |
sp|A5IMA0|RS5_THEP1 | 30S ribosomal protein S5 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpsE PE=3 SV=1 | 88 | 228 | 4.0E-14 |
sp|P66572|RS5_HELPY | 30S ribosomal protein S5 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpsE PE=3 SV=2 | 76 | 224 | 4.0E-14 |
sp|P66573|RS5_HELPJ | 30S ribosomal protein S5 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpsE PE=3 SV=2 | 76 | 224 | 4.0E-14 |
sp|A9W4S3|RS5_METEP | 30S ribosomal protein S5 OS=Methylobacterium extorquens (strain PA1) GN=rpsE PE=3 SV=1 | 79 | 219 | 4.0E-14 |
sp|B7L0T3|RS5_METC4 | 30S ribosomal protein S5 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsE PE=3 SV=1 | 79 | 219 | 4.0E-14 |
sp|B1Z776|RS5_METPB | 30S ribosomal protein S5 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsE PE=3 SV=1 | 79 | 219 | 5.0E-14 |
sp|Q30Z59|RS5_DESAG | 30S ribosomal protein S5 OS=Desulfovibrio alaskensis (strain G20) GN=rpsE PE=3 SV=1 | 77 | 220 | 5.0E-14 |
sp|A0T0J5|RR5_PHATC | 30S ribosomal protein S5, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rps5 PE=3 SV=1 | 75 | 210 | 5.0E-14 |
sp|Q134U6|RS5_RHOPS | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsE PE=3 SV=1 | 79 | 239 | 5.0E-14 |
sp|Q9X1J2|RS5_THEMA | 30S ribosomal protein S5 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpsE PE=3 SV=1 | 88 | 228 | 6.0E-14 |
sp|B2IK79|RS5_BEII9 | 30S ribosomal protein S5 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpsE PE=3 SV=1 | 79 | 221 | 6.0E-14 |
sp|Q17ZC2|RS5_HELAH | 30S ribosomal protein S5 OS=Helicobacter acinonychis (strain Sheeba) GN=rpsE PE=3 SV=1 | 52 | 224 | 6.0E-14 |
sp|Q5HSA7|RS5_CAMJR | 30S ribosomal protein S5 OS=Campylobacter jejuni (strain RM1221) GN=rpsE PE=3 SV=1 | 76 | 220 | 6.0E-14 |
sp|A1W1U3|RS5_CAMJJ | 30S ribosomal protein S5 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpsE PE=3 SV=1 | 76 | 220 | 6.0E-14 |
sp|Q9PLY8|RS5_CAMJE | 30S ribosomal protein S5 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpsE PE=3 SV=1 | 76 | 220 | 6.0E-14 |
sp|A7H639|RS5_CAMJD | 30S ribosomal protein S5 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpsE PE=3 SV=1 | 76 | 220 | 6.0E-14 |
sp|A8FP04|RS5_CAMJ8 | 30S ribosomal protein S5 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpsE PE=3 SV=1 | 76 | 220 | 6.0E-14 |
sp|A1W325|RS5_ACISJ | 30S ribosomal protein S5 OS=Acidovorax sp. (strain JS42) GN=rpsE PE=3 SV=1 | 77 | 222 | 6.0E-14 |
sp|B9MBV4|RS5_ACIET | 30S ribosomal protein S5 OS=Acidovorax ebreus (strain TPSY) GN=rpsE PE=3 SV=1 | 77 | 222 | 6.0E-14 |
sp|A7HWS8|RS5_PARL1 | 30S ribosomal protein S5 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpsE PE=3 SV=1 | 79 | 224 | 7.0E-14 |
sp|Q2NIX1|RS5_AYWBP | 30S ribosomal protein S5 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpsE PE=3 SV=1 | 77 | 216 | 7.0E-14 |
sp|C6C1A2|RS5_DESAD | 30S ribosomal protein S5 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rpsE PE=3 SV=1 | 77 | 219 | 8.0E-14 |
sp|Q3A6N0|RS5_PELCD | 30S ribosomal protein S5 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpsE PE=3 SV=1 | 76 | 221 | 8.0E-14 |
sp|Q16AC7|RS5_ROSDO | 30S ribosomal protein S5 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpsE PE=3 SV=1 | 75 | 224 | 8.0E-14 |
sp|A8ESW0|RS5_ARCB4 | 30S ribosomal protein S5 OS=Arcobacter butzleri (strain RM4018) GN=rpsE PE=3 SV=1 | 77 | 221 | 8.0E-14 |
sp|Q661C5|RS5_BORBP | 30S ribosomal protein S5 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpsE PE=3 SV=1 | 79 | 218 | 9.0E-14 |
sp|P51298|RR5_PORPU | 30S ribosomal protein S5, chloroplastic OS=Porphyra purpurea GN=rps5 PE=3 SV=1 | 78 | 239 | 9.0E-14 |
sp|B8G6Q8|RS5_CHLAD | 30S ribosomal protein S5 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpsE PE=3 SV=1 | 76 | 225 | 9.0E-14 |
sp|B2A4F6|RS5_NATTJ | 30S ribosomal protein S5 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpsE PE=3 SV=1 | 77 | 221 | 1.0E-13 |
sp|Q89JA1|RS5_BRADU | 30S ribosomal protein S5 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsE PE=3 SV=1 | 79 | 239 | 1.0E-13 |
sp|Q6B8W9|RR5_GRATL | 30S ribosomal protein S5, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rps5 PE=3 SV=1 | 78 | 239 | 1.0E-13 |
sp|Q2W2K8|RS5_MAGSA | 30S ribosomal protein S5 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpsE PE=3 SV=1 | 79 | 219 | 1.0E-13 |
sp|P23402|RR5_CYAPA | 30S ribosomal protein S5, cyanelle OS=Cyanophora paradoxa GN=rps5 PE=3 SV=1 | 75 | 225 | 1.0E-13 |
sp|Q1XDJ0|RR5_PYRYE | 30S ribosomal protein S5, chloroplastic OS=Pyropia yezoensis GN=rps5 PE=3 SV=1 | 78 | 239 | 1.0E-13 |
sp|Q0SN12|RS5_BORAP | 30S ribosomal protein S5 OS=Borrelia afzelii (strain PKo) GN=rpsE PE=3 SV=1 | 79 | 218 | 1.0E-13 |
sp|B8DNB3|RS5_DESVM | 30S ribosomal protein S5 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpsE PE=3 SV=1 | 77 | 220 | 1.0E-13 |
sp|A0RM28|RS5_CAMFF | 30S ribosomal protein S5 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rpsE PE=3 SV=1 | 76 | 220 | 1.0E-13 |
sp|Q2RFR4|RS5_MOOTA | 30S ribosomal protein S5 OS=Moorella thermoacetica (strain ATCC 39073) GN=rpsE PE=3 SV=1 | 77 | 216 | 2.0E-13 |
sp|A8IAP6|RS5_AZOC5 | 30S ribosomal protein S5 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsE PE=3 SV=1 | 79 | 239 | 2.0E-13 |
sp|Q7VGC7|RS5_HELHP | 30S ribosomal protein S5 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpsE PE=3 SV=1 | 81 | 224 | 2.0E-13 |
sp|B7KI03|RS5_CYAP7 | 30S ribosomal protein S5 OS=Cyanothece sp. (strain PCC 7424) GN=rpsE PE=3 SV=1 | 78 | 239 | 2.0E-13 |
sp|Q67JW0|RS5_SYMTH | 30S ribosomal protein S5 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpsE PE=3 SV=1 | 76 | 219 | 2.0E-13 |
sp|B0C1E9|RS5_ACAM1 | 30S ribosomal protein S5 OS=Acaryochloris marina (strain MBIC 11017) GN=rpsE PE=3 SV=1 | 78 | 239 | 2.0E-13 |
sp|A9BRW8|RS5_DELAS | 30S ribosomal protein S5 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpsE PE=3 SV=1 | 73 | 219 | 2.0E-13 |
sp|Q28UT7|RS5_JANSC | 30S ribosomal protein S5 OS=Jannaschia sp. (strain CCS1) GN=rpsE PE=3 SV=1 | 75 | 216 | 3.0E-13 |
sp|A1B044|RS5_PARDP | 30S ribosomal protein S5 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpsE PE=3 SV=1 | 75 | 221 | 3.0E-13 |
sp|Q2JFF9|RS5_FRASC | 30S ribosomal protein S5 OS=Frankia sp. (strain CcI3) GN=rpsE PE=3 SV=1 | 79 | 219 | 3.0E-13 |
sp|B2T734|RS5_BURPP | 30S ribosomal protein S5 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-13 |
sp|Q0RRQ4|RS5_FRAAA | 30S ribosomal protein S5 OS=Frankia alni (strain ACN14a) GN=rpsE PE=3 SV=1 | 79 | 219 | 3.0E-13 |
sp|A8LB15|RS5_FRASN | 30S ribosomal protein S5 OS=Frankia sp. (strain EAN1pec) GN=rpsE PE=3 SV=1 | 79 | 219 | 3.0E-13 |
sp|A1R8S9|RS5_ARTAT | 30S ribosomal protein S5 OS=Arthrobacter aurescens (strain TC1) GN=rpsE PE=3 SV=1 | 79 | 239 | 4.0E-13 |
sp|Q318K0|RS5_PROM9 | 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain MIT 9312) GN=rpsE PE=3 SV=1 | 78 | 239 | 4.0E-13 |
sp|Q74L73|RS5_LACJO | 30S ribosomal protein S5 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpsE PE=3 SV=1 | 77 | 221 | 4.0E-13 |
sp|Q046A9|RS5_LACGA | 30S ribosomal protein S5 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpsE PE=3 SV=1 | 77 | 221 | 4.0E-13 |
sp|Q1WSA7|RS5_LACS1 | 30S ribosomal protein S5 OS=Lactobacillus salivarius (strain UCC118) GN=rpsE PE=3 SV=1 | 77 | 216 | 4.0E-13 |
sp|A6LLN0|RS5_THEM4 | 30S ribosomal protein S5 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpsE PE=3 SV=1 | 78 | 205 | 4.0E-13 |
sp|A1WK99|RS5_VEREI | 30S ribosomal protein S5 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpsE PE=3 SV=1 | 73 | 222 | 4.0E-13 |
sp|A0LIK7|RS5_SYNFM | 30S ribosomal protein S5 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpsE PE=3 SV=1 | 76 | 216 | 5.0E-13 |
sp|Q1GK12|RS5_RUEST | 30S ribosomal protein S5 OS=Ruegeria sp. (strain TM1040) GN=rpsE PE=3 SV=1 | 75 | 224 | 5.0E-13 |
sp|A8G745|RS5_PROM2 | 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain MIT 9215) GN=rpsE PE=3 SV=1 | 78 | 239 | 5.0E-13 |
sp|B3QBW3|RS5_RHOPT | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsE PE=3 SV=1 | 79 | 239 | 5.0E-13 |
sp|Q6N4V0|RS5_RHOPA | 30S ribosomal protein S5 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsE PE=1 SV=3 | 79 | 239 | 5.0E-13 |
sp|Q6KI38|RS5_MYCMO | 30S ribosomal protein S5 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpsE PE=3 SV=1 | 81 | 221 | 6.0E-13 |
sp|A1USR1|RS5_BARBK | 30S ribosomal protein S5 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpsE PE=3 SV=1 | 79 | 221 | 6.0E-13 |
sp|A6X0D5|RS5_OCHA4 | 30S ribosomal protein S5 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpsE PE=3 SV=1 | 79 | 219 | 7.0E-13 |
sp|Q6ME47|RS5_PARUW | 30S ribosomal protein S5 OS=Protochlamydia amoebophila (strain UWE25) GN=rpsE PE=3 SV=1 | 77 | 229 | 7.0E-13 |
sp|B4RT45|RS5_ALTMD | 30S ribosomal protein S5 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpsE PE=3 SV=1 | 73 | 221 | 7.0E-13 |
sp|Q8RIH3|RS5_FUSNN | 30S ribosomal protein S5 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpsE PE=3 SV=1 | 78 | 219 | 7.0E-13 |
sp|A5FZU8|RS5_ACICJ | 30S ribosomal protein S5 OS=Acidiphilium cryptum (strain JF-5) GN=rpsE PE=3 SV=1 | 77 | 221 | 8.0E-13 |
sp|A2SLE0|RS5_METPP | 30S ribosomal protein S5 OS=Methylibium petroleiphilum (strain PM1) GN=rpsE PE=3 SV=1 | 77 | 222 | 8.0E-13 |
sp|Q7UZW0|RS5_PROMP | 30S ribosomal protein S5 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rpsE PE=3 SV=1 | 78 | 239 | 9.0E-13 |
sp|Q1IX89|RS5_DEIGD | 30S ribosomal protein S5 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpsE PE=3 SV=1 | 76 | 234 | 9.0E-13 |
sp|Q1QDG9|RS5_PSYCK | 30S ribosomal protein S5 OS=Psychrobacter cryohalolentis (strain K5) GN=rpsE PE=3 SV=1 | 77 | 219 | 9.0E-13 |
sp|Q4FUD9|RS5_PSYA2 | 30S ribosomal protein S5 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpsE PE=3 SV=1 | 77 | 219 | 9.0E-13 |
sp|Q30TU7|RS5_SULDN | 30S ribosomal protein S5 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpsE PE=3 SV=1 | 77 | 219 | 1.0E-12 |
sp|B2ITN9|RS5_NOSP7 | 30S ribosomal protein S5 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpsE PE=3 SV=1 | 78 | 239 | 1.0E-12 |
sp|A0JZ68|RS5_ARTS2 | 30S ribosomal protein S5 OS=Arthrobacter sp. (strain FB24) GN=rpsE PE=3 SV=1 | 79 | 239 | 1.0E-12 |
sp|A6MW17|RR5_RHDSA | 30S ribosomal protein S5, chloroplastic OS=Rhodomonas salina GN=rps5 PE=3 SV=1 | 78 | 229 | 1.0E-12 |
sp|Q6AD11|RS5_LEIXX | 30S ribosomal protein S5 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rpsE PE=3 SV=1 | 79 | 221 | 1.0E-12 |
sp|A3PF31|RS5_PROM0 | 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain MIT 9301) GN=rpsE PE=3 SV=1 | 78 | 239 | 1.0E-12 |
sp|A0T0Y9|RR5_THAPS | 30S ribosomal protein S5, chloroplastic OS=Thalassiosira pseudonana GN=rps5 PE=3 SV=1 | 76 | 229 | 1.0E-12 |
sp|A7IPQ3|RS5_XANP2 | 30S ribosomal protein S5 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpsE PE=3 SV=1 | 79 | 239 | 1.0E-12 |
sp|B2UEK2|RS5_RALPJ | 30S ribosomal protein S5 OS=Ralstonia pickettii (strain 12J) GN=rpsE PE=3 SV=1 | 77 | 221 | 1.0E-12 |
sp|Q47LL0|RS5_THEFY | 30S ribosomal protein S5 OS=Thermobifida fusca (strain YX) GN=rpsE PE=3 SV=1 | 79 | 219 | 1.0E-12 |
sp|A0L5Z0|RS5_MAGMM | 30S ribosomal protein S5 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-12 |
sp|C3LRP1|RS5_VIBCM | 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpsE PE=3 SV=1 | 77 | 219 | 2.0E-12 |
sp|Q9KP01|RS5_VIBCH | 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpsE PE=3 SV=1 | 77 | 219 | 2.0E-12 |
sp|A5F563|RS5_VIBC3 | 30S ribosomal protein S5 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpsE PE=3 SV=1 | 77 | 219 | 2.0E-12 |
sp|B7IHW3|RS5_THEAB | 30S ribosomal protein S5 OS=Thermosipho africanus (strain TCF52B) GN=rpsE PE=3 SV=1 | 77 | 205 | 2.0E-12 |
sp|Q8YPJ5|RS5_NOSS1 | 30S ribosomal protein S5 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rpsE PE=3 SV=1 | 78 | 239 | 2.0E-12 |
sp|Q3MFA5|RS5_ANAVT | 30S ribosomal protein S5 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rpsE PE=3 SV=1 | 78 | 239 | 2.0E-12 |
sp|B7VLE0|RS5_VIBTL | 30S ribosomal protein S5 OS=Vibrio tasmaniensis (strain LGP32) GN=rpsE PE=3 SV=1 | 77 | 219 | 2.0E-12 |
sp|P66571|RS5_BRUSU | 30S ribosomal protein S5 OS=Brucella suis biovar 1 (strain 1330) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-12 |
sp|B0CH15|RS5_BRUSI | 30S ribosomal protein S5 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-12 |
sp|P66570|RS5_BRUME | 30S ribosomal protein S5 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-12 |
sp|C0RJI4|RS5_BRUMB | 30S ribosomal protein S5 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-12 |
sp|A9M5N3|RS5_BRUC2 | 30S ribosomal protein S5 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-12 |
sp|Q57CS5|RS5_BRUAB | 30S ribosomal protein S5 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-12 |
sp|Q2YRT3|RS5_BRUA2 | 30S ribosomal protein S5 OS=Brucella abortus (strain 2308) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-12 |
sp|B2S662|RS5_BRUA1 | 30S ribosomal protein S5 OS=Brucella abortus (strain S19) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-12 |
sp|Q5NQ48|RS5_ZYMMO | 30S ribosomal protein S5 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rpsE PE=3 SV=1 | 76 | 220 | 2.0E-12 |
sp|Q21QP0|RS5_RHOFT | 30S ribosomal protein S5 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpsE PE=3 SV=1 | 77 | 220 | 2.0E-12 |
sp|Q7VKF0|RS5_HAEDU | 30S ribosomal protein S5 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpsE PE=3 SV=1 | 76 | 221 | 2.0E-12 |
sp|B7K232|RS5_CYAP8 | 30S ribosomal protein S5 OS=Cyanothece sp. (strain PCC 8801) GN=rpsE PE=3 SV=1 | 78 | 239 | 2.0E-12 |
sp|P59126|RS5_THEEB | 30S ribosomal protein S5 OS=Thermosynechococcus elongatus (strain BP-1) GN=rpsE PE=3 SV=1 | 78 | 239 | 2.0E-12 |
sp|Q7MTN0|RS5_PORGI | 30S ribosomal protein S5 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpsE PE=3 SV=1 | 76 | 239 | 2.0E-12 |
sp|A2BYS0|RS5_PROM5 | 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain MIT 9515) GN=rpsE PE=3 SV=1 | 78 | 239 | 2.0E-12 |
sp|A4TED4|RS5_MYCGI | 30S ribosomal protein S5 OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-12 |
sp|A5VQY9|RS5_BRUO2 | 30S ribosomal protein S5 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpsE PE=3 SV=1 | 79 | 219 | 3.0E-12 |
sp|Q3AMP6|RS5_SYNSC | 30S ribosomal protein S5 OS=Synechococcus sp. (strain CC9605) GN=rpsE PE=3 SV=1 | 78 | 217 | 3.0E-12 |
sp|Q2SU44|RS5_BURTA | 30S ribosomal protein S5 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|C5CQ83|RS5_VARPS | 30S ribosomal protein S5 OS=Variovorax paradoxus (strain S110) GN=rpsE PE=3 SV=1 | 77 | 216 | 3.0E-12 |
sp|A9H3L2|RS5_GLUDA | 30S ribosomal protein S5 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|A3N374|RS5_ACTP2 | 30S ribosomal protein S5 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpsE PE=3 SV=1 | 76 | 221 | 3.0E-12 |
sp|Q7U4I4|RS5_SYNPX | 30S ribosomal protein S5 OS=Synechococcus sp. (strain WH8102) GN=rpsE PE=3 SV=1 | 78 | 217 | 3.0E-12 |
sp|Q63Q28|RS5_BURPS | 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain K96243) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|A3NEG2|RS5_BURP6 | 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 668) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|Q3JMT0|RS5_BURP1 | 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 1710b) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|A3P096|RS5_BURP0 | 30S ribosomal protein S5 OS=Burkholderia pseudomallei (strain 1106a) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|A1V886|RS5_BURMS | 30S ribosomal protein S5 OS=Burkholderia mallei (strain SAVP1) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|Q62GM2|RS5_BURMA | 30S ribosomal protein S5 OS=Burkholderia mallei (strain ATCC 23344) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|A2S7J3|RS5_BURM9 | 30S ribosomal protein S5 OS=Burkholderia mallei (strain NCTC 10229) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|A3MRX1|RS5_BURM7 | 30S ribosomal protein S5 OS=Burkholderia mallei (strain NCTC 10247) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|A9ADL0|RS5_BURM1 | 30S ribosomal protein S5 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|B2JI48|RS5_BURP8 | 30S ribosomal protein S5 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|Q4A5D8|RS5_MYCS5 | 30S ribosomal protein S5 OS=Mycoplasma synoviae (strain 53) GN=rpsE PE=3 SV=2 | 73 | 219 | 3.0E-12 |
sp|Q1LI54|RS5_CUPMC | 30S ribosomal protein S5 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-12 |
sp|Q87SZ6|RS5_VIBPA | 30S ribosomal protein S5 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpsE PE=3 SV=1 | 77 | 219 | 3.0E-12 |
sp|A7MWH5|RS5_VIBCB | 30S ribosomal protein S5 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpsE PE=3 SV=1 | 77 | 219 | 3.0E-12 |
sp|A1S235|RS5_SHEAM | 30S ribosomal protein S5 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpsE PE=3 SV=1 | 77 | 220 | 3.0E-12 |
sp|Q488Z6|RS5_COLP3 | 30S ribosomal protein S5 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rpsE PE=3 SV=1 | 77 | 224 | 3.0E-12 |
sp|Q9RSL1|RS5_DEIRA | 30S ribosomal protein S5 OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=rpsE PE=3 SV=1 | 76 | 204 | 4.0E-12 |
sp|Q5Z1Q5|RS5_NOCFA | 30S ribosomal protein S5 OS=Nocardia farcinica (strain IFM 10152) GN=rpsE PE=3 SV=1 | 79 | 221 | 4.0E-12 |
sp|A5GIS9|RS5_SYNPW | 30S ribosomal protein S5 OS=Synechococcus sp. (strain WH7803) GN=rpsE PE=3 SV=1 | 78 | 217 | 4.0E-12 |
sp|Q7MPH1|RS5_VIBVY | 30S ribosomal protein S5 OS=Vibrio vulnificus (strain YJ016) GN=rpsE PE=3 SV=1 | 77 | 219 | 4.0E-12 |
sp|Q8DE57|RS5_VIBVU | 30S ribosomal protein S5 OS=Vibrio vulnificus (strain CMCP6) GN=rpsE PE=3 SV=1 | 77 | 219 | 4.0E-12 |
sp|Q15X56|RS5_PSEA6 | 30S ribosomal protein S5 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpsE PE=3 SV=1 | 77 | 229 | 4.0E-12 |
sp|C1B029|RS5_RHOOB | 30S ribosomal protein S5 OS=Rhodococcus opacus (strain B4) GN=rpsE PE=3 SV=1 | 79 | 219 | 4.0E-12 |
sp|Q0S3F9|RS5_RHOJR | 30S ribosomal protein S5 OS=Rhodococcus jostii (strain RHA1) GN=rpsE PE=3 SV=1 | 79 | 219 | 4.0E-12 |
sp|Q2S929|RS5_HAHCH | 30S ribosomal protein S5 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsE PE=3 SV=1 | 76 | 216 | 4.0E-12 |
sp|Q13TI7|RS5_BURXL | 30S ribosomal protein S5 OS=Burkholderia xenovorans (strain LB400) GN=rpsE PE=3 SV=1 | 77 | 221 | 4.0E-12 |
sp|A2CC44|RS5_PROM3 | 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain MIT 9303) GN=rpsE PE=3 SV=1 | 78 | 217 | 4.0E-12 |
sp|Q8UE35|RS5_AGRFC | 30S ribosomal protein S5 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpsE PE=3 SV=1 | 79 | 219 | 5.0E-12 |
sp|B0JHY7|RS5_MICAN | 30S ribosomal protein S5 OS=Microcystis aeruginosa (strain NIES-843) GN=rpsE PE=3 SV=1 | 78 | 229 | 5.0E-12 |
sp|A2BTC1|RS5_PROMS | 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain AS9601) GN=rpsE PE=3 SV=1 | 78 | 239 | 5.0E-12 |
sp|Q7V529|RS5_PROMM | 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain MIT 9313) GN=rpsE PE=3 SV=1 | 78 | 217 | 5.0E-12 |
sp|Q46IS5|RS5_PROMT | 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain NATL2A) GN=rpsE PE=3 SV=1 | 78 | 217 | 5.0E-12 |
sp|Q7V9X8|RS5_PROMA | 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=rpsE PE=3 SV=1 | 78 | 217 | 5.0E-12 |
sp|A2C4Y3|RS5_PROM1 | 30S ribosomal protein S5 OS=Prochlorococcus marinus (strain NATL1A) GN=rpsE PE=3 SV=1 | 78 | 239 | 5.0E-12 |
sp|A7HZM3|RS5_CAMHC | 30S ribosomal protein S5 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rpsE PE=3 SV=1 | 76 | 220 | 5.0E-12 |
sp|B0UX31|RS5_HISS2 | 30S ribosomal protein S5 OS=Histophilus somni (strain 2336) GN=rpsE PE=3 SV=1 | 76 | 221 | 6.0E-12 |
sp|Q0I145|RS5_HAES1 | 30S ribosomal protein S5 OS=Haemophilus somnus (strain 129Pt) GN=rpsE PE=3 SV=1 | 76 | 221 | 6.0E-12 |
sp|B4R8N4|RS5_PHEZH | 30S ribosomal protein S5 OS=Phenylobacterium zucineum (strain HLK1) GN=rpsE PE=3 SV=1 | 76 | 219 | 6.0E-12 |
sp|Q47J86|RS5_DECAR | 30S ribosomal protein S5 OS=Dechloromonas aromatica (strain RCB) GN=rpsE PE=3 SV=1 | 77 | 221 | 6.0E-12 |
sp|Q39KF0|RS5_BURL3 | 30S ribosomal protein S5 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpsE PE=3 SV=1 | 77 | 221 | 6.0E-12 |
sp|B4E5D7|RS5_BURCJ | 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpsE PE=3 SV=1 | 77 | 221 | 6.0E-12 |
sp|Q0BUN3|RS5_GRABC | 30S ribosomal protein S5 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpsE PE=3 SV=1 | 79 | 221 | 6.0E-12 |
sp|A4JAQ7|RS5_BURVG | 30S ribosomal protein S5 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpsE PE=3 SV=1 | 77 | 221 | 7.0E-12 |
sp|Q0BJ29|RS5_BURCM | 30S ribosomal protein S5 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpsE PE=3 SV=1 | 77 | 221 | 7.0E-12 |
sp|A0K3P2|RS5_BURCH | 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain HI2424) GN=rpsE PE=3 SV=1 | 77 | 221 | 7.0E-12 |
sp|B1JU39|RS5_BURCC | 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpsE PE=3 SV=1 | 77 | 221 | 7.0E-12 |
sp|Q1BRW5|RS5_BURCA | 30S ribosomal protein S5 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpsE PE=3 SV=1 | 77 | 221 | 7.0E-12 |
sp|B1YRP6|RS5_BURA4 | 30S ribosomal protein S5 OS=Burkholderia ambifaria (strain MC40-6) GN=rpsE PE=3 SV=1 | 77 | 221 | 7.0E-12 |
sp|Q6MJ29|RS5_BDEBA | 30S ribosomal protein S5 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpsE PE=3 SV=1 | 76 | 216 | 7.0E-12 |
sp|P44374|RS5_HAEIN | 30S ribosomal protein S5 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpsE PE=3 SV=1 | 76 | 221 | 7.0E-12 |
sp|A5UHU8|RS5_HAEIG | 30S ribosomal protein S5 OS=Haemophilus influenzae (strain PittGG) GN=rpsE PE=3 SV=1 | 76 | 221 | 7.0E-12 |
sp|A5UDT0|RS5_HAEIE | 30S ribosomal protein S5 OS=Haemophilus influenzae (strain PittEE) GN=rpsE PE=3 SV=1 | 76 | 221 | 7.0E-12 |
sp|Q4QMA4|RS5_HAEI8 | 30S ribosomal protein S5 OS=Haemophilus influenzae (strain 86-028NP) GN=rpsE PE=3 SV=1 | 76 | 221 | 7.0E-12 |
sp|A9KWB9|RS5_SHEB9 | 30S ribosomal protein S5 OS=Shewanella baltica (strain OS195) GN=rpsE PE=3 SV=1 | 77 | 219 | 7.0E-12 |
sp|A6WHU5|RS5_SHEB8 | 30S ribosomal protein S5 OS=Shewanella baltica (strain OS185) GN=rpsE PE=3 SV=1 | 77 | 219 | 7.0E-12 |
sp|A3DA55|RS5_SHEB5 | 30S ribosomal protein S5 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpsE PE=3 SV=1 | 77 | 219 | 7.0E-12 |
sp|B8EBI8|RS5_SHEB2 | 30S ribosomal protein S5 OS=Shewanella baltica (strain OS223) GN=rpsE PE=3 SV=1 | 77 | 219 | 7.0E-12 |
sp|A1TJT4|RS5_ACIAC | 30S ribosomal protein S5 OS=Acidovorax citrulli (strain AAC00-1) GN=rpsE PE=3 SV=1 | 77 | 222 | 8.0E-12 |
sp|Q0BYD1|RS5_HYPNA | 30S ribosomal protein S5 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpsE PE=3 SV=1 | 71 | 219 | 8.0E-12 |
sp|Q9CL47|RS5_PASMU | 30S ribosomal protein S5 OS=Pasteurella multocida (strain Pm70) GN=rpsE PE=3 SV=1 | 76 | 221 | 8.0E-12 |
sp|Q12G86|RS5_POLSJ | 30S ribosomal protein S5 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpsE PE=3 SV=1 | 77 | 222 | 8.0E-12 |
sp|Q6LV99|RS5_PHOPR | 30S ribosomal protein S5 OS=Photobacterium profundum GN=rpsE PE=3 SV=1 | 77 | 220 | 8.0E-12 |
sp|C3MAZ7|RS5_RHISN | 30S ribosomal protein S5 OS=Rhizobium sp. (strain NGR234) GN=rpsE PE=3 SV=1 | 79 | 219 | 9.0E-12 |
sp|A5GVX6|RS5_SYNR3 | 30S ribosomal protein S5 OS=Synechococcus sp. (strain RCC307) GN=rpsE PE=3 SV=1 | 78 | 217 | 9.0E-12 |
sp|Q89A82|RS5_BUCBP | 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpsE PE=3 SV=2 | 77 | 216 | 9.0E-12 |
sp|Q3AW77|RS5_SYNS9 | 30S ribosomal protein S5 OS=Synechococcus sp. (strain CC9902) GN=rpsE PE=3 SV=1 | 78 | 217 | 9.0E-12 |
sp|A1JS11|RS5_YERE8 | 30S ribosomal protein S5 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpsE PE=3 SV=1 | 76 | 219 | 9.0E-12 |
sp|B3R7F1|RS5_CUPTR | 30S ribosomal protein S5 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rpsE PE=3 SV=1 | 77 | 221 | 1.0E-11 |
sp|Q0K636|RS5_CUPNH | 30S ribosomal protein S5 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpsE PE=3 SV=1 | 77 | 221 | 1.0E-11 |
sp|Q664T8|RS5_YERPS | 30S ribosomal protein S5 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpsE PE=3 SV=1 | 76 | 219 | 1.0E-11 |
sp|A4TH09|RS5_YERPP | 30S ribosomal protein S5 OS=Yersinia pestis (strain Pestoides F) GN=rpsE PE=3 SV=1 | 76 | 219 | 1.0E-11 |
sp|Q1CCW1|RS5_YERPN | 30S ribosomal protein S5 OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpsE PE=3 SV=1 | 76 | 219 | 1.0E-11 |
sp|Q8ZJ95|RS5_YERPE | 30S ribosomal protein S5 OS=Yersinia pestis GN=rpsE PE=3 SV=1 | 76 | 219 | 1.0E-11 |
sp|Q1C2W4|RS5_YERPA | 30S ribosomal protein S5 OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpsE PE=3 SV=1 | 76 | 219 | 1.0E-11 |
sp|A7FNL7|RS5_YERP3 | 30S ribosomal protein S5 OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpsE PE=3 SV=1 | 76 | 219 | 1.0E-11 |
sp|Q0ANR7|RS5_MARMM | 30S ribosomal protein S5 OS=Maricaulis maris (strain MCS10) GN=rpsE PE=3 SV=1 | 76 | 219 | 1.0E-11 |
sp|B1WQS7|RS5_CYAA5 | 30S ribosomal protein S5 OS=Cyanothece sp. (strain ATCC 51142) GN=rpsE PE=3 SV=1 | 78 | 239 | 1.0E-11 |
sp|C1CXE9|RS5_DEIDV | 30S ribosomal protein S5 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsE PE=3 SV=1 | 76 | 204 | 1.0E-11 |
sp|Q3IJK2|RS5_PSEHT | 30S ribosomal protein S5 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpsE PE=3 SV=1 | 75 | 219 | 1.0E-11 |
sp|Q46WG1|RS5_CUPPJ | 30S ribosomal protein S5 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpsE PE=3 SV=1 | 77 | 221 | 1.0E-11 |
sp|Q9A8T6|RS5_CAUCR | 30S ribosomal protein S5 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpsE PE=3 SV=1 | 79 | 219 | 1.0E-11 |
sp|B8H4F1|RS5_CAUCN | 30S ribosomal protein S5 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpsE PE=3 SV=1 | 79 | 219 | 1.0E-11 |
sp|Q8XV29|RS5_RALSO | 30S ribosomal protein S5 OS=Ralstonia solanacearum (strain GMI1000) GN=rpsE PE=3 SV=1 | 77 | 221 | 1.0E-11 |
sp|Q6A6P3|RS5_PROAC | 30S ribosomal protein S5 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=rpsE PE=3 SV=1 | 79 | 221 | 1.0E-11 |
sp|Q1LTC1|RS5_BAUCH | 30S ribosomal protein S5 OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rpsE PE=3 SV=1 | 66 | 221 | 1.0E-11 |
sp|A8GKI0|RS5_SERP5 | 30S ribosomal protein S5 OS=Serratia proteamaculans (strain 568) GN=rpsE PE=3 SV=1 | 76 | 219 | 1.0E-11 |
sp|Q73S92|RS5_MYCPA | 30S ribosomal protein S5 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=rpsE PE=3 SV=1 | 79 | 219 | 1.0E-11 |
sp|B2HCT8|RS5_MYCMM | 30S ribosomal protein S5 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=rpsE PE=3 SV=1 | 79 | 219 | 1.0E-11 |
sp|A1VJ32|RS5_POLNA | 30S ribosomal protein S5 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpsE PE=3 SV=1 | 77 | 222 | 1.0E-11 |
sp|A5WCK7|RS5_PSYWF | 30S ribosomal protein S5 OS=Psychrobacter sp. (strain PRwf-1) GN=rpsE PE=3 SV=1 | 77 | 219 | 1.0E-11 |
sp|B5FG26|RS5_VIBFM | 30S ribosomal protein S5 OS=Vibrio fischeri (strain MJ11) GN=rpsE PE=3 SV=1 | 77 | 220 | 1.0E-11 |
sp|Q5E897|RS5_VIBF1 | 30S ribosomal protein S5 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpsE PE=3 SV=1 | 77 | 220 | 1.0E-11 |
sp|A3Q999|RS5_SHELP | 30S ribosomal protein S5 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpsE PE=3 SV=1 | 77 | 220 | 2.0E-11 |
sp|Q65QX2|RS5_MANSM | 30S ribosomal protein S5 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpsE PE=3 SV=1 | 76 | 221 | 2.0E-11 |
sp|Q04BZ8|RS5_LACDB | 30S ribosomal protein S5 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpsE PE=3 SV=1 | 77 | 221 | 2.0E-11 |
sp|Q1GBK1|RS5_LACDA | 30S ribosomal protein S5 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpsE PE=3 SV=1 | 77 | 221 | 2.0E-11 |
sp|Q98N40|RS5_RHILO | 30S ribosomal protein S5 OS=Rhizobium loti (strain MAFF303099) GN=rpsE PE=3 SV=2 | 79 | 219 | 2.0E-11 |
sp|Q85FU7|RR5_CYAME | 30S ribosomal protein S5, chloroplastic OS=Cyanidioschyzon merolae GN=rps5 PE=3 SV=1 | 78 | 224 | 2.0E-11 |
sp|B1VAD1|RS5_PHYAS | 30S ribosomal protein S5 OS=Phytoplasma australiense GN=rpsE PE=3 SV=1 | 78 | 216 | 2.0E-11 |
sp|Q11HR9|RS5_CHESB | 30S ribosomal protein S5 OS=Chelativorans sp. (strain BNC1) GN=rpsE PE=3 SV=1 | 79 | 221 | 2.0E-11 |
sp|Q5FU00|RS5_GLUOX | 30S ribosomal protein S5 OS=Gluconobacter oxydans (strain 621H) GN=rpsE PE=3 SV=1 | 77 | 221 | 2.0E-11 |
sp|B8DW30|RS5_BIFA0 | 30S ribosomal protein S5 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=rpsE PE=3 SV=1 | 76 | 219 | 2.0E-11 |
sp|A6U876|RS5_SINMW | 30S ribosomal protein S5 OS=Sinorhizobium medicae (strain WSM419) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-11 |
sp|Q92QF3|RS5_RHIME | 30S ribosomal protein S5 OS=Rhizobium meliloti (strain 1021) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-11 |
sp|A4WVJ1|RS5_RHOS5 | 30S ribosomal protein S5 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rpsE PE=3 SV=1 | 75 | 221 | 2.0E-11 |
sp|Q7VQD1|RS5_BLOFL | 30S ribosomal protein S5 OS=Blochmannia floridanus GN=rpsE PE=3 SV=1 | 74 | 219 | 2.0E-11 |
sp|B9JVQ4|RS5_AGRVS | 30S ribosomal protein S5 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-11 |
sp|A6VLK5|RS5_ACTSZ | 30S ribosomal protein S5 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpsE PE=3 SV=1 | 76 | 221 | 2.0E-11 |
sp|Q6FZD9|RS5_BARQU | 30S ribosomal protein S5 OS=Bartonella quintana (strain Toulouse) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-11 |
sp|A0QSG6|RS5_MYCS2 | 30S ribosomal protein S5 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=rpsE PE=1 SV=1 | 79 | 219 | 2.0E-11 |
sp|Q9Z7S3|RS5_CHLPN | 30S ribosomal protein S5 OS=Chlamydia pneumoniae GN=rpsE PE=3 SV=1 | 76 | 232 | 2.0E-11 |
sp|A9IW04|RS5_BART1 | 30S ribosomal protein S5 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpsE PE=3 SV=1 | 79 | 219 | 2.0E-11 |
sp|Q057C1|RS5_BUCCC | 30S ribosomal protein S5 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpsE PE=3 SV=1 | 76 | 221 | 3.0E-11 |
sp|A0PM82|RS5_MYCUA | 30S ribosomal protein S5 OS=Mycobacterium ulcerans (strain Agy99) GN=rpsE PE=3 SV=1 | 79 | 219 | 3.0E-11 |
sp|Q7UN03|RS5_RHOBA | 30S ribosomal protein S5 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=rpsE PE=3 SV=1 | 77 | 221 | 3.0E-11 |
sp|A1T0C5|RS5_PSYIN | 30S ribosomal protein S5 OS=Psychromonas ingrahamii (strain 37) GN=rpsE PE=3 SV=1 | 77 | 219 | 3.0E-11 |
sp|Q0ABF8|RS5_ALKEH | 30S ribosomal protein S5 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpsE PE=3 SV=1 | 77 | 220 | 3.0E-11 |
sp|Q1R0F8|RS5_CHRSD | 30S ribosomal protein S5 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rpsE PE=3 SV=1 | 77 | 216 | 3.0E-11 |
sp|A0LRN7|RS5_ACIC1 | 30S ribosomal protein S5 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpsE PE=3 SV=1 | 79 | 239 | 3.0E-11 |
sp|Q1MIC4|RS5_RHIL3 | 30S ribosomal protein S5 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpsE PE=3 SV=1 | 79 | 219 | 3.0E-11 |
sp|Q0I088|RS5_SHESR | 30S ribosomal protein S5 OS=Shewanella sp. (strain MR-7) GN=rpsE PE=3 SV=1 | 77 | 219 | 3.0E-11 |
sp|Q0HNS0|RS5_SHESM | 30S ribosomal protein S5 OS=Shewanella sp. (strain MR-4) GN=rpsE PE=3 SV=1 | 77 | 219 | 3.0E-11 |
sp|A0KRP1|RS5_SHESA | 30S ribosomal protein S5 OS=Shewanella sp. (strain ANA-3) GN=rpsE PE=3 SV=1 | 77 | 219 | 3.0E-11 |
sp|P59124|RS5_SHEON | 30S ribosomal protein S5 OS=Shewanella oneidensis (strain MR-1) GN=rpsE PE=3 SV=1 | 77 | 219 | 3.0E-11 |
sp|A6TEV5|RS5_KLEP7 | 30S ribosomal protein S5 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpsE PE=3 SV=1 | 76 | 230 | 3.0E-11 |
sp|B0T2D9|RS5_CAUSK | 30S ribosomal protein S5 OS=Caulobacter sp. (strain K31) GN=rpsE PE=3 SV=1 | 79 | 219 | 3.0E-11 |
sp|B5ZYV2|RS5_RHILW | 30S ribosomal protein S5 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpsE PE=3 SV=1 | 79 | 219 | 3.0E-11 |
GO Term | Description | Terminal node |
---|---|---|
GO:0005840 | ribosome | Yes |
GO:0006412 | translation | Yes |
GO:0003735 | structural constituent of ribosome | Yes |
GO:0003723 | RNA binding | Yes |
GO:0009059 | macromolecule biosynthetic process | No |
GO:0097159 | organic cyclic compound binding | No |
GO:0019538 | protein metabolic process | No |
GO:0044271 | cellular nitrogen compound biosynthetic process | No |
GO:0044260 | cellular macromolecule metabolic process | No |
GO:0044238 | primary metabolic process | No |
GO:0005488 | binding | No |
GO:1901576 | organic substance biosynthetic process | No |
GO:0009987 | cellular process | No |
GO:0006807 | nitrogen compound metabolic process | No |
GO:0003676 | nucleic acid binding | No |
GO:0044249 | cellular biosynthetic process | No |
GO:0008152 | metabolic process | No |
GO:0043228 | non-membrane-bounded organelle | No |
GO:0003674 | molecular_function | No |
GO:0005575 | cellular_component | No |
GO:1901564 | organonitrogen compound metabolic process | No |
GO:0006518 | peptide metabolic process | No |
GO:0005198 | structural molecule activity | No |
GO:1901566 | organonitrogen compound biosynthetic process | No |
GO:0043232 | intracellular non-membrane-bounded organelle | No |
GO:0008150 | biological_process | No |
GO:0034641 | cellular nitrogen compound metabolic process | No |
GO:0043603 | cellular amide metabolic process | No |
GO:0110165 | cellular anatomical entity | No |
GO:0043604 | amide biosynthetic process | No |
GO:0043226 | organelle | No |
GO:0043170 | macromolecule metabolic process | No |
GO:1901363 | heterocyclic compound binding | No |
GO:0044237 | cellular metabolic process | No |
GO:0034645 | cellular macromolecule biosynthetic process | No |
GO:0043043 | peptide biosynthetic process | No |
GO:0071704 | organic substance metabolic process | No |
GO:0043229 | intracellular organelle | No |
GO:0009058 | biosynthetic process | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 12 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Agabi119p4|045680 MADAPRGRGGFGRGRDRGRGRRGPRRGGRKEEDKEWVPVTKLGRLVKDGKIKSMEEIYLFSLPVKEFQIVDFFLP KLKDEVMKIMPVQKQTQAGQRTRFKAFVAIGDFDGHVGLGVKCAKEVATAIRGAIILAKLSVIPVRRGYWGAALG EPHTVPTKVSGKVGSVMCRLLPAPRGTGIVAAPACKRLLQLAGVQDVYTQAQGSTATMGNFLKATFAAITKTYAF LTPDLWREIPLSRLPFDEFSAHLALSATKKY* |
Coding | >Agabi119p4|045680 ATGGCAGACGCTCCCAGAGGACGTGGTGGATTTGGCCGAGGACGTGATCGCGGTAGGGGCCGCCGGGGACCCCGC CGTGGCGGTCGCAAAGAAGAGGACAAGGAATGGGTCCCCGTCACTAAACTCGGTCGTCTCGTGAAAGATGGAAAG ATCAAATCAATGGAAGAGATCTACCTCTTCTCTCTCCCCGTCAAGGAATTCCAGATCGTCGACTTTTTCCTCCCC AAACTGAAGGACGAGGTGATGAAAATTATGCCCGTGCAGAAACAAACACAAGCTGGCCAGCGAACCCGTTTCAAA GCTTTCGTAGCGATCGGTGACTTTGATGGTCATGTCGGGCTCGGTGTCAAATGTGCAAAAGAAGTGGCGACGGCC ATTCGTGGGGCCATCATCCTCGCCAAACTTTCTGTTATTCCTGTCCGCCGTGGCTACTGGGGAGCGGCACTCGGT GAGCCTCACACTGTCCCAACCAAAGTTAGTGGCAAAGTGGGGTCAGTCATGTGTCGTCTCCTGCCTGCGCCCCGT GGAACTGGCATCGTTGCTGCCCCTGCGTGTAAACGTCTGCTACAGCTTGCTGGTGTGCAAGATGTATACACACAA GCGCAGGGTTCCACAGCCACGATGGGTAACTTCTTAAAAGCCACTTTTGCTGCGATCACAAAGACATATGCTTTC CTGACACCTGACTTGTGGCGAGAGATACCTCTATCGAGACTGCCGTTTGATGAGTTTAGTGCACACTTGGCGCTT AGTGCCACGAAAAAGTACTAG |
Transcript | >Agabi119p4|045680 ATGGCAGACGCTCCCAGAGGACGTGGTGGATTTGGCCGAGGACGTGATCGCGGTAGGGGCCGCCGGGGACCCCGC CGTGGCGGTCGCAAAGAAGAGGACAAGGAATGGGTCCCCGTCACTAAACTCGGTCGTCTCGTGAAAGATGGAAAG ATCAAATCAATGGAAGAGATCTACCTCTTCTCTCTCCCCGTCAAGGAATTCCAGATCGTCGACTTTTTCCTCCCC AAACTGAAGGACGAGGTGATGAAAATTATGCCCGTGCAGAAACAAACACAAGCTGGCCAGCGAACCCGTTTCAAA GCTTTCGTAGCGATCGGTGACTTTGATGGTCATGTCGGGCTCGGTGTCAAATGTGCAAAAGAAGTGGCGACGGCC ATTCGTGGGGCCATCATCCTCGCCAAACTTTCTGTTATTCCTGTCCGCCGTGGCTACTGGGGAGCGGCACTCGGT GAGCCTCACACTGTCCCAACCAAAGTTAGTGGCAAAGTGGGGTCAGTCATGTGTCGTCTCCTGCCTGCGCCCCGT GGAACTGGCATCGTTGCTGCCCCTGCGTGTAAACGTCTGCTACAGCTTGCTGGTGTGCAAGATGTATACACACAA GCGCAGGGTTCCACAGCCACGATGGGTAACTTCTTAAAAGCCACTTTTGCTGCGATCACAAAGACATATGCTTTC CTGACACCTGACTTGTGGCGAGAGATACCTCTATCGAGACTGCCGTTTGATGAGTTTAGTGCACACTTGGCGCTT AGTGCCACGAAAAAGTACTAG |
Gene | >Agabi119p4|045680 ATGGCAGACGCTCCCAGAGGACGTGGTGGATTTGGCCGAGGACGTGATCGCGGTAGGGGCCGCCGGGGACCCCGC CGTGGCGGTCGCAAAGAAGAGGACAAGGAATGGTATGTTATCCTGTGTTCAAAAGATTTCTCTATCTTATATCGC CGTAGGGTCCCCGTCACTAAACTCGGTCGTCTCGTGAAAGATGGAAAGATCAAATCAATGGAAGAGATCTACCTC TTCTCTCTCCCCGTCAAGGAATTCCAGATCGTCGACTTTTTCCTCCCCAAACTGAAGGACGAGGTGATGAAAATT ATGCCCGTGCAGAAACAAACACAAGCTGGCCAGCGAACCCGTTTCAAAGCTTTCGTAGCGATCGGTGACTTTGAT GGTCATGTCGGGCTCGGTGTCAAATGTGCAAAAGAAGTGGCGACGGCCATTCGTGGGGCCATCATCCTCGCCAAA CTTTCTGTTATTCCTGTCCGCCGTGGCTACTGGGGAGCGGCACTCGGTGAGCCTCACACTGTCCCAACCAAAGTT AGTGGCAAAGTGGGGTCAGTCATGTGTCGTCTCCTGCCTGCGCCCCGTGGAACTGGCATCGTTGCTGCCCCTGCG TGTAAACGTCTGCTACAGCTTGCTGGTGTGCAAGATGTATACACACAAGCGCAGGGTTCCACAGCCACGATGGGT AACTTCTTAAAAGCCACTTTTGCTGCGGTGAGTTGTGGTCCCTGTGTTGTGGGAGAGCAGATGCTGACGATGGAG ATACAGATCACAAAGACATATGCTTTCCTGACACCTGACTTGTGGCGAGAGATACCTCTATCGAGACTGCCGTTT GATGAGTTTAGTGCACACTTGGCGCTTAGTGCCACGAAAAAGTACTAG |